F454370

General Info

Members Datasets Scaffolds Average Seq Length
493 299 433 351

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10001656|JGI25151J46595_100016564
Length 406
Sequence MRVMVTGGAGFIGSALVRHLVGTVGAEVLNIDKLTYAGNLASLSSVENAANYRFLRADICDRAAMQEAFASFRPEIVMHLAAESHVDRSISGAGDFIQTNIVGTFSLLDAARGYWDGLEAEAKSAFRFLHVSTDEVYGSLGDDGLFEEVTAYDPSSPYSASKAASDHLAIAWHRTYGLPVVVSNCSNNYGPFHFPEKLIPLIILNALEGKPLPVYGNGANIRDWLYVEDHARALFTIASRGRPGEKYNVGGRNERRNIEVVERICAILDSVFPGKEAHSRLITNVTDRPGHDARYAIDATKIETELGWKAEENFDSGIEKTVRWYLDNEWWWRPLRDNVYSGERLGTFKGRXXCALPSRANRDRWSSRFWSWLRPMASNWWPSAVRTSTLPIPPACCRLWRRHGPT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
5 2643221568 Rhizobium sp. Root564 Isolate Unclassified
6 2718217927 Rhizobium sp. N324 Isolate Nodule
7 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
8 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
9 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
10 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
11 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
12 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
13 2718218423 Rhizobium sp. N941 Isolate Nodule
14 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
15 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
16 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
17 2721755809 Rhizobium sp. N541 Isolate Nodule
18 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
19 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
20 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
21 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
22 2738541293 Rhizobium sp. GV031 Isolate Unclassified
23 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
24 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
25 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
26 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
27 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
28 2838061910 Rhizobium phaseoli L15 Isolate Nodule
29 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
30 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
31 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
32 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
33 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
34 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
35 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
36 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
37 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
38 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
39 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
40 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
41 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
42 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
43 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
44 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
45 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
46 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
47 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
48 2933599457 Rhizobium phaseoli M3 Isolate Nodule
49 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
50 2996887358 Rhizobium sp. R711 Isolate Nodule
51 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
52 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
53 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
54 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
55 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
56 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
60 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
75 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
76 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
77 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
78 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
91 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
222 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
252 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
274 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
275 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
283 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
284 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
285 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
286 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
289 8005275841 Rhizobium sp. N4311 Isolate Nodule
290 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
291 8005321885 Rhizobium sp. R72 Isolate Nodule
292 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
293 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
294 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
295 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
296 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
297 8018176218 Rhizobium sp. N122 Isolate Nodule
298 8024501048 Rhizobium sp. H4 Isolate Nodule
299 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.83
Metatranscriptomes 0
Isolates 12.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.36
Nodule 8.52
Rhizoplane 2.23
Rhizosphere 68.97
Stem 0
Stem Tuber 0
Unclassified 8.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2038536 2162886007 Bacteria 5256
2 SwRhRL2b_contig_2292987 2162886007 Bacteria 31145
3 JGI24740J21852_10038367 3300001979 Bacteria 1470
4 JGI24739J22299_10000461 3300001989 Bacteria 14302
5 JGI24737J22298_10003559 3300001990 Bacteria 5492
6 JGI24735J21928_10001002 3300002067 Bacteria 10092
7 JGI24735J21928_10005298 3300002067 Bacteria 4282
8 JGI24738J21930_10000331 3300002075 Bacteria 12980
9 JGI24744J21845_10000501 3300002077 Bacteria 6956
10 JGI25152J39213_1000481 3300002773 Bacteria 22817
11 JGI25152J39213_1004710 3300002773 Bacteria 4220
12 JGI25150J39212_1000175 3300002774 Bacteria 35998
13 JGI25151J46595_10000518 3300003187 Bacteria 35998
14 JGI25151J46595_10001656 3300003187 Bacteria 14617
15 JGI25165J46597_1000499 3300003214 Bacteria 37816
16 JGI25153J46596_10005250 3300003215 Bacteria 6811
17 rootH1_10079410 3300003323 Bacteria 4771
18 Ga0055526_1011642 3300003771 Bacteria 3937
19 Ga0055524_1019675 3300003775 Bacteria 2300
20 Ga0055528_1001812 3300003790 Bacteria 12218
21 Ga0055528_1004074 3300003790 Bacteria 7134
22 Ga0065165_1003208 3300005262 Bacteria 11920
23 Ga0065704_10001247 3300005289 Bacteria 22290
24 Ga0065704_10001414 3300005289 Bacteria 9375
25 Ga0065704_10070346 3300005289 Bacteria 31193
26 Ga0070658_10000068 3300005327 Bacteria 102788
27 Ga0070658_10002371 3300005327 Bacteria 15809
28 Ga0070658_10018367 3300005327 Bacteria 5599
29 Ga0070658_10321549 3300005327 Bacteria 1321
30 Ga0070683_100005689 3300005329 Bacteria 10410
31 Ga0070683_100010674 3300005329 Bacteria 7898
32 Ga0070690_100004148 3300005330 Bacteria 8014
33 Ga0070670_100000201 3300005331 Bacteria 55479
34 Ga0068869_100000348 3300005334 Bacteria 24802
35 Ga0070666_10005604 3300005335 Bacteria 7704
36 Ga0070666_10010306 3300005335 Bacteria 5844
37 Ga0070680_100104246 3300005336 Bacteria 2357
38 Ga0070682_100033344 3300005337 Bacteria 3128
39 Ga0068868_100000411 3300005338 Bacteria 28958
