F454415

General Info

Members Datasets Scaffolds Average Seq Length
493 265 344 306

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10004602|Ga0105244_100046026
Length 324
Sequence MLHLTRYINIDRVGIQMNKPKIGMIGLGSIAQKAYLPTLTKELDWHFVGAFTPNAEKRKQICQQYRIQDFHSIETLASECDAVFVHSSTATHYEIVSELLKKGIDVYVDKPLAATVEQAEKLVELSEKYNRKLMVGFNRRFVPMYVAAKEQANAISWIRIEKHRTNKVGPNTYDFTMLDDYLHIVDTARWLANDDLNVVHNMMQINEKNELLYGHHTYTTTNGLLLSTAMHRHAGTNLEQIELVTAGKIIRVRNMNTFEIEQENSVSQSGSPSWETTLKQRGFEDAVHHFIECVHGDTKPVVDGLEGLKTQQMLQTLLDKVNKN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
6 2547132181 Kosakonia sacchari SP1 Isolate Stem
7 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
8 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
9 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
10 2561511199 Enterobacter sp. R4-368 Isolate Nodule
11 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
12 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
13 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
14 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
15 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
16 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
17 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
18 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
19 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
20 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
21 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
22 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
23 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
24 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
25 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
26 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
27 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
28 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
29 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
30 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
31 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
32 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
33 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
34 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
35 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
36 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
37 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
38 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
39 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
40 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
41 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
42 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
43 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
44 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
45 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
46 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
47 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
48 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
49 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
50 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
51 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
52 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
53 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
54 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
55 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
56 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
57 2636415599 Klebsiella variicola DX120E Isolate Unclassified
58 2643221729 Bacillus sp. Root11 Isolate Unclassified
59 2643221730 Bacillus sp. Root131 Isolate Unclassified
60 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
61 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
62 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
63 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
64 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
65 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
66 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
67 2684622632 Bacillus cereus 905 Isolate Unclassified
68 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
69 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
70 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
71 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
72 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
73 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
74 2738541358 Bacillus sp. OV752 Isolate Unclassified
75 2738543006 Bacillus sp. OK077 Isolate Unclassified
76 2751185917 Enterobacter sp. HK169 Isolate Unclassified
77 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
78 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
79 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
80 2775507074 Klebsiella sp. D5A Isolate Unclassified
81 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
82 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
83 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
84 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
85 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
86 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
87 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
88 2821118458 Enterobacter asburiae 609 Isolate Unclassified
89 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
90 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
91 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
92 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
93 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
94 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
95 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
96 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
97 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