40 Ga0070660_100002865 3300005339 Bacteria 11879
41 Ga0070660_100006536 3300005339 Bacteria 8086
42 Ga0070660_100008150 3300005339 Bacteria 7322
43 Ga0070691_10022964 3300005341 Bacteria 2895
44 Ga0070675_100095681 3300005354 Bacteria 2494
45 Ga0070671_100000587 3300005355 Bacteria 25952
46 Ga0070671_100009223 3300005355 Bacteria 7926
47 Ga0070671_100179523 3300005355 Bacteria 1792
48 Ga0070674_100002362 3300005356 Bacteria 10416
49 Ga0070674_100096009 3300005356 Bacteria 2150
50 Ga0070673_100000010 3300005364 Bacteria 153851
51 Ga0070673_100048867 3300005364 Bacteria 3300
52 Ga0070659_100013035 3300005366 Bacteria 6182
53 Ga0070667_100002617 3300005367 Bacteria 15601
54 Ga0070667_100020836 3300005367 Bacteria 5445
55 Ga0070667_100065275 3300005367 Bacteria 3091
56 Ga0070714_100046210 3300005435 Bacteria 3692
57 Ga0070714_100160549 3300005435 Bacteria 2033
58 Ga0070663_100134093 3300005455 Bacteria 1884
59 Ga0070678_100002067 3300005456 Bacteria 10886
60 Ga0070662_100008303 3300005457 Bacteria 6765
61 Ga0070662_100158059 3300005457 Bacteria 1771
62 Ga0068867_100000019 3300005459 Bacteria 97503
63 Ga0070679_100097747 3300005530 Bacteria 2923
64 Ga0070684_100007725 3300005535 Bacteria 8381
65 Ga0070684_100009982 3300005535 Bacteria 7505
66 Ga0068853_100000580 3300005539 Bacteria 24987
67 Ga0068853_100002226 3300005539 Bacteria 14500
68 Ga0068853_100031722 3300005539 Bacteria 4470
69 Ga0070672_100286038 3300005543 Bacteria 1395
70 Ga0070665_100002057 3300005548 Bacteria 22632
71 Ga0070665_100038790 3300005548 Bacteria 4789
72 Ga0068855_100092862 3300005563 Bacteria 3480
73 Ga0068855_100160209 3300005563 Bacteria 2555
74 Ga0068857_100154716 3300005577 Bacteria 2079
75 Ga0068856_100004335 3300005614 Bacteria 14150
76 Ga0068856_100018858 3300005614 Bacteria 6691
77 Ga0068856_100137108 3300005614 Bacteria 2453
78 Ga0068856_100169313 3300005614 Bacteria 2196
79 Ga0068856_100347747 3300005614 Bacteria 1501
80 Ga0068852_100001943 3300005616 Bacteria 14077
81 Ga0068852_100005672 3300005616 Bacteria 8951
82 Ga0068852_100005716 3300005616 Bacteria 8921
83 Ga0068852_100015947 3300005616 Bacteria 5847
84 Ga0068852_100057781 3300005616 Bacteria 3358
85 Ga0068852_100179998 3300005616 Bacteria 1987
86 Ga0068864_100000315 3300005618 Bacteria 42764
87 Ga0068864_100003428 3300005618 Bacteria 13118
88 Ga0068864_100007965 3300005618 Bacteria 8733
89 Ga0068866_10034070 3300005718 Bacteria 2477
90 Ga0068861_100061177 3300005719 Bacteria 2889
91 Ga0068863_100000090 3300005841 Bacteria 100887
92 Ga0068863_100173321 3300005841 Bacteria 2070
93 Ga0068858_100000094 3300005842 Bacteria 93130
94 Ga0068858_100006847 3300005842 Bacteria 11079
95 Ga0068858_100010547 3300005842 Bacteria 8750
96 Ga0068860_100000089 3300005843 Bacteria 152667
97 Ga0081539_10023787 3300005985 Bacteria 3999
98 Ga0070717_10357190 3300006028 Bacteria 1307
99 Ga0075365_10004363 3300006038 Bacteria 7479
100 Ga0075364_10003343 3300006051 Bacteria 9098
101 Ga0075432_10000846 3300006058 Bacteria 9620
102 Ga0075362_10011198 3300006177 Bacteria 3528
103 Ga0075369_10000478 3300006186 Bacteria 12366
104 Ga0075366_10006837 3300006195 Bacteria 6274
105 Ga0075370_10003863 3300006353 Bacteria 7178
106 Ga0075370_10036553 3300006353 Bacteria 2759
107 Ga0075370_10159044 3300006353 Bacteria 1325
108 Ga0068871_100001517 3300006358 Bacteria 15555
109 Ga0068871_100194555 3300006358 Bacteria 1748
110 Ga0068865_100000058 3300006881 Bacteria 60005
111 Ga0079104_1000185 3300006946 Bacteria 88917
112 Ga0105240_10011355 3300009093 Bacteria 12407
113 Ga0105240_10045659 3300009093 Bacteria 5556
114 Ga0105245_10000267 3300009098 Bacteria 49800
115 Ga0105247_10096231 3300009101 Bacteria 1887
116 Ga0105243_10000054 3300009148 Bacteria 136517
117 Ga0105241_10060143 3300009174 Bacteria 2922
118 Ga0105242_10005052 3300009176 Bacteria 10188
119 Ga0105242_10015892 3300009176 Bacteria 5848
120 Ga0105248_10002296 3300009177 Bacteria 21166
121 Ga0105248_10054601 3300009177 Bacteria 4480
122 Ga0105248_10243129 3300009177 Bacteria 2026
123 Ga0105248_10449823 3300009177 Bacteria 1451
124 Ga0105238_10005484 3300009551 Bacteria 12532
125 Ga0105238_10044128 3300009551 Bacteria 4509
126 Ga0105249_10008147 3300009553 Bacteria 9135
127 Ga0105246_10003900 3300011119 Bacteria 9035
128 Ga0157373_10001108 3300013100 Bacteria 20667
129 Ga0157373_10039966 3300013100 Bacteria 3357
130 Ga0157371_10001158 3300013102 Bacteria 28366
131 Ga0157371_10132242 3300013102 Bacteria 1775
132 Ga0157370_10017958 3300013104 Bacteria 7122
133 Ga0157370_10022700 3300013104 Bacteria 6245
134 Ga0157370_10294767 3300013104 Bacteria 1498
135 Ga0157369_10045731 3300013105 Bacteria 4759
136 Ga0157369_10164466 3300013105 Bacteria 2341
137 Ga0157374_10010622 3300013296 Bacteria 7928
138 Ga0157374_10018327 3300013296 Bacteria 6177
139 Ga0157374_10022836 3300013296 Bacteria 5587
140 Ga0157378_10022192 3300013297 Bacteria 5587
141 Ga0163162_10000352 3300013306 Bacteria 41842
142 Ga0157372_10001545 3300013307 Bacteria 25066
143 Ga0157372_10028340 3300013307 Bacteria 6111
144 Ga0157375_10009354 3300013308 Bacteria 8599
145 Ga0157375_10019797 3300013308 Bacteria 6133
146 Ga0157375_10024795 3300013308 Bacteria 5558
147 Ga0157377_10006377 3300014745 Bacteria 5623
148 Ga0157379_10203113 3300014968 Bacteria 1792
149 Ga0157376_10000061 3300014969 Bacteria 91247
150 Ga0163161_10029234 3300017792 Bacteria 3917
151 Ga0209437_100182 3300025233 Bacteria 130514
152 Ga0207425_1000300 3300025245 Bacteria 36053
153 Ga0209148_1000114 3300025254 Bacteria 192073
154 Ga0209129_1000329 3300025258 Bacteria 41319
155 Ga0209129_1000588 3300025258 Bacteria 24948
156 Ga0209129_1001512 3300025258 Bacteria 12888
157 Ga0209129_1005605 3300025258 Bacteria 4368
158 Ga0209233_1000231 3300025261 Bacteria 97534
159 Ga0209673_1000068 3300025273 Bacteria 245891
160 Ga0209673_1001609 3300025273 Bacteria 19762
161 Ga0209673_1002964 3300025273 Bacteria 10616
162 Ga0209676_1021204 3300025292 Bacteria 2187
163 Ga0209025_1000992 3300025294 Bacteria 42037
164 Ga0209025_1001164 3300025294 Bacteria 37261
165 Ga0209025_1004041 3300025294 Bacteria 13137
166 Ga0209564_1010769 3300025295 Bacteria 4170
167 Ga0209758_1000860 3300025297 Bacteria 42010
168 Ga0209758_1014491 3300025297 Bacteria 4186
169 Ga0209758_1040752 3300025297 Bacteria 1747
170 Ga0209256_1005660 3300025299 Bacteria 7038
171 Ga0207426_1002235 3300025302 Bacteria 12907
172 Ga0207697_10026452 3300025315 Bacteria 2372
173 Ga0207680_10004131 3300025903 Bacteria 6870
174 Ga0207647_10000068 3300025904 Bacteria 81240
175 Ga0207647_10000533 3300025904 Bacteria 30383
176 Ga0207647_10004043 3300025904 Bacteria 10931
177 Ga0207647_10005845 3300025904 Bacteria 8972
178 Ga0207645_10002589 3300025907 Bacteria 14104
179 Ga0207705_10000124 3300025909 Bacteria 85292
180 Ga0207705_10002930 3300025909 Bacteria 13044
181 Ga0207705_10008608 3300025909 Bacteria 7437
182 Ga0207705_10101836 3300025909 Bacteria 2113
183 Ga0207705_10125937 3300025909 Bacteria 1904
184 Ga0207654_10133447 3300025911 Bacteria 1574
185 Ga0207695_10008958 3300025913 Bacteria 12457
186 Ga0207695_10023300 3300025913 Bacteria 7000
187 Ga0207671_10063577 3300025914 Bacteria 2742
188 Ga0207660_10013223 3300025917 Bacteria 5405
189 Ga0207660_10020626 3300025917 Bacteria 4426
190 Ga0207657_10005464 3300025919 Bacteria 13266
191 Ga0207657_10007987 3300025919 Bacteria 10788
192 Ga0207657_10009048 3300025919 Bacteria 10056
193 Ga0207657_10011394 3300025919 Bacteria 8826
194 Ga0207657_10243944 3300025919 Bacteria 1434
195 Ga0207649_10008913 3300025920 Bacteria 5478
196 Ga0207652_10044923 3300025921 Bacteria 3765
197 Ga0207694_10026156 3300025924 Bacteria 4437
198 Ga0207694_10054721 3300025924 Bacteria 3096
199 Ga0207694_10137577 3300025924 Bacteria 1963
200 Ga0207650_10003557 3300025925 Bacteria 10691
201 Ga0207659_10003307 3300025926 Bacteria 9657
202 Ga0207659_10129745 3300025926 Bacteria 1944
203 Ga0207659_10210558 3300025926 Bacteria 1558
204 Ga0207687_10000869 3300025927 Bacteria 20436
205 Ga0207687_10015190 3300025927 Bacteria 5046
206 Ga0207644_10006222 3300025931 Bacteria 7780
207 Ga0207644_10088291 3300025931 Bacteria 2306
208 Ga0207690_10001590 3300025932 Bacteria 14187
209 Ga0207690_10011957 3300025932 Bacteria 5189
210 Ga0207706_10014667 3300025933 Bacteria 7096
211 Ga0207706_10024803 3300025933 Bacteria 5375
212 Ga0207706_10041202 3300025933 Bacteria 4095
213 Ga0207706_10072749 3300025933 Bacteria 3023
214 Ga0207706_10274340 3300025933 Bacteria 1471
215 Ga0207686_10001311 3300025934 Bacteria 14254
216 Ga0207709_10000050 3300025935 Bacteria 234391
217 Ga0207669_10019961 3300025937 Bacteria 3502
218 Ga0207704_10000051 3300025938 Bacteria 81152
219 Ga0207691_10201023 3300025940 Bacteria 1734
220 Ga0207711_10026804 3300025941 Bacteria 4837
221 Ga0207711_10145805 3300025941 Bacteria 2133
222 Ga0207689_10000537 3300025942 Bacteria 35986
223 Ga0207661_10000290 3300025944 Bacteria 31735
224 Ga0207661_10227223 3300025944 Bacteria 1651
225 Ga0207679_10019350 3300025945 Bacteria 4572
226 Ga0207667_10006693 3300025949 Bacteria 13932
227 Ga0207667_10065975 3300025949 Bacteria 3774
228 Ga0207667_10121294 3300025949 Bacteria 2694
229 Ga0207651_10000005 3300025960 Bacteria 246132
230 Ga0207651_10002784 3300025960 Bacteria 8400
231 Ga0207712_10004758 3300025961 Bacteria 8575
232 Ga0207668_10184045 3300025972 Bacteria 1650
233 Ga0207640_10004636 3300025981 Bacteria 7460
234 Ga0207640_10004924 3300025981 Bacteria 7253
235 Ga0207640_10264045 3300025981 Bacteria 1343
236 Ga0207658_10009284 3300025986 Bacteria 6671
237 Ga0207658_10244016 3300025986 Bacteria 1523
238 Ga0207677_10000128 3300026023 Bacteria 62112
239 Ga0207677_10028341 3300026023 Bacteria 3539
240 Ga0207677_10271684 3300026023 Bacteria 1387
241 Ga0207703_10000328 3300026035 Bacteria 51780
242 Ga0207703_10035221 3300026035 Bacteria 3978
243 Ga0207639_10000839 3300026041 Bacteria 20858
244 Ga0207639_10001421 3300026041 Bacteria 16186
245 Ga0207639_10011781 3300026041 Bacteria 6081
246 Ga0207639_10082923 3300026041 Bacteria 2543
247 Ga0207678_10208422 3300026067 Bacteria 1672
248 Ga0207702_10001036 3300026078 Bacteria 28486
249 Ga0207702_10030241 3300026078 Bacteria 4513
250 Ga0207702_10043529 3300026078 Bacteria 3770
251 Ga0207641_10000069 3300026088 Bacteria 154022
252 Ga0207641_10037002 3300026088 Bacteria 4075
253 Ga0207648_10000068 3300026089 Bacteria 97469
254 Ga0207676_10000720 3300026095 Bacteria 25922
255 Ga0207676_10004305 3300026095 Bacteria 10063
256 Ga0207674_10002721 3300026116 Bacteria 22050
257 Ga0207674_10054551 3300026116 Bacteria 4068
258 Ga0207674_10226677 3300026116 Bacteria 1817
259 Ga0207675_100083143 3300026118 Bacteria 3002
260 Ga0207683_10005153 3300026121 Bacteria 11223
261 Ga0207698_10000067 3300026142 Bacteria 70181
262 Ga0207698_10001384 3300026142 Bacteria 14102
263 Ga0207698_10020255 3300026142 Bacteria 4574
264 Ga0207698_10219312 3300026142 Bacteria 1717
265 Ga0207698_10373197 3300026142 Bacteria 1355
266 Ga0207698_10484251 3300026142 Bacteria 1201
267 Ga0209281_1000211 3300027111 Bacteria 130597
268 Ga0207428_10012236 3300027907 Bacteria 7547
269 Ga0268266_10001007 3300028379 Bacteria 35510
270 Ga0268266_10008060 3300028379 Bacteria 9413
271 Ga0268266_10113568 3300028379 Bacteria 2402
272 Ga0268264_10000160 3300028381 Bacteria 152653
273 Ga0307408_100048166 3300031548 Bacteria 3056
274 Ga0307405_10004996 3300031731 Bacteria 6340
275 Ga0307413_10002690 3300031824 Bacteria 7287
276 Ga0307410_10009435 3300031852 Bacteria 5473
277 Ga0307410_10109512 3300031852 Bacteria 1996
278 Ga0307406_10113483 3300031901 Bacteria 1870
279 Ga0307412_10006733 3300031911 Bacteria 6514
280 Ga0307416_100097560 3300032002 Bacteria 2546
281 Ga0307416_100193533 3300032002 Bacteria 1921
282 Ga0307415_100025720 3300032126 Bacteria 3700
283 Ga0307415_100027084 3300032126 Bacteria 3627
284 Ga0373946_0012062 3300035171 Bacteria 3232
285 Ga0373927_0049588 3300035695 Bacteria 2715
286 Ga0395899_0000943 3300037312 Bacteria 27277
287 Ga0395899_0002700 3300037312 Bacteria 14310
288 Ga0395899_0026236 3300037312 Bacteria 4396
289 Ga0395900_0022970 3300037418 Bacteria 6383
290 Ga0395900_0042428 3300037418 Bacteria 4688
291 Ga0395900_0112753 3300037418 Bacteria 2792
292 Ga0395900_0134946 3300037418 Bacteria 2528
293 Ga0395900_0146692 3300037418 Bacteria 2412
294 Ga0395900_0163509 3300037418 Bacteria 2269
295 Ga0395898_0001771 3300037466 Bacteria 28186
296 Ga0395898_0056619 3300037466 Bacteria 3821
297 Ga0395898_0290336 3300037466 Bacteria 1560
298 Ga0395905_0001250 3300037471 Bacteria 31475
299 Ga0395905_0003350 3300037471 Bacteria 17186
300 Ga0395905_0012450 3300037471 Bacteria 8188
301 Ga0395905_0018160 3300037471 Bacteria 6675
302 Ga0395905_0023985 3300037471 Bacteria 5760
303 Ga0395905_0056103 3300037471 Bacteria 3686
304 Ga0395905_0059800 3300037471 Bacteria 3563
305 Ga0395905_0084647 3300037471 Bacteria 2971
306 Ga0395905_0112500 3300037471 Bacteria 2557
307 Ga0395905_0116341 3300037471 Bacteria 2513
308 Ga0395905_0130916 3300037471 Bacteria 2359
309 Ga0395905_0216637 3300037471 Bacteria 1793
310 Ga0395905_0357803 3300037471 Bacteria 1352
311 Ga0395901_0000640 3300038443 Bacteria 40526
312 Ga0395901_0006730 3300038443 Bacteria 11608
313 Ga0395901_0041368 3300038443 Bacteria 4775
314 Ga0395901_0076733 3300038443 Bacteria 3487
315 Ga0395901_0157858 3300038443 Bacteria 2382
316 Ga0436365_1247980 3300039437 Bacteria 2535
317 Ga0439465_0003666 3300041413 Bacteria 5008
318 Ga0439448_0003660 3300042005 Bacteria 4280
319 Ga0439448_0014023 3300042005 Bacteria 2414
320 Ga0439449_0028141 3300042007 Bacteria 2095
321 Ga0439450_001512 3300042008 Bacteria 3418
322 Ga0439455_0001053 3300042012 Bacteria 4369
323 Ga0439455_0011480 3300042012 Bacteria 1969
324 Ga0466972_0160110 3300044658 Bacteria 1058
325 Ga0466961_0013763 3300044693 Bacteria 5185
326 Ga0466961_0036241 3300044693 Bacteria 3166
327 Ga0466963_0036381 3300044694 Bacteria 3211
328 Ga0466963_0054621 3300044694 Bacteria 2655
329 Ga0466964_0006073 3300044706 Bacteria 4502
330 Ga0466971_0045823 3300044719 Bacteria 1964
331 Ga0466970_0007851 3300044765 Bacteria 5356
332 Ga0466970_0026546 3300044765 Bacteria 3035
333 Ga0466959_0055186 3300045049 Bacteria 2901
334 Ga0466959_0103038 3300045049 Bacteria 2042
335 Ga0466958_0007878 3300045836 Bacteria 5888
336 Ga0466958_0029869 3300045836 Bacteria 3235