98 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
99 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
100 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
101 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
102 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
103 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
104 2904504865 Serratia marcescens 1822 Isolate Unclassified
105 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
106 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
107 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
108 2919150387 Rahnella aceris 1817 Isolate Unclassified
109 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
110 2927143783 Rahnella sp. 2050 Isolate Unclassified
111 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
112 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
113 2932406140 Serratia sp. 2723 Isolate Rhizosphere
114 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
115 2937539931 Pantoea sp. LS15 Isolate Unclassified
116 2937967321 Serratia sp. YC16 Isolate Unclassified
117 2938917290 Bacillus sp. CR71 Isolate Unclassified
118 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
119 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
120 2939577877 Serratia sp. 509 Isolate Rhizosphere
121 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
122 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
123 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
124 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
125 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
126 2965761152 Bacillus sp. COPE52 Isolate Unclassified
127 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
128 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
129 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
130 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
131 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
132 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
133 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
134 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
135 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
136 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
137 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
138 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
139 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
140 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
141 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
142 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
143 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
144 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
145 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
146 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
147 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
148 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
149 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
150 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
151 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
152 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
153 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
154 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
155 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
156 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
157 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
158 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
159 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
160 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
170 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
171 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
172 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
196 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
197 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
203 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
250 640753048 Serratia proteamaculans 568 Isolate Endosphere
251 8004592986 Serratia sp. S119 Isolate Unclassified
252 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
253 8018221730 Enterobacter sp. CM29 Isolate Unclassified
254 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
255 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
256 8022792930 Bacillus sp. Xin Isolate Rhizosphere
257 8023438354 Bacillus sp. BH2 Isolate Unclassified
258 8023444577 Bacillus sp. BH32 Isolate Unclassified
259 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
260 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
261 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
262 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
263 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
264 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
265 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.78
Metatranscriptomes 0
Isolates 30.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 9.13
Nodule 4.67
Rhizoplane 11.97
Rhizosphere 43.81
Stem 0.2
Stem Tuber 1.22
Unclassified 28.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1083203 2162886007 Bacteria 3067
2 SwRhRL2b_contig_2128605 2162886007 Bacteria 4644
3 JGI25162J39368_1000019 3300002737 Bacteria 262053
4 JGI25163J39215_1000079 3300002771 Bacteria 42883
5 JGI25164J39214_1000011 3300002772 Bacteria 262057
6 JGI25152J39213_1001623 3300002773 Bacteria 9388
7 JGI25159J45721_1009161 3300002987 Bacteria 2637
8 JGI25159J45721_1010018 3300002987 Bacteria 2451
9 JGI25151J46595_10000727 3300003187 Bacteria 27386
10 JGI25151J46595_10007592 3300003187 Bacteria 5293
11 JGI25151J46595_10029222 3300003187 Bacteria 2185
12 JGI25151J46595_10037260 3300003187 Bacteria 1825
13 rootH2_10001915 3300003320 Bacteria 32137
14 Ga0055538_1000021 3300003751 Bacteria 262057