337 Ga0466958_0041571 3300045836 Bacteria 2765
338 Ga0466958_0044455 3300045836 Bacteria 2677
339 Ga0466967_0028387 3300045976 Bacteria 4671
340 Ga0466967_0285448 3300045976 Bacteria 1584
341 Ga0466967_0337783 3300045976 Bacteria 1456
342 Ga0495627_000432 3300046453 Bacteria 36351
343 Ga0495627_001001 3300046453 Bacteria 19008
344 Ga0495638_0008265 3300046460 Bacteria 7391
345 Ga0495596_0000119 3300046500 Bacteria 54166
346 Ga0495607_0030174 3300046501 Bacteria 3331
347 Ga0495583_0000033 3300046506 Bacteria 246882
348 Ga0495606_0000506 3300046507 Bacteria 63276
349 Ga0495606_0060884 3300046507 Bacteria 2416
350 Ga0495606_0079823 3300046507 Bacteria 2037
351 Ga0495610_0000243 3300046512 Bacteria 57521
352 Ga0495610_0000687 3300046512 Bacteria 32649
353 Ga0495620_0002894 3300046515 Bacteria 9868
354 Ga0495637_0003442 3300046520 Bacteria 8404
355 Ga0495643_0004015 3300046522 Bacteria 10512
356 Ga0495648_0057619 3300046524 Bacteria 2328
357 Ga0495663_0021266 3300046525 Bacteria 1868
358 Ga0495654_0000274 3300046530 Bacteria 46547
359 Ga0495609_0005187 3300046538 Bacteria 6934
360 Ga0495633_0001488 3300046558 Bacteria 18170
361 Ga0495625_0000832 3300046660 Bacteria 42398
362 Ga0495625_0007251 3300046660 Bacteria 9701
363 Ga0495588_0000566 3300046674 Bacteria 17675
364 Ga0495669_0005530 3300046684 Bacteria 5271
365 Ga0495671_0149049 3300046692 Bacteria 1139
366 Ga0495687_012037 3300047443 Bacteria 4601
367 Ga0495681_0000179 3300047470 Bacteria 53785
368 Ga0495681_0001625 3300047470 Bacteria 16699
369 Ga0495686_0000053 3300047472 Bacteria 259537
370 Ga0495686_0000779 3300047472 Bacteria 41840
371 Ga0495686_0003742 3300047472 Bacteria 12963
372 Ga0495686_0004383 3300047472 Bacteria 11637
373 Ga0495686_0008456 3300047472 Bacteria 7549
374 Ga0496100_0009837 3300048903 Bacteria 5389
375 Ga0496101_0006709 3300048904 Bacteria 7423
376 Ga0496103_0059248 3300048906 Bacteria 2379
377 Ga0496104_0004735 3300048907 Bacteria 11841
378 Ga0496105_0000838 3300048908 Bacteria 20915
379 Ga0496106_0036094 3300048909 Bacteria 3698
380 Ga0496106_0447934 3300048909 Bacteria 1037
381 Ga0496108_0026463 3300048911 Bacteria 4784
382 Ga0496111_0039198 3300048914 Bacteria 3396
383 Ga0496111_0167199 3300048914 Bacteria 1633
384 Ga0496116_0133165 3300048919 Bacteria 1413
385 Ga0496117_0004321 3300048920 Bacteria 15804
386 Ga0496117_0035067 3300048920 Bacteria 3772
387 Ga0496118_0019063 3300048921 Bacteria 6149
388 Ga0496118_0030082 3300048921 Bacteria 4541
389 Ga0496120_0052482 3300048923 Bacteria 2322
390 Ga0496121_0000087 3300048924 Bacteria 222451
391 Ga0496121_0001015 3300048924 Bacteria 50131
392 Ga0496121_0009286 3300048924 Bacteria 11344
393 Ga0496121_0009783 3300048924 Bacteria 10958
394 Ga0496121_0013911 3300048924 Bacteria 8601
395 Ga0496121_0116833 3300048924 Bacteria 2022
396 Ga0496122_0000157 3300048925 Bacteria 159733
397 Ga0496122_0006109 3300048925 Bacteria 14022
398 Ga0496123_0000048 3300048926 Bacteria 244152
399 Ga0496123_0004274 3300048926 Bacteria 15199
400 Ga0496123_0013438 3300048926 Bacteria 6875
401 Ga0496123_0057123 3300048926 Bacteria 2543
402 Ga0496124_0000131 3300048927 Bacteria 156256
403 Ga0496124_0001488 3300048927 Bacteria 34405
404 Ga0496124_0001662 3300048927 Bacteria 31739
405 Ga0496124_0032422 3300048927 Bacteria 4613
406 Ga0496124_0074441 3300048927 Bacteria 2807
407 Ga0496124_0092310 3300048927 Bacteria 2466
408 Ga0496124_0115162 3300048927 Bacteria 2158
409 Ga0496124_0207465 3300048927 Bacteria 1485
410 Ga0496124_0213044 3300048927 Bacteria 1460
411 Ga0496125_0041191 3300048928 Bacteria 3953
412 Ga0496125_0127573 3300048928 Bacteria 1799
413 Ga0496126_0001697 3300048929 Bacteria 32726
414 Ga0501038_0003137 3300049574 Bacteria 15417
415 Ga0501206_010654 3300049653 Bacteria 1234
416 Ga0501211_001878 3300049658 Bacteria 2242
417 Ga0501225_0009498 3300049705 Bacteria 2768
418 Ga0501035_0098204 3300049822 Bacteria 2571
419 nmdc:mga03683_15204_c1 3300050489 Bacteria 2868
420 nmdc:mga00v17_5040_c1 3300050491 Bacteria 6936
421 nmdc:mga00v17_588_c1 3300050491 Bacteria 20251
422 nmdc:mga0k408_9537_c1 3300050493 Bacteria 5237
423 nmdc:mga07m45_2459_c1 3300050496 Bacteria 8691
424 nmdc:mga0sz30_3575_c1 3300050516 Bacteria 5605
425 Ga0500555_000515 3300053103 Bacteria 15513
426 Ga0500560_000087 3300053107 Bacteria 9083
427 Ga0500618_000211 3300053125 Bacteria 46131
428 Ga0500618_001205 3300053125 Bacteria 12326
429 Ga0500559_0004258 3300053136 Bacteria 6845
430 Ga0500559_0027239 3300053136 Bacteria 2438
431 Ga0500573_0001149 3300053140 Bacteria 12350
432 Ga0500616_0022486 3300053153 Bacteria 3519
433 Ga0500624_000117 3300053157 Bacteria 36573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0160110 Ga0466972_0160110_124_990 288
2 3300044693 Ga0466961_0036241 Ga0466961_0036241_2282_3148 288
3 3300048909 Ga0496106_0447934 Ga0496106_0447934_10_969 319
4 3300048927 Ga0496124_0000131 Ga0496124_0000131_30597_31652 329
5 3300037418 Ga0395900_0134946 Ga0395900_0134946_1023_2075 333
6 3300037471 Ga0395905_0112500 Ga0395905_0112500_512_1564 333
7 3300038443 Ga0395901_0157858 Ga0395901_0157858_754_1806 333
8 3300044693 Ga0466961_0013763 Ga0466961_0013763_1126_2136 336
9 3300044706 Ga0466964_0006073 Ga0466964_0006073_3085_4095 336
10 3300001989 JGI24739J22299_10000461 JGI24739J22299_100004617 339
11 3300001990 JGI24737J22298_10003559 JGI24737J22298_100035595 339
12 3300002067 JGI24735J21928_10001002 JGI24735J21928_100010023 339
13 3300002067 JGI24735J21928_10005298 JGI24735J21928_100052982 339
14 3300002075 JGI24738J21930_10000331 JGI24738J21930_100003317 339
15 3300002077 JGI24744J21845_10000501 JGI24744J21845_100005016 339
16 3300003323 rootH1_10079410 rootH1_100794102 339
17 3300005334 Ga0068869_100000348 Ga0068869_10000034822 339
18 3300005338 Ga0068868_100000411 Ga0068868_1000004115 339
19 3300005339 Ga0070660_100002865 Ga0070660_1000028657 339
20 3300005339 Ga0070660_100006536 Ga0070660_1000065362 339
21 3300005355 Ga0070671_100179523 Ga0070671_1001795231 339
22 3300005356 Ga0070674_100002362 Ga0070674_1000023627 339
23 3300005364 Ga0070673_100000010 Ga0070673_10000001081 339
24 3300005366 Ga0070659_100013035 Ga0070659_1000130354 339
25 3300005455 Ga0070663_100134093 Ga0070663_1001340931 339
26 3300005456 Ga0070678_100002067 Ga0070678_1000020675 339
27 3300005459 Ga0068867_100000019 Ga0068867_10000001924 339
28 3300005539 Ga0068853_100031722 Ga0068853_1000317224 339
29 3300006881 Ga0068865_100000058 Ga0068865_10000005851 339
30 3300009098 Ga0105245_10000267 Ga0105245_1000026733 339
31 3300009148 Ga0105243_10000054 Ga0105243_10000054161 339
32 3300009176 Ga0105242_10005052 Ga0105242_1000505210 339
33 3300009553 Ga0105249_10008147 Ga0105249_100081472 339
34 3300011119 Ga0105246_10003900 Ga0105246_100039004 339
35 3300013296 Ga0157374_10022836 Ga0157374_100228363 339
36 3300013297 Ga0157378_10022192 Ga0157378_100221923 339
37 3300013307 Ga0157372_10028340 Ga0157372_100283403 339
38 3300013308 Ga0157375_10019797 Ga0157375_100197974 339
39 3300014745 Ga0157377_10006377 Ga0157377_100063773 339
40 3300014969 Ga0157376_10000061 Ga0157376_1000006167 339
41 3300025254 Ga0209148_1000114 Ga0209148_100011432 339
42 3300025904 Ga0207647_10000068 Ga0207647_1000006849 339
43 3300025907 Ga0207645_10002589 Ga0207645_1000258910 339
44 3300025914 Ga0207671_10063577 Ga0207671_100635772 339
45 3300025919 Ga0207657_10005464 Ga0207657_100054647 339
46 3300025919 Ga0207657_10011394 Ga0207657_100113945 339
47 3300025926 Ga0207659_10003307 Ga0207659_100033073 339
48 3300025926 Ga0207659_10210558 Ga0207659_102105582 339
49 3300025927 Ga0207687_10000869 Ga0207687_100008692 339
50 3300025933 Ga0207706_10024803 Ga0207706_100248033 339
51 3300025933 Ga0207706_10072749 Ga0207706_100727493 339
52 3300025934 Ga0207686_10001311 Ga0207686_100013117 339
53 3300025935 Ga0207709_10000050 Ga0207709_1000005067 339
54 3300025937 Ga0207669_10019961 Ga0207669_100199612 339
55 3300025938 Ga0207704_10000051 Ga0207704_1000005161 339
56 3300025942 Ga0207689_10000537 Ga0207689_1000053724 339
57 3300025960 Ga0207651_10000005 Ga0207651_10000005184 339
58 3300025961 Ga0207712_10004758 Ga0207712_100047588 339
59 3300026023 Ga0207677_10000128 Ga0207677_1000012849 339
60 3300026041 Ga0207639_10011781 Ga0207639_100117816 339
61 3300026041 Ga0207639_10082923 Ga0207639_100829233 339
62 3300026067 Ga0207678_10208422 Ga0207678_102084222 339
63 3300026089 Ga0207648_10000068 Ga0207648_1000006824 339
64 3300026121 Ga0207683_10005153 Ga0207683_100051537 339
65 3300026142 Ga0207698_10484251 Ga0207698_104842512 339
66 3300037471 Ga0395905_0116341 Ga0395905_0116341_118_1191 339
67 3300038443 Ga0395901_0076733 Ga0395901_0076733_2386_3459 339
68 3300042005 Ga0439448_0003660 Ga0439448_0003660_2578_3651 339
69 3300042005 Ga0439448_0014023 Ga0439448_0014023_368_1441 339
70 3300042008 Ga0439450_001512 Ga0439450_001512_437_1510 339
71 3300042012 Ga0439455_0001053 Ga0439455_0001053_953_2026 339
72 3300042012 Ga0439455_0011480 Ga0439455_0011480_29_1102 339
73 3300046460 Ga0495638_0008265 Ga0495638_0008265_44_1129 339
74 3300046506 Ga0495583_0000033 Ga0495583_0000033_41167_42252 339
75 3300046507 Ga0495606_0000506 Ga0495606_0000506_27903_28976 339
76 3300047443 Ga0495687_012037 Ga0495687_012037_3210_4283 339
77 3300047472 Ga0495686_0000053 Ga0495686_0000053_43995_45080 339
78 3300047472 Ga0495686_0000779 Ga0495686_0000779_22024_23097 339
79 3300047472 Ga0495686_0003742 Ga0495686_0003742_1778_2854 339
80 3300047472 Ga0495686_0004383 Ga0495686_0004383_10101_11174 339
81 3300048914 Ga0496111_0039198 Ga0496111_0039198_910_1983 339
82 3300048920 Ga0496117_0004321 Ga0496117_0004321_9016_10089 339
83 3300048921 Ga0496118_0030082 Ga0496118_0030082_2952_4025 339
84 3300048924 Ga0496121_0009783 Ga0496121_0009783_3213_4286 339
85 3300048925 Ga0496122_0006109 Ga0496122_0006109_6613_7686 339
86 3300048926 Ga0496123_0004274 Ga0496123_0004274_4332_5405 339
87 3300048926 Ga0496123_0013438 Ga0496123_0013438_4470_5543 339
88 3300048926 Ga0496123_0057123 Ga0496123_0057123_363_1445 339
89 3300048927 Ga0496124_0074441 Ga0496124_0074441_255_1337 339
90 3300049822 Ga0501035_0098204 Ga0501035_0098204_1405_2478 339
91 3300053103 Ga0500555_000515 Ga0500555_000515_7291_8376 339
92 3300053136 Ga0500559_0004258 Ga0500559_0004258_4221_5294 339
93 3300053153 Ga0500616_0022486 Ga0500616_0022486_1795_2868 339
94 3300005330 Ga0070690_100004148 Ga0070690_1000041486 342
95 3300005335 Ga0070666_10005604 Ga0070666_100056047 342
96 3300005367 Ga0070667_100020836 Ga0070667_1000208362 342
97 3300005718 Ga0068866_10034070 Ga0068866_100340702 342
98 3300005841 Ga0068863_100173321 Ga0068863_1001733213 342
99 3300005842 Ga0068858_100010547 Ga0068858_1000105475 342
100 3300006358 Ga0068871_100001517 Ga0068871_1000015179 342
101 3300009176 Ga0105242_10015892 Ga0105242_100158925 342
102 3300013308 Ga0157375_10024795 Ga0157375_100247952 342
103 3300025931 Ga0207644_10006222 Ga0207644_100062223 342
104 3300025933 Ga0207706_10041202 Ga0207706_100412024 342
105 3300025960 Ga0207651_10002784 Ga0207651_100027842 342
106 3300025986 Ga0207658_10244016 Ga0207658_102440162 342
107 3300026023 Ga0207677_10028341 Ga0207677_100283412 342
108 3300026088 Ga0207641_10037002 Ga0207641_100370022 342
109 3300048903 Ga0496100_0009837 Ga0496100_0009837_283_1341 342
110 3300048904 Ga0496101_0006709 Ga0496101_0006709_6065_7123 342
111 3300048909 Ga0496106_0036094 Ga0496106_0036094_1071_2129 342
112 3300048911 Ga0496108_0026463 Ga0496108_0026463_659_1717 342
113 iso_pu_bacteria 2510461069 2510843297 345
114 iso_pu_bacteria 2718217927 2719384941 345
115 iso_pu_bacteria 2718217997 2719664688 345
116 iso_pu_bacteria 2718218199 2720491108 345
117 iso_pu_bacteria 2718218232 2720612475 345
118 iso_pu_bacteria 2718218233 2720619318 345
119 iso_pu_bacteria 2718218235 2720630715 345
120 iso_pu_bacteria 2718218269 2720774408 345
121 iso_pu_bacteria 2718218423 2721398661 345
122 iso_pu_bacteria 2721755556 2723026134 345
123 iso_pu_bacteria 2721755684 2723559678 345
124 iso_pu_bacteria 2721755685 2723566296 345
125 iso_pu_bacteria 2721755809 2724037474 345
126 iso_pu_bacteria 2721755819 2724089015 345
127 iso_pu_bacteria 2721755822 2724103561 345
128 iso_pu_bacteria 2721755823 2724109398 345
129 iso_pu_bacteria 2728369352 2730107070 345
130 iso_pu_bacteria 2738541293 2738802840 345
131 iso_pu_bacteria 2791355253 2793283825 345
132 iso_pu_bacteria 2802429605 2805926509 345
133 iso_pu_bacteria 2838016132 2838017357 345
134 iso_pu_bacteria 2838061910 2838063393 345
135 iso_pu_bacteria 2838068647 2838072948 345
136 iso_pu_bacteria 2842264693 2842266853 345
137 iso_pu_bacteria 2842357229 2842363084 345
138 iso_pu_bacteria 2842422224 2842426366 345
139 iso_pu_bacteria 2842428310 2842430984 345
140 iso_pu_bacteria 2842434925 2842437018 345
141 iso_pu_bacteria 2842441272 2842443096 345
142 iso_pu_bacteria 2842462802 2842465107 345
143 iso_pu_bacteria 2842469257 2842471667 345
144 iso_pu_bacteria 2899845264 2899847994 345
145 iso_pu_bacteria 2933599457 2933603863 345
146 iso_pu_bacteria 2996887358 2996889536 345
147 iso_pu_bacteria 8005275841 8005279662 345
148 iso_pu_bacteria 8005282627 8005283567 345
149 iso_pu_bacteria 8005321885 8005324063 345
150 iso_pu_bacteria 8005430974 8005437150 345
151 iso_pu_bacteria 8005497431 8005499422 345
152 iso_pu_bacteria 8005619151 8005620597 345
153 iso_pu_bacteria 8005626139 8005627036 345
154 iso_pu_bacteria 8005668836 8005670838 345
155 iso_pu_bacteria 8018176218 8018182580 345
156 iso_pu_bacteria 8024501048 8024503183 345
157 3300037418 Ga0395900_0022970 Ga0395900_0022970_1305_2363 346
158 3300037471 Ga0395905_0003350 Ga0395905_0003350_12539_13597 346
159 3300005457 Ga0070662_100158059 Ga0070662_1001580592 347
160 3300005616 Ga0068852_100005716 Ga0068852_1000057169 347
161 3300025927 Ga0207687_10015190 Ga0207687_100151904 347
162 3300045976 Ga0466967_0337783 Ga0466967_0337783_229_1287 347
163 iso_pu_bacteria 2808606404 2809081373 347
164 iso_pu_bacteria 2880518877 2880523773 347
165 3300005331 Ga0070670_100000201 Ga0070670_10000020154 348
166 3300025925 Ga0207650_10003557 Ga0207650_1000355715 348
167 iso_pu_bacteria 2848297114 2848299295 348
168 iso_pu_bacteria 8054302542 8054306391 348
169 3300002773 JGI25152J39213_1004710 JGI25152J39213_10047103 349
170 3300003214 JGI25165J46597_1000499 JGI25165J46597_100049916 349