15 Ga0055539_1000026 3300003752 Bacteria 262057
16 Ga0055533_1000035 3300003756 Bacteria 262057
17 Ga0055525_1000045 3300003759 Bacteria 262057
18 Ga0055541_1000020 3300003841 Bacteria 262057
19 Ga0058692_1001688 3300003856 Bacteria 7914
20 Ga0058692_1002011 3300003856 Bacteria 7054
21 Ga0058692_1002955 3300003856 Bacteria 5465
22 Ga0058692_1014543 3300003856 Bacteria 1799
23 Ga0065703_1019352 3300005272 Bacteria 3138
24 Ga0065704_10000333 3300005289 Bacteria 49423
25 Ga0065704_10003968 3300005289 Bacteria 10032
26 Ga0065704_10075866 3300005289 Bacteria 5347
27 Ga0065704_10081102 3300005289 Bacteria 3819
28 Ga0070665_100000262 3300005548 Bacteria 86632
29 Ga0068857_100000082 3300005577 Bacteria 55308
30 Ga0075364_10004261 3300006051 Bacteria 8212
31 Ga0075364_10051357 3300006051 Bacteria 2692
32 Ga0075364_10209838 3300006051 Bacteria 1321
33 Ga0075366_10005587 3300006195 Bacteria 6818
34 Ga0079104_1000035 3300006946 Bacteria 198709
35 Ga0079104_1000274 3300006946 Bacteria 67264
36 Ga0079104_1000343 3300006946 Bacteria 56060
37 Ga0079104_1000464 3300006946 Bacteria 45595
38 Ga0079104_1000709 3300006946 Bacteria 30234
39 Ga0079104_1000819 3300006946 Bacteria 25996
40 Ga0079104_1001797 3300006946 Bacteria 13307
41 Ga0079104_1003555 3300006946 Bacteria 7168
42 Ga0079104_1004489 3300006946 Bacteria 5938
43 Ga0079104_1004816 3300006946 Bacteria 5617
44 Ga0079104_1015178 3300006946 Bacteria 2291
45 Ga0105251_10000740 3300009011 Bacteria 29928
46 Ga0105251_10000748 3300009011 Bacteria 29683
47 Ga0105251_10002213 3300009011 Bacteria 15519
48 Ga0105251_10002549 3300009011 Bacteria 14164
49 Ga0105251_10002676 3300009011 Bacteria 13720
50 Ga0105251_10002876 3300009011 Bacteria 12987
51 Ga0105251_10005182 3300009011 Bacteria 8604
52 Ga0105251_10009227 3300009011 Bacteria 5848
53 Ga0105251_10069447 3300009011 Bacteria 1642
54 Ga0105251_10126158 3300009011 Bacteria 1162
55 Ga0105244_10000117 3300009036 Bacteria 83982
56 Ga0105244_10000491 3300009036 Bacteria 35705
57 Ga0105244_10001091 3300009036 Bacteria 22607
58 Ga0105244_10001660 3300009036 Bacteria 17613
59 Ga0105244_10003195 3300009036 Bacteria 11877
60 Ga0105244_10004371 3300009036 Bacteria 9744
61 Ga0105244_10004602 3300009036 Bacteria 9443
62 Ga0105244_10012720 3300009036 Bacteria 4962
63 Ga0105244_10018028 3300009036 Bacteria 3974
64 Ga0105244_10020234 3300009036 Bacteria 3699
65 Ga0105244_10032135 3300009036 Bacteria 2781
66 Ga0105244_10054055 3300009036 Bacteria 2038
67 Ga0105244_10062481 3300009036 Bacteria 1872
68 Ga0105244_10074127 3300009036 Bacteria 1693
69 Ga0105244_10098013 3300009036 Bacteria 1436
70 Ga0105250_10000001 3300009092 Bacteria 617357
71 Ga0105250_10000535 3300009092 Bacteria 26313
72 Ga0105250_10000917 3300009092 Bacteria 17339
73 Ga0105250_10002649 3300009092 Bacteria 8881
74 Ga0105250_10002792 3300009092 Bacteria 8567
75 Ga0105250_10003048 3300009092 Bacteria 8091
76 Ga0105250_10004835 3300009092 Bacteria 6131
77 Ga0105250_10010641 3300009092 Bacteria 3832
78 Ga0105250_10017981 3300009092 Bacteria 2868
79 Ga0105250_10019994 3300009092 Bacteria 2707
80 Ga0105247_10000012 3300009101 Bacteria 292188
81 Ga0105243_10355494 3300009148 Bacteria 1347
82 Ga0105241_10000001 3300009174 Bacteria 879793
83 Ga0105246_10170217 3300011119 Bacteria 1668
84 Ga0157373_10000779 3300013100 Bacteria 24578
85 Ga0157373_10065256 3300013100 Bacteria 2576
86 Ga0157371_10000098 3300013102 Bacteria 134017
87 Ga0157371_10033850 3300013102 Bacteria 3669
88 Ga0157370_10003193 3300013104 Bacteria 19382
89 Ga0163162_10006068 3300013306 Bacteria 11695
90 Ga0157372_10001655 3300013307 Bacteria 24172
91 Ga0157372_10003992 3300013307 Bacteria 15837
92 Ga0182008_10006475 3300014497 Bacteria 6541
93 Ga0182006_1000022 3300015261 Bacteria 275350
94 Ga0183366_1001 3300015679 Bacteria 2743932
95 Ga0183370_1001 3300015680 Bacteria 2743932
96 Ga0183369_1001 3300015685 Bacteria 2743932
97 Ga0183368_1001 3300015687 Bacteria 2743932
98 Ga0163161_10000001 3300017792 Bacteria 2041488
99 Ga0213876_10000086 3300021384 Bacteria 106079
100 Ga0209760_100004 3300025207 Bacteria 254650
101 Ga0209784_100001 3300025224 Bacteria 3600592
102 Ga0209566_100001 3300025225 Bacteria 3600765
103 Ga0209674_100002 3300025226 Bacteria 3600592
104 Ga0209563_100002 3300025230 Bacteria 2045675
105 Ga0207427_100012 3300025231 Bacteria 585657
106 Ga0209437_100001 3300025233 Bacteria 2045675
107 Ga0209677_100002 3300025253 Bacteria 2045675
108 Ga0209129_1000018 3300025258 Bacteria 469298
109 Ga0209233_1000805 3300025261 Bacteria 13994
110 Ga0209130_1000969 3300025284 Bacteria 22634
111 Ga0209130_1002386 3300025284 Bacteria 9507
112 Ga0209130_1009739 3300025284 Bacteria 2709
113 Ga0209025_1000353 3300025294 Bacteria 99365
114 Ga0209025_1002464 3300025294 Bacteria 19538
115 Ga0209025_1005982 3300025294 Bacteria 9667
116 Ga0209025_1007008 3300025294 Bacteria 8549
117 Ga0209025_1007407 3300025294 Bacteria 8200
118 Ga0209025_1008112 3300025294 Bacteria 7631
119 Ga0209025_1018247 3300025294 Bacteria 3995
120 Ga0209025_1030536 3300025294 Bacteria 2577
121 Ga0207696_1000001 3300025711 Bacteria 2579611
122 Ga0207696_1000015 3300025711 Bacteria 507848
123 Ga0207696_1000077 3300025711 Bacteria 209611
124 Ga0207696_1000170 3300025711 Bacteria 102852
125 Ga0207696_1000298 3300025711 Bacteria 57382
126 Ga0207696_1000482 3300025711 Bacteria 33749
127 Ga0207696_1001040 3300025711 Bacteria 16508
128 Ga0207696_1001602 3300025711 Bacteria 11978
129 Ga0207696_1008657 3300025711 Bacteria 3864
130 Ga0207655_1000001 3300025728 Bacteria 1866413
131 Ga0207655_1000009 3300025728 Bacteria 664676
132 Ga0207655_1000046 3300025728 Bacteria 309474
133 Ga0207655_1000110 3300025728 Bacteria 171137
134 Ga0207655_1000229 3300025728 Bacteria 93185
135 Ga0207655_1000506 3300025728 Bacteria 49895
136 Ga0207655_1000763 3300025728 Bacteria 36016
137 Ga0207655_1001416 3300025728 Bacteria 22268
138 Ga0207655_1013419 3300025728 Bacteria 4706
139 Ga0207655_1038898 3300025728 Bacteria 2072
140 Ga0207713_1000004 3300025735 Bacteria 702781
141 Ga0207713_1000088 3300025735 Bacteria 155734
142 Ga0207713_1000648 3300025735 Bacteria 33341
143 Ga0207713_1000753 3300025735 Bacteria 30153
144 Ga0207713_1000762 3300025735 Bacteria 29825
145 Ga0207713_1001329 3300025735 Bacteria 20259
146 Ga0207713_1017663 3300025735 Bacteria 3563
147 Ga0207713_1017712 3300025735 Bacteria 3557
148 Ga0207710_10000083 3300025900 Bacteria 136593
149 Ga0207654_10000004 3300025911 Bacteria 902334
150 Ga0209281_1000001 3300027111 Bacteria 1933496
151 Ga0209281_1000003 3300027111 Bacteria 1260089
152 Ga0209281_1000114 3300027111 Bacteria 210536
153 Ga0209281_1000180 3300027111 Bacteria 147099
154 Ga0209281_1000229 3300027111 Bacteria 118957
155 Ga0209281_1000267 3300027111 Bacteria 100564
156 Ga0209281_1000288 3300027111 Bacteria 93347
157 Ga0209281_1000383 3300027111 Bacteria 70062
158 Ga0209281_1000722 3300027111 Bacteria 32788
159 Ga0209281_1001917 3300027111 Bacteria 9885
160 Ga0209281_1002477 3300027111 Bacteria 7347
161 Ga0209371_1000001 3300027312 Bacteria 2771503
162 Ga0209371_1000081 3300027312 Bacteria 185440
163 Ga0209371_1000086 3300027312 Bacteria 175099
164 Ga0209371_1000616 3300027312 Bacteria 31750
165 Ga0209371_1000809 3300027312 Bacteria 25834
166 Ga0209371_1001458 3300027312 Bacteria 16004
167 Ga0209371_1002095 3300027312 Bacteria 11843
168 Ga0209371_1003591 3300027312 Bacteria 7413
169 Ga0209371_1004146 3300027312 Bacteria 6491
170 Ga0209371_1009627 3300027312 Bacteria 3052
171 Ga0209371_1010630 3300027312 Bacteria 2809
172 Ga0209371_1013777 3300027312 Bacteria 2247
173 Ga0268266_10000282 3300028379 Bacteria 83781
174 Ga0237817_10167 3300030083 Bacteria 18907
175 Ga0237817_10395 3300030083 Bacteria 7423
176 Ga0268256_1000001 3300030500 Bacteria 2771065
177 Ga0268256_1000003 3300030500 Bacteria 1289401
178 Ga0268256_1000175 3300030500 Bacteria 76497
179 Ga0268256_1000920 3300030500 Bacteria 20333
180 Ga0268256_1001317 3300030500 Bacteria 15229
181 Ga0268256_1001749 3300030500 Bacteria 12267
182 Ga0268256_1002069 3300030500 Bacteria 10802
183 Ga0268256_1003892 3300030500 Bacteria 6491
184 Ga0268256_1008788 3300030500 Bacteria 3431
185 Ga0268256_1011424 3300030500 Bacteria 2809
186 Ga0268256_1016067 3300030500 Bacteria 2158
187 Ga0237819_00266 3300038705 Bacteria 19073
188 Ga0237819_01016 3300038705 Bacteria 8425
189 Ga0436365_1037676 3300039437 Bacteria 170132
190 Ga0439438_003376 3300041405 Bacteria 6463
191 Ga0439438_004342 3300041405 Bacteria 5466
192 Ga0439438_009966 3300041405 Bacteria 3043
193 Ga0451853_1484765 3300041512 Bacteria 4094
194 Ga0439432_023186 3300042006 Bacteria 2046
195 Ga0439452_000003 3300042010 Bacteria 942815
196 Ga0439452_000008 3300042010 Bacteria 569877
197 Ga0439452_000161 3300042010 Bacteria 49828
198 Ga0439452_000216 3300042010 Bacteria 40719
199 Ga0439452_002880 3300042010 Bacteria 6178
200 Ga0466981_0000016 3300044669 Bacteria 100013
201 Ga0466967_0000101 3300045976 Bacteria 31089
202 Ga0495627_000027 3300046453 Bacteria 236960
203 Ga0495591_000238 3300046458 Bacteria 52890
204 Ga0495591_002382 3300046458 Bacteria 10545
205 Ga0495638_0002381 3300046460 Bacteria 15407
206 Ga0495650_0000021 3300046471 Bacteria 531242
207 Ga0495650_0000032 3300046471 Bacteria 425389
208 Ga0495650_0000182 3300046471 Bacteria 137031
209 Ga0495584_0002351 3300046491 Bacteria 10777
210 Ga0495607_0007488 3300046501 Bacteria 7547
211 Ga0495606_0001314 3300046507 Bacteria 34190
212 Ga0495616_0021328 3300046513 Bacteria 3509
213 Ga0495620_0003066 3300046515 Bacteria 9591
214 Ga0495643_0098228 3300046522 Bacteria 1503
215 Ga0495644_0006862 3300046523 Bacteria 4407
216 Ga0495648_0006462 3300046524 Bacteria 9563
217 Ga0495654_0000356 3300046530 Bacteria 39697
218 Ga0495654_0011962 3300046530 Bacteria 4678
219 Ga0495654_0094073 3300046530 Bacteria 1387
220 Ga0495597_0000537 3300046542 Bacteria 31420
221 Ga0495625_0008966 3300046660 Bacteria 8448
222 Ga0495588_0004121 3300046674 Bacteria 6398
223 Ga0495671_0006021 3300046692 Bacteria 7048
224 Ga0495671_0181174 3300046692 Bacteria 1023
225 Ga0495649_0015407 3300046694 Bacteria 4352
226 Ga0495649_0048499 3300046694 Bacteria 2307
227 Ga0495589_0000001 3300046794 Bacteria 888100
228 Ga0495589_0028080 3300046794 Bacteria 2842
229 Ga0495660_0000004 3300046810 Bacteria 1003183
230 Ga0495660_0000021 3300046810 Bacteria 293250
231 Ga0495672_0000002 3300047320 Bacteria 740116
232 Ga0495672_0000020 3300047320 Bacteria 432845
233 Ga0495683_0143795 3300047323 Bacteria 1115
234 Ga0495679_000020 3300047446 Bacteria 228413
235 Ga0495679_009670 3300047446 Bacteria 3841
236 Ga0495679_029432 3300047446 Bacteria 1791
237 Ga0495679_029913 3300047446 Bacteria 1772
238 Ga0495673_0000065 3300047469 Bacteria 222481
239 Ga0495673_0000081 3300047469 Bacteria 199943
240 Ga0495681_0007465 3300047470 Bacteria 6979
241 Ga0496100_0043881 3300048903 Bacteria 2861
242 Ga0496100_0147435 3300048903 Bacteria 1675
243 Ga0496101_0088123 3300048904 Bacteria 2305
244 Ga0496104_0000893 3300048907 Bacteria 25662
245 Ga0496104_0003863 3300048907 Bacteria 12962
246 Ga0496104_0295567 3300048907 Bacteria 1532
247 Ga0496105_0026844 3300048908 Bacteria 4699
248 Ga0496116_0000001 3300048919 Bacteria 1501681
249 Ga0496116_0000094 3300048919 Bacteria 205588
250 Ga0496116_0000392 3300048919 Bacteria 64036
251 Ga0496116_0000930 3300048919 Bacteria 36114
252 Ga0496116_0023587 3300048919 Bacteria 4578
253 Ga0496116_0047741 3300048919 Bacteria 2879
254 Ga0496116_0119007 3300048919 Bacteria 1533
255 Ga0496117_0001414 3300048920 Bacteria 34795
256 Ga0496117_0002170 3300048920 Bacteria 25573
257 Ga0496117_0002234 3300048920 Bacteria 24995
258 Ga0496117_0006051 3300048920 Bacteria 12425