171 3300003771 Ga0055526_1011642 Ga0055526_10116423 349
172 3300003775 Ga0055524_1019675 Ga0055524_10196752 349
173 3300003790 Ga0055528_1001812 Ga0055528_10018128 349
174 3300003790 Ga0055528_1004074 Ga0055528_10040744 349
175 3300005289 Ga0065704_10001414 Ga0065704_100014145 349
176 3300005355 Ga0070671_100000587 Ga0070671_10000058718 349
177 3300005539 Ga0068853_100000580 Ga0068853_1000005807 349
178 3300005548 Ga0070665_100038790 Ga0070665_1000387902 349
179 3300006038 Ga0075365_10004363 Ga0075365_100043636 349
180 3300006051 Ga0075364_10003343 Ga0075364_100033436 349
181 3300006177 Ga0075362_10011198 Ga0075362_100111983 349
182 3300006186 Ga0075369_10000478 Ga0075369_100004786 349
183 3300006195 Ga0075366_10006837 Ga0075366_100068376 349
184 3300006353 Ga0075370_10003863 Ga0075370_100038634 349
185 3300006353 Ga0075370_10159044 Ga0075370_101590442 349
186 3300009174 Ga0105241_10060143 Ga0105241_100601433 349
187 3300025233 Ga0209437_100182 Ga0209437_10018293 349
188 3300025258 Ga0209129_1000329 Ga0209129_10003296 349
189 3300025258 Ga0209129_1001512 Ga0209129_10015121 349
190 3300025258 Ga0209129_1005605 Ga0209129_10056054 349
191 3300025261 Ga0209233_1000231 Ga0209233_100023122 349
192 3300025273 Ga0209673_1000068 Ga0209673_1000068110 349
193 3300025273 Ga0209673_1001609 Ga0209673_10016094 349
194 3300025273 Ga0209673_1002964 Ga0209673_10029646 349
195 3300025292 Ga0209676_1021204 Ga0209676_10212043 349
196 3300025294 Ga0209025_1001164 Ga0209025_10011646 349
197 3300025294 Ga0209025_1004041 Ga0209025_100404110 349
198 3300025295 Ga0209564_1010769 Ga0209564_10107694 349
199 3300025297 Ga0209758_1014491 Ga0209758_10144915 349
200 3300025297 Ga0209758_1040752 Ga0209758_10407522 349
201 3300025299 Ga0209256_1005660 Ga0209256_10056603 349
202 3300025302 Ga0207426_1002235 Ga0207426_10022355 349
203 3300026041 Ga0207639_10001421 Ga0207639_1000142117 349
204 3300026078 Ga0207702_10030241 Ga0207702_100302412 349
205 3300028379 Ga0268266_10008060 Ga0268266_100080609 349
206 3300037471 Ga0395905_0059800 Ga0395905_0059800_805_1857 349
207 3300041413 Ga0439465_0003666 Ga0439465_0003666_2681_3733 349
208 3300042007 Ga0439449_0028141 Ga0439449_0028141_192_1244 349
209 3300046507 Ga0495606_0060884 Ga0495606_0060884_932_1987 349
210 3300046507 Ga0495606_0079823 Ga0495606_0079823_444_1499 349
211 3300048919 Ga0496116_0133165 Ga0496116_0133165_241_1296 349
212 3300048924 Ga0496121_0001015 Ga0496121_0001015_1704_2759 349
213 3300048924 Ga0496121_0013911 Ga0496121_0013911_3955_5010 349
214 3300048924 Ga0496121_0116833 Ga0496121_0116833_210_1265 349
215 3300048927 Ga0496124_0001662 Ga0496124_0001662_25268_26323 349
216 3300048927 Ga0496124_0092310 Ga0496124_0092310_557_1612 349
217 3300048927 Ga0496124_0207465 Ga0496124_0207465_31_1086 349
218 3300050489 nmdc:mga03683_15204_c1 nmdc:mga03683_15204_c1_1267_2322 349
219 3300050491 nmdc:mga00v17_5040_c1 nmdc:mga00v17_5040_c1_3750_4805 349
220 3300050491 nmdc:mga00v17_588_c1 nmdc:mga00v17_588_c1_17054_18109 349
221 3300050493 nmdc:mga0k408_9537_c1 nmdc:mga0k408_9537_c1_1305_2360 349
222 3300050496 nmdc:mga07m45_2459_c1 nmdc:mga07m45_2459_c1_3646_4701 349
223 3300050516 nmdc:mga0sz30_3575_c1 nmdc:mga0sz30_3575_c1_106_1161 349
224 3300053136 Ga0500559_0027239 Ga0500559_0027239_198_1253 349
225 3300053140 Ga0500573_0001149 Ga0500573_0001149_10020_11075 349
226 iso_pu_bacteria 2599185156 2599334646 349
227 iso_pu_bacteria 2842922631 2842925770 349
228 3300009177 Ga0105248_10054601 Ga0105248_100546012 350
229 3300046500 Ga0495596_0000119 Ga0495596_0000119_40529_41584 350
230 3300046501 Ga0495607_0030174 Ga0495607_0030174_1228_2283 350
231 3300046522 Ga0495643_0004015 Ga0495643_0004015_947_2002 350
232 3300046538 Ga0495609_0005187 Ga0495609_0005187_4462_5517 350
233 3300046660 Ga0495625_0007251 Ga0495625_0007251_6534_7589 350
234 3300046692 Ga0495671_0149049 Ga0495671_0149049_36_1091 350
235 3300048924 Ga0496121_0000087 Ga0496121_0000087_70364_71419 350
236 iso_pu_bacteria 2643221568 2643854033 350
237 iso_pu_bacteria 2821123053 2821124456 350
238 iso_pu_bacteria 2838736955 2838741049 350
239 iso_pu_bacteria 2841840854 2841845054 350
240 iso_pu_bacteria 2842140634 2842144777 350
241 iso_pu_bacteria 2854916844 2854917686 350
242 iso_pu_bacteria 2857531043 2857532037 350
243 iso_pu_bacteria 2920822456 2920828104 350
244 iso_pu_bacteria 2941499720 2941502903 350
245 3300045836 Ga0466958_0044455 Ga0466958_0044455_1020_2075 351
246 3300046684 Ga0495669_0005530 Ga0495669_0005530_3293_4348 351
247 3300005327 Ga0070658_10000068 Ga0070658_1000006860 352
248 3300005327 Ga0070658_10018367 Ga0070658_100183672 352
249 3300005327 Ga0070658_10321549 Ga0070658_103215492 352
250 3300005329 Ga0070683_100005689 Ga0070683_1000056896 352
251 3300005335 Ga0070666_10010306 Ga0070666_100103062 352
252 3300005354 Ga0070675_100095681 Ga0070675_1000956812 352
253 3300005355 Ga0070671_100009223 Ga0070671_1000092237 352
254 3300005356 Ga0070674_100096009 Ga0070674_1000960092 352
255 3300005364 Ga0070673_100048867 Ga0070673_1000488672 352
256 3300005367 Ga0070667_100065275 Ga0070667_1000652753 352
257 3300005435 Ga0070714_100046210 Ga0070714_1000462102 352
258 3300005435 Ga0070714_100160549 Ga0070714_1001605491 352
259 3300005530 Ga0070679_100097747 Ga0070679_1000977472 352
260 3300005535 Ga0070684_100009982 Ga0070684_1000099827 352
261 3300005543 Ga0070672_100286038 Ga0070672_1002860382 352
262 3300005563 Ga0068855_100092862 Ga0068855_1000928623 352
263 3300005563 Ga0068855_100160209 Ga0068855_1001602092 352
264 3300005577 Ga0068857_100154716 Ga0068857_1001547162 352
265 3300005614 Ga0068856_100004335 Ga0068856_1000043353 352
266 3300005614 Ga0068856_100018858 Ga0068856_1000188584 352
267 3300005614 Ga0068856_100137108 Ga0068856_1001371083 352
268 3300005614 Ga0068856_100169313 Ga0068856_1001693132 352
269 3300005614 Ga0068856_100347747 Ga0068856_1003477471 352
270 3300005616 Ga0068852_100001943 Ga0068852_1000019436 352
271 3300005616 Ga0068852_100005672 Ga0068852_1000056727 352
272 3300005616 Ga0068852_100015947 Ga0068852_1000159474 352
273 3300005616 Ga0068852_100057781 Ga0068852_1000577813 352
274 3300005618 Ga0068864_100000315 Ga0068864_10000031520 352
275 3300005618 Ga0068864_100003428 Ga0068864_10000342811 352
276 3300005719 Ga0068861_100061177 Ga0068861_1000611773 352
277 3300005842 Ga0068858_100000094 Ga0068858_10000009489 352
278 3300005985 Ga0081539_10023787 Ga0081539_100237874 352
279 3300006028 Ga0070717_10357190 Ga0070717_103571901 352
280 3300006058 Ga0075432_10000846 Ga0075432_100008463 352
281 3300006353 Ga0075370_10036553 Ga0075370_100365532 352
282 3300006358 Ga0068871_100194555 Ga0068871_1001945552 352
283 3300009093 Ga0105240_10011355 Ga0105240_100113552 352
284 3300009177 Ga0105248_10002296 Ga0105248_100022962 352
285 3300009177 Ga0105248_10243129 Ga0105248_102431292 352
286 3300009177 Ga0105248_10449823 Ga0105248_104498231 352
287 3300009551 Ga0105238_10044128 Ga0105238_100441282 352
288 3300013100 Ga0157373_10039966 Ga0157373_100399663 352
289 3300013102 Ga0157371_10132242 Ga0157371_101322422 352
290 3300013104 Ga0157370_10017958 Ga0157370_100179586 352