259 Ga0496117_0013317 3300048920 Bacteria 7185
260 Ga0496117_0064649 3300048920 Bacteria 2493
261 Ga0496117_0064937 3300048920 Bacteria 2484
262 Ga0496117_0070283 3300048920 Bacteria 2352
263 Ga0496117_0083923 3300048920 Bacteria 2080
264 Ga0496117_0136289 3300048920 Bacteria 1478
265 Ga0496118_0002508 3300048921 Bacteria 24634
266 Ga0496118_0002970 3300048921 Bacteria 21939
267 Ga0496118_0008590 3300048921 Bacteria 10513
268 Ga0496118_0015079 3300048921 Bacteria 7181
269 Ga0496118_0017379 3300048921 Bacteria 6548
270 Ga0496118_0125585 3300048921 Bacteria 1661
271 Ga0496119_0000008 3300048922 Bacteria 446822
272 Ga0496119_0000080 3300048922 Bacteria 139962
273 Ga0496119_0001831 3300048922 Bacteria 24634
274 Ga0496119_0002686 3300048922 Bacteria 19209
275 Ga0496119_0004122 3300048922 Bacteria 14639
276 Ga0496119_0005060 3300048922 Bacteria 12816
277 Ga0496119_0009516 3300048922 Bacteria 8324
278 Ga0496119_0085864 3300048922 Bacteria 1801
279 Ga0496119_0140351 3300048922 Bacteria 1305
280 Ga0496119_0232048 3300048922 Bacteria 938
281 Ga0496120_0000075 3300048923 Bacteria 163540
282 Ga0496120_0000128 3300048923 Bacteria 127855
283 Ga0496120_0000641 3300048923 Bacteria 51804
284 Ga0496120_0000940 3300048923 Bacteria 40056
285 Ga0496120_0002130 3300048923 Bacteria 21149
286 Ga0496120_0003711 3300048923 Bacteria 13599
287 Ga0496120_0006896 3300048923 Bacteria 8573
288 Ga0496120_0009817 3300048923 Bacteria 6744
289 Ga0496120_0023153 3300048923 Bacteria 3892
290 Ga0496120_0107419 3300048923 Bacteria 1463
291 Ga0496120_0117770 3300048923 Bacteria 1377
292 Ga0496120_0181056 3300048923 Bacteria 1034
293 Ga0496121_0001134 3300048924 Bacteria 46801
294 Ga0496121_0002930 3300048924 Bacteria 24980
295 Ga0496121_0003880 3300048924 Bacteria 20785
296 Ga0496121_0029389 3300048924 Bacteria 5082
297 Ga0496121_0031328 3300048924 Bacteria 4860
298 Ga0496121_0056449 3300048924 Bacteria 3262
299 Ga0496121_0174032 3300048924 Bacteria 1560
300 Ga0496121_0262152 3300048924 Bacteria 1192
301 Ga0496122_0000007 3300048925 Bacteria 606493
302 Ga0496122_0000356 3300048925 Bacteria 98548
303 Ga0496122_0001024 3300048925 Bacteria 49397
304 Ga0496122_0001535 3300048925 Bacteria 36726
305 Ga0496122_0004658 3300048925 Bacteria 16853
306 Ga0496122_0017955 3300048925 Bacteria 6565
307 Ga0496122_0050743 3300048925 Bacteria 3160
308 Ga0496122_0091004 3300048925 Bacteria 2079
309 Ga0496123_0000004 3300048926 Bacteria 777230
310 Ga0496123_0000248 3300048926 Bacteria 109122
311 Ga0496123_0000309 3300048926 Bacteria 94366
312 Ga0496123_0001080 3300048926 Bacteria 41095
313 Ga0496123_0002455 3300048926 Bacteria 22975
314 Ga0496123_0008295 3300048926 Bacteria 9566
315 Ga0496123_0023863 3300048926 Bacteria 4669
316 Ga0496123_0047822 3300048926 Bacteria 2885
317 Ga0496123_0085933 3300048926 Bacteria 1889
318 Ga0496123_0090890 3300048926 Bacteria 1813
319 Ga0496124_0000008 3300048927 Bacteria 864372
320 Ga0496124_0000025 3300048927 Bacteria 405471
321 Ga0496124_0000097 3300048927 Bacteria 183703
322 Ga0496124_0000659 3300048927 Bacteria 56974
323 Ga0496124_0001496 3300048927 Bacteria 34238
324 Ga0496124_0011293 3300048927 Bacteria 8941
325 Ga0496124_0083078 3300048927 Bacteria 2628
326 Ga0496124_0174397 3300048927 Bacteria 1661
327 Ga0496125_0000013 3300048928 Bacteria 628761
328 Ga0496125_0000055 3300048928 Bacteria 278140
329 Ga0496125_0002587 3300048928 Bacteria 23244
330 Ga0496125_0003192 3300048928 Bacteria 20252
331 Ga0496125_0008301 3300048928 Bacteria 10905
332 Ga0496125_0024948 3300048928 Bacteria 5486
333 Ga0496125_0053161 3300048928 Bacteria 3323
334 Ga0496125_0108944 3300048928 Bacteria 2012
335 Ga0496126_0000276 3300048929 Bacteria 108459
336 Ga0496126_0001242 3300048929 Bacteria 41379
337 Ga0496126_0001275 3300048929 Bacteria 40477
338 Ga0496126_0114238 3300048929 Bacteria 2349
339 Ga0495678_000817 3300049459 Bacteria 27883
340 Ga0495682_0000015 3300049460 Bacteria 235048
341 nmdc:mga00v17_151666_c1 3300050491 Bacteria 1489
342 nmdc:mga00v17_629_c1 3300050491 Bacteria 19512
343 nmdc:mga0k408_5660_c1 3300050493 Bacteria 6640
344 Ga0500621_000001 3300053126 Bacteria 1049698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_151666_c1 nmdc:mga00v17_151666_c1_32_865 277
2 3300048923 Ga0496120_0181056 Ga0496120_0181056_21_878 285
3 3300009092 Ga0105250_10000001 Ga0105250_10000001256 295
4 3300047446 Ga0495679_029432 Ga0495679_029432_826_1716 296
5 3300025728 Ga0207655_1038898 Ga0207655_10388982 298
6 iso_pu_bacteria 2904504865 2904507510 298
7 3300009011 Ga0105251_10126158 Ga0105251_101261582 299
8 3300013307 Ga0157372_10001655 Ga0157372_1000165518 299
9 3300039437 Ga0436365_1037676 Ga0436365_1037676_139597_140496 299
10 3300041405 Ga0439438_003376 Ga0439438_003376_2787_3686 299
11 3300046692 Ga0495671_0181174 Ga0495671_0181174_63_962 299
12 3300048925 Ga0496122_0001024 Ga0496122_0001024_18894_19793 299
13 3300048926 Ga0496123_0000248 Ga0496123_0000248_27068_27967 299
14 3300048926 Ga0496123_0090890 Ga0496123_0090890_797_1696 299
15 iso_pu_bacteria 2585427591 2585827599 299
16 iso_pu_bacteria 2585427592 2585832333 299
17 iso_pu_bacteria 2667528173 2671108681 299
18 iso_pu_bacteria 2904474040 2904475624 299
19 iso_pu_bacteria 2919150387 2919151793 299
20 iso_pu_bacteria 2927143783 2927144462 299
21 iso_pu_bacteria 8055693939 8055695847 299
22 3300015261 Ga0182006_1000022 Ga0182006_1000022134 300
23 3300041405 Ga0439438_009966 Ga0439438_009966_257_1159 300
24 3300042010 Ga0439452_000003 Ga0439452_000003_106907_107809 300
25 3300048919 Ga0496116_0119007 Ga0496116_0119007_99_1001 300
26 3300048922 Ga0496119_0232048 Ga0496119_0232048_21_923 300
27 iso_pu_bacteria 2706794495 2707098981 300
28 iso_pu_bacteria 2854601825 2854602307 300
29 iso_pu_bacteria 2932406140 2932407877 301
30 iso_pu_bacteria 2939577877 2939580282 301
31 iso_pu_bacteria 8022792930 8022797931 301
32 3300025711 Ga0207696_1000015 Ga0207696_1000015433 302
33 iso_pu_bacteria 2506520007 2506578960 302
34 iso_pu_bacteria 2506520008 2506584099 302
35 iso_pu_bacteria 2508501071 2508852833 302
36 iso_pu_bacteria 2654587920 2656279833 302
37 iso_pu_bacteria 2687453601 2689445415 302
38 iso_pu_bacteria 2772190666 2772439386 302
39 iso_pu_bacteria 2806310673 2807179789 302
40 iso_pu_bacteria 2852103415 2852104545 302
41 iso_pu_bacteria 2869551831 2869554867 302
42 iso_pu_bacteria 2888366609 2888369449 302
43 iso_pu_bacteria 2937967321 2937968017 302
44 iso_pu_bacteria 640753048 640938334 302
45 iso_pu_bacteria 8004592986 8004596966 302
46 iso_pu_bacteria 8015394850 8015395578 302
47 3300002737 JGI25162J39368_1000019 JGI25162J39368_1000019231 303
48 3300002771 JGI25163J39215_1000079 JGI25163J39215_100007912 303
49 3300002772 JGI25164J39214_1000011 JGI25164J39214_100001143 303
50 3300003751 Ga0055538_1000021 Ga0055538_100002143 303
51 3300003752 Ga0055539_1000026 Ga0055539_1000026231 303
52 3300003756 Ga0055533_1000035 Ga0055533_100003543 303
53 3300003759 Ga0055525_1000045 Ga0055525_100004543 303
54 3300003841 Ga0055541_1000020 Ga0055541_100002043 303
55 3300009011 Ga0105251_10069447 Ga0105251_100694472 303
56 3300009036 Ga0105244_10001660 Ga0105244_100016609 303
57 3300013102 Ga0157371_10000098 Ga0157371_1000009852 303
58 3300013306 Ga0163162_10006068 Ga0163162_100060682 303
59 3300025207 Ga0209760_100004 Ga0209760_10000442 303
60 3300025224 Ga0209784_100001 Ga0209784_1000012547 303
61 3300025225 Ga0209566_100001 Ga0209566_1000012547 303
62 3300025226 Ga0209674_100002 Ga0209674_1000022547 303
63 3300025230 Ga0209563_100002 Ga0209563_1000021082 303
64 3300025231 Ga0207427_100012 Ga0207427_100012269 303
65 3300025233 Ga0209437_100001 Ga0209437_1000011082 303
66 3300025253 Ga0209677_100002 Ga0209677_1000021082 303
67 3300025261 Ga0209233_1000805 Ga0209233_10008052 303
68 3300025711 Ga0207696_1000298 Ga0207696_100029837 303
69 3300025728 Ga0207655_1000229 Ga0207655_100022940 303
70 3300046471 Ga0495650_0000182 Ga0495650_0000182_110185_111096 303
71 3300046810 Ga0495660_0000004 Ga0495660_0000004_816483_817394 303
72 3300048907 Ga0496104_0003863 Ga0496104_0003863_9542_10453 303
73 3300048919 Ga0496116_0000094 Ga0496116_0000094_41894_42805 303
74 3300048920 Ga0496117_0013317 Ga0496117_0013317_5608_6519 303
75 3300048920 Ga0496117_0083923 Ga0496117_0083923_1022_1933 303
76 3300048921 Ga0496118_0002970 Ga0496118_0002970_9694_10605 303
77 3300048921 Ga0496118_0125585 Ga0496118_0125585_17_928 303
78 3300048923 Ga0496120_0002130 Ga0496120_0002130_11274_12185 303
79 3300048925 Ga0496122_0000007 Ga0496122_0000007_342268_343179 303
80 3300048926 Ga0496123_0000004 Ga0496123_0000004_434051_434962 303
81 3300048927 Ga0496124_0000025 Ga0496124_0000025_141013_141924 303
82 3300048928 Ga0496125_0000013 Ga0496125_0000013_238272_239183 303
83 3300048929 Ga0496126_0000276 Ga0496126_0000276_42123_43034 303
84 iso_pu_bacteria 2547132181 2547694982 303
85 iso_pu_bacteria 2547132416 2548648038 303
86 iso_pu_bacteria 2551306519 2553396477 303
87 iso_pu_bacteria 2554235234 2555260404 303
88 iso_pu_bacteria 2561511199 2562467007 303
89 iso_pu_bacteria 2599185169 2599411092 303
90 iso_pu_bacteria 2600255254 2601521438 303
91 iso_pu_bacteria 2600255255 2601526463 303
92 iso_pu_bacteria 2600255256 2601535059 303
93 iso_pu_bacteria 2600255257 2601541460 303
94 iso_pu_bacteria 2600255280 2601613293 303
95 iso_pu_bacteria 2600255281 2601622196 303
96 iso_pu_bacteria 2600255287 2601643337 303
97 iso_pu_bacteria 2600255288 2601650232 303
98 iso_pu_bacteria 2600255289 2601655521 303
99 iso_pu_bacteria 2600255290 2601656768 303
100 iso_pu_bacteria 2600255291 2601663158 303
101 iso_pu_bacteria 2600255298 2601696117 303
102 iso_pu_bacteria 2600255299 2601700791 303
103 iso_pu_bacteria 2600255300 2601704565 303
104 iso_pu_bacteria 2600255301 2601709594 303
105 iso_pu_bacteria 2600255302 2601714606 303
106 iso_pu_bacteria 2600255303 2601721142 303
107 iso_pu_bacteria 2600255304 2601725012 303
108 iso_pu_bacteria 2600255305 2601729554 303
109 iso_pu_bacteria 2600255306 2601734571 303
110 iso_pu_bacteria 2600255307 2601744092 303
111 iso_pu_bacteria 2600255309 2601753349 303
112 iso_pu_bacteria 2600255310 2601758241 303
113 iso_pu_bacteria 2600255311 2601764350 303
114 iso_pu_bacteria 2600255392 2602020801 303
115 iso_pu_bacteria 2602042046 2603638388 303
116 iso_pu_bacteria 2602042047 2603642883 303
117 iso_pu_bacteria 2602042052 2603660542 303
118 iso_pu_bacteria 2602042053 2603665817 303
119 iso_pu_bacteria 2602042066 2603698072 303
120 iso_pu_bacteria 2602042067 2603703489 303
121 iso_pu_bacteria 2602042103 2603836924 303
122 iso_pu_bacteria 2602042104 2603842000 303
123 iso_pu_bacteria 2602042105 2603847073 303
124 iso_pu_bacteria 2602042106 2603852143 303
125 iso_pu_bacteria 2602042109 2603867423 303
126 iso_pu_bacteria 2602042110 2603870197 303
127 iso_pu_bacteria 2602042111 2603875155 303
128 iso_pu_bacteria 2603880178 2606047388 303
129 iso_pu_bacteria 2603880184 2606070248 303
130 iso_pu_bacteria 2603880202 2606146109 303
131 iso_pu_bacteria 2603880211 2606174789 303
132 iso_pu_bacteria 2609459761 2609910065 303
133 iso_pu_bacteria 2636415599 2637226009 303
134 iso_pu_bacteria 2643221729 2644706351 303
135 iso_pu_bacteria 2643221730 2644713032 303
136 iso_pu_bacteria 2667528172 2671103427 303
137 iso_pu_bacteria 2671180115 2671587299 303
138 iso_pu_bacteria 2675903046 2676407800 303
139 iso_pu_bacteria 2681812866 2681997445 303
140 iso_pu_bacteria 2681812869 2682007051 303
141 iso_pu_bacteria 2684622632 2685152649 303
142 iso_pu_bacteria 2695420987 2698320522 303
143 iso_pu_bacteria 2703719227 2705996565 303
144 iso_pu_bacteria 2711768156 2712470172 303
145 iso_pu_bacteria 2718218445 2721507803 303
146 iso_pu_bacteria 2738541358 2739157572 303