291 3300013104 Ga0157370_10022700 Ga0157370_100227005 352
292 3300013104 Ga0157370_10294767 Ga0157370_102947672 352
293 3300013105 Ga0157369_10164466 Ga0157369_101644663 352
294 3300013296 Ga0157374_10010622 Ga0157374_100106222 352
295 3300013306 Ga0163162_10000352 Ga0163162_1000035239 352
296 3300013308 Ga0157375_10009354 Ga0157375_100093548 352
297 3300014968 Ga0157379_10203113 Ga0157379_102031132 352
298 3300025315 Ga0207697_10026452 Ga0207697_100264522 352
299 3300025903 Ga0207680_10004131 Ga0207680_100041313 352
300 3300025904 Ga0207647_10004043 Ga0207647_100040439 352
301 3300025904 Ga0207647_10005845 Ga0207647_100058457 352
302 3300025909 Ga0207705_10000124 Ga0207705_1000012467 352
303 3300025909 Ga0207705_10002930 Ga0207705_100029302 352
304 3300025909 Ga0207705_10008608 Ga0207705_100086084 352
305 3300025909 Ga0207705_10125937 Ga0207705_101259372 352
306 3300025911 Ga0207654_10133447 Ga0207654_101334472 352
307 3300025913 Ga0207695_10008958 Ga0207695_100089582 352
308 3300025917 Ga0207660_10020626 Ga0207660_100206263 352
309 3300025919 Ga0207657_10009048 Ga0207657_100090485 352
310 3300025919 Ga0207657_10243944 Ga0207657_102439441 352
311 3300025921 Ga0207652_10044923 Ga0207652_100449234 352
312 3300025924 Ga0207694_10026156 Ga0207694_100261562 352
313 3300025924 Ga0207694_10137577 Ga0207694_101375771 352
314 3300025926 Ga0207659_10129745 Ga0207659_101297452 352
315 3300025931 Ga0207644_10088291 Ga0207644_100882912 352
316 3300025932 Ga0207690_10011957 Ga0207690_100119574 352
317 3300025933 Ga0207706_10274340 Ga0207706_102743401 352
318 3300025940 Ga0207691_10201023 Ga0207691_102010232 352
319 3300025941 Ga0207711_10026804 Ga0207711_100268044 352
320 3300025941 Ga0207711_10145805 Ga0207711_101458051 352
321 3300025944 Ga0207661_10000290 Ga0207661_1000029022 352
322 3300025949 Ga0207667_10006693 Ga0207667_100066938 352
323 3300025949 Ga0207667_10121294 Ga0207667_101212943 352
324 3300025981 Ga0207640_10004924 Ga0207640_100049245 352
325 3300025981 Ga0207640_10264045 Ga0207640_102640451 352
326 3300025986 Ga0207658_10009284 Ga0207658_100092845 352
327 3300026023 Ga0207677_10271684 Ga0207677_102716842 352
328 3300026035 Ga0207703_10000328 Ga0207703_1000032832 352
329 3300026078 Ga0207702_10001036 Ga0207702_100010363 352
330 3300026078 Ga0207702_10043529 Ga0207702_100435293 352
331 3300026095 Ga0207676_10000720 Ga0207676_100007208 352
332 3300026116 Ga0207674_10002721 Ga0207674_1000272119 352
333 3300026116 Ga0207674_10226677 Ga0207674_102266772 352
334 3300026118 Ga0207675_100083143 Ga0207675_1000831433 352
335 3300026142 Ga0207698_10000067 Ga0207698_1000006767 352
336 3300026142 Ga0207698_10020255 Ga0207698_100202553 352
337 3300026142 Ga0207698_10219312 Ga0207698_102193121 352
338 3300026142 Ga0207698_10373197 Ga0207698_103731971 352
339 3300027907 Ga0207428_10012236 Ga0207428_100122366 352
340 3300031548 Ga0307408_100048166 Ga0307408_1000481663 352
341 3300031731 Ga0307405_10004996 Ga0307405_100049965 352
342 3300031824 Ga0307413_10002690 Ga0307413_100026906 352
343 3300031852 Ga0307410_10009435 Ga0307410_100094354 352
344 3300031852 Ga0307410_10109512 Ga0307410_101095122 352
345 3300031901 Ga0307406_10113483 Ga0307406_101134832 352
346 3300031911 Ga0307412_10006733 Ga0307412_100067335 352
347 3300032002 Ga0307416_100097560 Ga0307416_1000975601 352
348 3300032002 Ga0307416_100193533 Ga0307416_1001935332 352
349 3300032126 Ga0307415_100025720 Ga0307415_1000257203 352
350 3300032126 Ga0307415_100027084 Ga0307415_1000270843 352
351 3300035171 Ga0373946_0012062 Ga0373946_0012062_1134_2192 352
352 3300035695 Ga0373927_0049588 Ga0373927_0049588_941_1999 352
353 3300037312 Ga0395899_0000943 Ga0395899_0000943_11407_12465 352
354 3300037312 Ga0395899_0026236 Ga0395899_0026236_368_1426 352
355 3300037418 Ga0395900_0042428 Ga0395900_0042428_1597_2655 352
356 3300037418 Ga0395900_0112753 Ga0395900_0112753_129_1187 352
357 3300037418 Ga0395900_0146692 Ga0395900_0146692_880_1938 352
358 3300037418 Ga0395900_0163509 Ga0395900_0163509_986_2044 352
359 3300037466 Ga0395898_0001771 Ga0395898_0001771_7354_8412 352
360 3300037466 Ga0395898_0290336 Ga0395898_0290336_47_1105 352
361 3300037471 Ga0395905_0001250 Ga0395905_0001250_7354_8412 352
362 3300037471 Ga0395905_0012450 Ga0395905_0012450_7033_8091 352
363 3300037471 Ga0395905_0018160 Ga0395905_0018160_1797_2855 352
364 3300037471 Ga0395905_0023985 Ga0395905_0023985_3116_4174 352
365 3300037471 Ga0395905_0056103 Ga0395905_0056103_2599_3657 352
366 3300037471 Ga0395905_0084647 Ga0395905_0084647_351_1409 352
367 3300037471 Ga0395905_0216637 Ga0395905_0216637_170_1228 352
368 3300037471 Ga0395905_0357803 Ga0395905_0357803_41_1099 352
369 3300038443 Ga0395901_0000640 Ga0395901_0000640_4088_5146 352
370 3300038443 Ga0395901_0006730 Ga0395901_0006730_6962_8020 352
371 3300038443 Ga0395901_0041368 Ga0395901_0041368_3146_4204 352
372 3300039437 Ga0436365_1247980 Ga0436365_1247980_397_1455 352
373 3300044694 Ga0466963_0036381 Ga0466963_0036381_518_1576 352
374 3300044694 Ga0466963_0054621 Ga0466963_0054621_726_1784 352
375 3300044719 Ga0466971_0045823 Ga0466971_0045823_247_1305 352
376 3300044765 Ga0466970_0007851 Ga0466970_0007851_667_1725 352
377 3300044765 Ga0466970_0026546 Ga0466970_0026546_1774_2832 352
378 3300045049 Ga0466959_0055186 Ga0466959_0055186_1738_2796 352
379 3300045049 Ga0466959_0103038 Ga0466959_0103038_592_1650 352
380 3300045836 Ga0466958_0007878 Ga0466958_0007878_1035_2093 352
381 3300045836 Ga0466958_0029869 Ga0466958_0029869_1730_2788 352
382 3300045836 Ga0466958_0041571 Ga0466958_0041571_620_1678 352
383 3300045976 Ga0466967_0028387 Ga0466967_0028387_1243_2301 352
384 3300045976 Ga0466967_0285448 Ga0466967_0285448_88_1146 352
385 3300046558 Ga0495633_0001488 Ga0495633_0001488_3707_4765 352
386 3300053125 Ga0500618_001205 Ga0500618_001205_3851_4912 352
387 iso_pu_bacteria 2510917021 2511129819 352
388 3300046530 Ga0495654_0000274 Ga0495654_0000274_16017_17081 353
389 3300048914 Ga0496111_0167199 Ga0496111_0167199_284_1348 353
390 3300048927 Ga0496124_0115162 Ga0496124_0115162_1046_2110 353
391 2162886007 SwRhRL2b_contig_2038536 SwRhRL2b_0138.00010770 354
392 2162886007 SwRhRL2b_contig_2292987 SwRhRL2b_0423.00007120 354
393 3300001979 JGI24740J21852_10038367 JGI24740J21852_100383671 354
394 3300002773 JGI25152J39213_1000481 JGI25152J39213_100048116 354
395 3300002774 JGI25150J39212_1000175 JGI25150J39212_100017519 354
396 3300003187 JGI25151J46595_10000518 JGI25151J46595_1000051823 354
397 3300003187 JGI25151J46595_10001656 JGI25151J46595_100016564 354
398 3300003215 JGI25153J46596_10005250 JGI25153J46596_100052505 354
399 3300005262 Ga0065165_1003208 Ga0065165_100320810 354
400 3300005289 Ga0065704_10001247 Ga0065704_1000124711 354
401 3300005289 Ga0065704_10070346 Ga0065704_1007034610 354
402 3300005327 Ga0070658_10002371 Ga0070658_1000237110 354
403 3300005329 Ga0070683_100010674 Ga0070683_1000106744 354
404 3300005336 Ga0070680_100104246 Ga0070680_1001042462 354
405 3300005337 Ga0070682_100033344 Ga0070682_1000333442 354
406 3300005339 Ga0070660_100008150 Ga0070660_1000081501 354
407 3300005341 Ga0070691_10022964 Ga0070691_100229642 354