147 iso_pu_bacteria 2738543006 2739209664 303
148 iso_pu_bacteria 2751185917 2753855525 303
149 iso_pu_bacteria 2765235842 2765588502 303
150 iso_pu_bacteria 2775506706 2775542316 303
151 iso_pu_bacteria 2775507074 2777023786 303
152 iso_pu_bacteria 2791354903 2791925881 303
153 iso_pu_bacteria 2791355010 2792311513 303
154 iso_pu_bacteria 2791355275 2793405918 303
155 iso_pu_bacteria 2811995292 2813729439 303
156 iso_pu_bacteria 2814123068 2814696934 303
157 iso_pu_bacteria 2818991443 2819581552 303
158 iso_pu_bacteria 2821118458 2821119331 303
159 iso_pu_bacteria 2823373977 2823374287 303
160 iso_pu_bacteria 2844425489 2844427069 303
161 iso_pu_bacteria 2884086401 2884089427 303
162 iso_pu_bacteria 2888373701 2888377914 303
163 iso_pu_bacteria 2891670763 2891672647 303
164 iso_pu_bacteria 2904513164 2904518332 303
165 iso_pu_bacteria 2908669403 2908670677 303
166 iso_pu_bacteria 2919108558 2919111950 303
167 iso_pu_bacteria 2923634449 2923638958 303
168 iso_pu_bacteria 2927833300 2927834552 303
169 iso_pu_bacteria 2929233124 2929238349 303
170 iso_pu_bacteria 2935625433 2935627109 303
171 iso_pu_bacteria 2937539931 2937543253 303
172 iso_pu_bacteria 2938917290 2938922544 303
173 iso_pu_bacteria 2939568625 2939568721 303
174 iso_pu_bacteria 2939573065 2939574245 303
175 iso_pu_bacteria 2939607340 2939607925 303
176 iso_pu_bacteria 2939617950 2939619102 303
177 iso_pu_bacteria 2939642701 2939644234 303
178 iso_pu_bacteria 2945874760 2945877265 303
179 iso_pu_bacteria 2947426588 2947431431 303
180 iso_pu_bacteria 2965761152 2965765825 303
181 iso_pu_bacteria 2969079654 2969083024 303
182 iso_pu_bacteria 2971820967 2971824296 303
183 iso_pu_bacteria 2974310843 2974312578 303
184 iso_pu_bacteria 2974435778 2974437972 303
185 iso_pu_bacteria 2979083700 2979088336 303
186 iso_pu_bacteria 2984559226 2984560041 303
187 iso_pu_bacteria 2984595703 2984598121 303
188 iso_pu_bacteria 3000376612 3000379634 303
189 iso_pu_bacteria 8018221730 8018224622 303
190 iso_pu_bacteria 8018405270 8018408632 303
191 iso_pu_bacteria 8019504834 8019505986 303
192 iso_pu_bacteria 8023438354 8023443636 303
193 iso_pu_bacteria 8023444577 8023445542 303
194 iso_pu_bacteria 8054844752 8054846261 303
195 iso_pu_bacteria 8054849141 8054850447 303
196 iso_pu_bacteria 8055087960 8055088540 303
197 iso_pu_bacteria 8055092621 8055094223 303
198 iso_pu_bacteria 8055097453 8055099641 303
199 iso_pu_bacteria 2537561728 2538424370 304
200 iso_pu_bacteria 2855195626 2855198808 304
201 iso_pu_bacteria 2858466076 2858468381 304
202 iso_pu_bacteria 2871272651 2871275226 304
203 iso_pu_bacteria 2871282230 2871285183 304
204 iso_pu_bacteria 2900051742 2900052230 304
205 iso_pu_bacteria 8057304971 8057309065 304
206 3300027312 Ga0209371_1000809 Ga0209371_100080913 305
207 3300030500 Ga0268256_1002069 Ga0268256_10020695 305
208 3300005272 Ga0065703_1019352 Ga0065703_10193521 306
209 3300006946 Ga0079104_1000709 Ga0079104_100070930 306
210 3300006946 Ga0079104_1004816 Ga0079104_10048163 306
211 3300009011 Ga0105251_10000740 Ga0105251_1000074017 306
212 3300009011 Ga0105251_10000748 Ga0105251_100007487 306
213 3300009011 Ga0105251_10002213 Ga0105251_1000221313 306
214 3300009011 Ga0105251_10002549 Ga0105251_1000254910 306
215 3300009011 Ga0105251_10002676 Ga0105251_100026765 306
216 3300009036 Ga0105244_10003195 Ga0105244_100031953 306
217 3300009036 Ga0105244_10018028 Ga0105244_100180282 306
218 3300009092 Ga0105250_10000535 Ga0105250_1000053513 306
219 3300009092 Ga0105250_10004835 Ga0105250_100048353 306
220 3300009101 Ga0105247_10000012 Ga0105247_10000012157 306
221 3300009174 Ga0105241_10000001 Ga0105241_10000001172 306
222 3300013100 Ga0157373_10000779 Ga0157373_1000077918 306
223 3300014497 Ga0182008_10006475 Ga0182008_100064753 306
224 3300017792 Ga0163161_10000001 Ga0163161_100000011631 306
225 3300025711 Ga0207696_1000001 Ga0207696_10000011712 306
226 3300025711 Ga0207696_1000077 Ga0207696_100007714 306
227 3300025728 Ga0207655_1000110 Ga0207655_10001108 306
228 3300025735 Ga0207713_1000088 Ga0207713_1000088121 306
229 3300025735 Ga0207713_1000648 Ga0207713_100064831 306
230 3300025735 Ga0207713_1000753 Ga0207713_100075318 306
231 3300025735 Ga0207713_1000762 Ga0207713_100076225 306
232 3300025735 Ga0207713_1001329 Ga0207713_10013295 306
233 3300025900 Ga0207710_10000083 Ga0207710_1000008354 306
234 3300025911 Ga0207654_10000004 Ga0207654_10000004200 306
235 3300027111 Ga0209281_1000003 Ga0209281_1000003812 306
236 3300027312 Ga0209371_1001458 Ga0209371_100145816 306
237 3300030500 Ga0268256_1001317 Ga0268256_100131716 306
238 3300046453 Ga0495627_000027 Ga0495627_000027_191915_192835 306
239 3300046530 Ga0495654_0000356 Ga0495654_0000356_22739_23659 306
240 3300046794 Ga0495589_0000001 Ga0495589_0000001_250616_251536 306
241 3300048919 Ga0496116_0000001 Ga0496116_0000001_1149116_1150036 306
242 3300048920 Ga0496117_0006051 Ga0496117_0006051_6395_7315 306
243 3300048920 Ga0496117_0064649 Ga0496117_0064649_1241_2161 306
244 3300048921 Ga0496118_0017379 Ga0496118_0017379_1631_2551 306
245 3300048922 Ga0496119_0001831 Ga0496119_0001831_17946_18866 306
246 3300048922 Ga0496119_0005060 Ga0496119_0005060_5901_6821 306
247 3300048922 Ga0496119_0009516 Ga0496119_0009516_842_1765 306
248 3300048923 Ga0496120_0000641 Ga0496120_0000641_24452_25372 306
249 3300048923 Ga0496120_0000940 Ga0496120_0000940_15620_16540 306
250 3300048923 Ga0496120_0003711 Ga0496120_0003711_11555_12478 306
251 3300048927 Ga0496124_0000008 Ga0496124_0000008_480731_481651 306
252 2162886007 SwRhRL2b_contig_1083203 SwRhRL2b_0501.00003210 307
253 2162886007 SwRhRL2b_contig_2128605 SwRhRL2b_0069.00006440 307
254 3300002773 JGI25152J39213_1001623 JGI25152J39213_100162311 307
255 3300002987 JGI25159J45721_1009161 JGI25159J45721_10091612 307