408 3300005367 Ga0070667_100002617 Ga0070667_1000026178 354
409 3300005457 Ga0070662_100008303 Ga0070662_1000083032 354
410 3300005535 Ga0070684_100007725 Ga0070684_1000077255 354
411 3300005539 Ga0068853_100002226 Ga0068853_1000022267 354
412 3300005548 Ga0070665_100002057 Ga0070665_10000205712 354
413 3300005616 Ga0068852_100179998 Ga0068852_1001799982 354
414 3300005618 Ga0068864_100007965 Ga0068864_1000079655 354
415 3300005841 Ga0068863_100000090 Ga0068863_10000009058 354
416 3300005842 Ga0068858_100006847 Ga0068858_1000068479 354
417 3300005843 Ga0068860_100000089 Ga0068860_10000008990 354
418 3300006946 Ga0079104_1000185 Ga0079104_100018537 354
419 3300009093 Ga0105240_10045659 Ga0105240_100456594 354
420 3300009101 Ga0105247_10096231 Ga0105247_100962312 354
421 3300009551 Ga0105238_10005484 Ga0105238_100054846 354
422 3300013100 Ga0157373_10001108 Ga0157373_1000110811 354
423 3300013102 Ga0157371_10001158 Ga0157371_1000115815 354
424 3300013105 Ga0157369_10045731 Ga0157369_100457313 354
425 3300013296 Ga0157374_10018327 Ga0157374_100183274 354
426 3300013307 Ga0157372_10001545 Ga0157372_1000154510 354
427 3300017792 Ga0163161_10029234 Ga0163161_100292342 354
428 3300025245 Ga0207425_1000300 Ga0207425_100030027 354
429 3300025258 Ga0209129_1000588 Ga0209129_100058819 354
430 3300025294 Ga0209025_1000992 Ga0209025_100099228 354
431 3300025297 Ga0209758_1000860 Ga0209758_100086027 354
432 3300025904 Ga0207647_10000533 Ga0207647_100005332 354
433 3300025909 Ga0207705_10101836 Ga0207705_101018362 354
434 3300025913 Ga0207695_10023300 Ga0207695_100233006 354
435 3300025917 Ga0207660_10013223 Ga0207660_100132234 354
436 3300025919 Ga0207657_10007987 Ga0207657_100079877 354
437 3300025920 Ga0207649_10008913 Ga0207649_100089134 354
438 3300025924 Ga0207694_10054721 Ga0207694_100547212 354
439 3300025932 Ga0207690_10001590 Ga0207690_1000159011 354
440 3300025933 Ga0207706_10014667 Ga0207706_100146672 354
441 3300025944 Ga0207661_10227223 Ga0207661_102272232 354
442 3300025945 Ga0207679_10019350 Ga0207679_100193504 354
443 3300025949 Ga0207667_10065975 Ga0207667_100659754 354
444 3300025972 Ga0207668_10184045 Ga0207668_101840452 354
445 3300025981 Ga0207640_10004636 Ga0207640_100046362 354
446 3300026035 Ga0207703_10035221 Ga0207703_100352213 354
447 3300026041 Ga0207639_10000839 Ga0207639_1000083910 354
448 3300026088 Ga0207641_10000069 Ga0207641_1000006959 354
449 3300026095 Ga0207676_10004305 Ga0207676_100043055 354
450 3300026116 Ga0207674_10054551 Ga0207674_100545513 354
451 3300026142 Ga0207698_10001384 Ga0207698_1000138410 354
452 3300027111 Ga0209281_1000211 Ga0209281_100021111 354
453 3300028379 Ga0268266_10001007 Ga0268266_1000100710 354
454 3300028379 Ga0268266_10113568 Ga0268266_101135681 354
455 3300028381 Ga0268264_10000160 Ga0268264_1000016058 354
456 3300037312 Ga0395899_0002700 Ga0395899_0002700_457_1521 354
457 3300037466 Ga0395898_0056619 Ga0395898_0056619_493_1557 354
458 3300037471 Ga0395905_0130916 Ga0395905_0130916_990_2054 354
459 3300046453 Ga0495627_000432 Ga0495627_000432_28467_29531 354
460 3300046453 Ga0495627_001001 Ga0495627_001001_13839_14903 354
461 3300046512 Ga0495610_0000243 Ga0495610_0000243_47819_48883 354
462 3300046512 Ga0495610_0000687 Ga0495610_0000687_17669_18736 354
463 3300046515 Ga0495620_0002894 Ga0495620_0002894_6328_7392 354
464 3300046520 Ga0495637_0003442 Ga0495637_0003442_316_1383 354
465 3300046524 Ga0495648_0057619 Ga0495648_0057619_571_1635 354
466 3300046525 Ga0495663_0021266 Ga0495663_0021266_630_1694 354
467 3300046660 Ga0495625_0000832 Ga0495625_0000832_14188_15255 354
468 3300046674 Ga0495588_0000566 Ga0495588_0000566_375_1442 354
469 3300047470 Ga0495681_0000179 Ga0495681_0000179_34210_35274 354
470 3300047470 Ga0495681_0001625 Ga0495681_0001625_12927_13991 354
471 3300047472 Ga0495686_0008456 Ga0495686_0008456_5926_7005 354
472 3300048906 Ga0496103_0059248 Ga0496103_0059248_636_1727 354
473 3300048907 Ga0496104_0004735 Ga0496104_0004735_2307_3398 354
474 3300048908 Ga0496105_0000838 Ga0496105_0000838_786_1877 354
475 3300048920 Ga0496117_0035067 Ga0496117_0035067_59_1150 354
476 3300048921 Ga0496118_0019063 Ga0496118_0019063_2006_3097 354
477 3300048923 Ga0496120_0052482 Ga0496120_0052482_990_2081 354
478 3300048924 Ga0496121_0009286 Ga0496121_0009286_7059_8159 354
479 3300048925 Ga0496122_0000157 Ga0496122_0000157_5080_6147 354
480 3300048926 Ga0496123_0000048 Ga0496123_0000048_238006_239073 354
481 3300048927 Ga0496124_0001488 Ga0496124_0001488_13367_14431 354
482 3300048927 Ga0496124_0032422 Ga0496124_0032422_2904_3968 354
483 3300048927 Ga0496124_0213044 Ga0496124_0213044_72_1142 354
484 3300048928 Ga0496125_0041191 Ga0496125_0041191_1881_2945 354
485 3300048928 Ga0496125_0127573 Ga0496125_0127573_468_1547 354
486 3300048929 Ga0496126_0001697 Ga0496126_0001697_19971_21035 354
487 3300049574 Ga0501038_0003137 Ga0501038_0003137_8409_9473 354
488 3300049653 Ga0501206_010654 Ga0501206_010654_72_1145 354
489 3300049658 Ga0501211_001878 Ga0501211_001878_407_1480 354
490 3300049705 Ga0501225_0009498 Ga0501225_0009498_1074_2147 354
491 3300053107 Ga0500560_000087 Ga0500560_000087_1928_2995 354
492 3300053125 Ga0500618_000211 Ga0500618_000211_3289_4362 354
493 3300053157 Ga0500624_000117 Ga0500624_000117_3079_4143 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

250

0.95

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

321

0.9

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

176

0.88

PF07993

NAD_binding_4

Male sterility protein

61

193

0.85

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

137

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

242

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9409 1 335
1g1a-assembly1.cif.gz_A the crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb)from salmonella enterica serovar typhimurium 0.9396 1 338
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9377 1 335
6bi4-assembly2.cif.gz_B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.9321 1 335
6bi4-assembly2.cif.gz_C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6-dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad. 0.929 1 335
ID Description Score Start End Superfamily
af_Q5QMG5_99_194_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9473 2 61 3.40.50.720
af_K7VJC9_94_197_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9469 2 61 3.40.50.720
1bxkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9276 2 314 3.40.50.720
4egbB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.923 1 311 3.40.50.720
4egbB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9188 1 311 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A662ZRW6-F1-model_v4 deleted 0.9816 171 327
AF-A0A3N5VJY6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9562 153 327
AF-A0A444QZH8-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.955 153 318
AF-A0A2M6Y005-F1-model_v4 dTDP-glucose 4,6-dehydratase 0.9544 179 338
AF-A0A7W7PVF3-F1-model_v4 dTDP-D-glucose 4,6-dehydratase 0.9511 183 338

Feature Viewer

pLDDT pTM Quality
86.06 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map