256 3300002987 JGI25159J45721_1010018 JGI25159J45721_10100183 307
257 3300003187 JGI25151J46595_10000727 JGI25151J46595_100007273 307
258 3300003187 JGI25151J46595_10007592 JGI25151J46595_100075922 307
259 3300003187 JGI25151J46595_10029222 JGI25151J46595_100292223 307
260 3300003187 JGI25151J46595_10037260 JGI25151J46595_100372602 307
261 3300003320 rootH2_10001915 rootH2_1000191533 307
262 3300003856 Ga0058692_1001688 Ga0058692_10016887 307
263 3300003856 Ga0058692_1002011 Ga0058692_10020118 307
264 3300003856 Ga0058692_1002955 Ga0058692_10029555 307
265 3300003856 Ga0058692_1014543 Ga0058692_10145431 307
266 3300005289 Ga0065704_10000333 Ga0065704_1000033339 307
267 3300005289 Ga0065704_10003968 Ga0065704_100039684 307
268 3300005289 Ga0065704_10075866 Ga0065704_100758662 307
269 3300005289 Ga0065704_10081102 Ga0065704_100811022 307
270 3300005548 Ga0070665_100000262 Ga0070665_10000026264 307
271 3300005577 Ga0068857_100000082 Ga0068857_10000008242 307
272 3300006051 Ga0075364_10004261 Ga0075364_1000426111 307
273 3300006051 Ga0075364_10051357 Ga0075364_100513573 307
274 3300006051 Ga0075364_10209838 Ga0075364_102098382 307
275 3300006195 Ga0075366_10005587 Ga0075366_100055874 307
276 3300006946 Ga0079104_1000035 Ga0079104_1000035174 307
277 3300006946 Ga0079104_1000274 Ga0079104_100027468 307
278 3300006946 Ga0079104_1000343 Ga0079104_100034328 307
279 3300006946 Ga0079104_1000464 Ga0079104_100046432 307
280 3300006946 Ga0079104_1000819 Ga0079104_100081921 307
281 3300006946 Ga0079104_1001797 Ga0079104_100179710 307
282 3300006946 Ga0079104_1003555 Ga0079104_10035553 307
283 3300006946 Ga0079104_1004489 Ga0079104_10044896 307
284 3300006946 Ga0079104_1015178 Ga0079104_10151783 307
285 3300009011 Ga0105251_10002876 Ga0105251_100028767 307
286 3300009011 Ga0105251_10005182 Ga0105251_100051823 307
287 3300009011 Ga0105251_10009227 Ga0105251_100092277 307
288 3300009036 Ga0105244_10000117 Ga0105244_1000011772 307
289 3300009036 Ga0105244_10000491 Ga0105244_1000049114 307
290 3300009036 Ga0105244_10001091 Ga0105244_100010918 307
291 3300009036 Ga0105244_10004371 Ga0105244_100043714 307
292 3300009036 Ga0105244_10004602 Ga0105244_100046026 307
293 3300009036 Ga0105244_10012720 Ga0105244_100127206 307
294 3300009036 Ga0105244_10020234 Ga0105244_100202344 307
295 3300009036 Ga0105244_10032135 Ga0105244_100321353 307
296 3300009036 Ga0105244_10054055 Ga0105244_100540552 307
297 3300009036 Ga0105244_10062481 Ga0105244_100624812 307
298 3300009036 Ga0105244_10074127 Ga0105244_100741272 307
299 3300009036 Ga0105244_10098013 Ga0105244_100980132 307
300 3300009092 Ga0105250_10000917 Ga0105250_100009179 307
301 3300009092 Ga0105250_10002649 Ga0105250_100026492 307
302 3300009092 Ga0105250_10002792 Ga0105250_100027924 307
303 3300009092 Ga0105250_10003048 Ga0105250_100030487 307
304 3300009092 Ga0105250_10010641 Ga0105250_100106416 307
305 3300009092 Ga0105250_10017981 Ga0105250_100179812 307
306 3300009092 Ga0105250_10019994 Ga0105250_100199942 307
307 3300009148 Ga0105243_10355494 Ga0105243_103554942 307
308 3300011119 Ga0105246_10170217 Ga0105246_101702172 307
309 3300013100 Ga0157373_10065256 Ga0157373_100652563 307
310 3300013102 Ga0157371_10033850 Ga0157371_100338502 307
311 3300013104 Ga0157370_10003193 Ga0157370_1000319316 307
312 3300013307 Ga0157372_10003992 Ga0157372_100039923 307
313 3300015679 Ga0183366_1001 Ga0183366_1001898 307
314 3300015680 Ga0183370_1001 Ga0183370_1001898 307
315 3300015685 Ga0183369_1001 Ga0183369_1001898 307
316 3300015687 Ga0183368_1001 Ga0183368_1001898 307
317 3300021384 Ga0213876_10000086 Ga0213876_1000008673 307
318 3300025258 Ga0209129_1000018 Ga0209129_1000018265 307
319 3300025284 Ga0209130_1000969 Ga0209130_100096917 307
320 3300025284 Ga0209130_1002386 Ga0209130_100238611 307
321 3300025284 Ga0209130_1009739 Ga0209130_10097392 307
322 3300025294 Ga0209025_1000353 Ga0209025_10003533 307
323 3300025294 Ga0209025_1002464 Ga0209025_100246414 307
324 3300025294 Ga0209025_1005982 Ga0209025_10059827 307
325 3300025294 Ga0209025_1007008 Ga0209025_10070087 307
326 3300025294 Ga0209025_1007407 Ga0209025_10074073 307
327 3300025294 Ga0209025_1008112 Ga0209025_10081126 307
328 3300025294 Ga0209025_1018247 Ga0209025_10182472 307
329 3300025294 Ga0209025_1030536 Ga0209025_10305362 307
330 3300025711 Ga0207696_1000170 Ga0207696_100017021 307
331 3300025711 Ga0207696_1000482 Ga0207696_100048225 307
332 3300025711 Ga0207696_1001040 Ga0207696_100104010 307
333 3300025711 Ga0207696_1001602 Ga0207696_100160211 307
334 3300025711 Ga0207696_1008657 Ga0207696_10086573 307
335 3300025728 Ga0207655_1000001 Ga0207655_1000001892 307
336 3300025728 Ga0207655_1000009 Ga0207655_1000009155 307
337 3300025728 Ga0207655_1000046 Ga0207655_1000046268 307
338 3300025728 Ga0207655_1000506 Ga0207655_100050619 307
339 3300025728 Ga0207655_1000763 Ga0207655_100076314 307
340 3300025728 Ga0207655_1001416 Ga0207655_100141619 307
341 3300025728 Ga0207655_1013419 Ga0207655_10134192 307
342 3300025735 Ga0207713_1000004 Ga0207713_100000497 307
343 3300025735 Ga0207713_1017663 Ga0207713_10176633 307
344 3300025735 Ga0207713_1017712 Ga0207713_10177123 307
345 3300027111 Ga0209281_1000001 Ga0209281_10000011043 307
346 3300027111 Ga0209281_1000114 Ga0209281_100011464 307
347 3300027111 Ga0209281_1000180 Ga0209281_1000180121 307
348 3300027111 Ga0209281_1000229 Ga0209281_1000229100 307
349 3300027111 Ga0209281_1000267 Ga0209281_100026727 307
350 3300027111 Ga0209281_1000288 Ga0209281_100028882 307
351 3300027111 Ga0209281_1000383 Ga0209281_100038355 307
352 3300027111 Ga0209281_1000722 Ga0209281_10007228 307
353 3300027111 Ga0209281_1001917 Ga0209281_10019176 307
354 3300027111 Ga0209281_1002477 Ga0209281_10024774 307
355 3300027312 Ga0209371_1000001 Ga0209371_1000001818 307
356 3300027312 Ga0209371_1000081 Ga0209371_1000081154 307
357 3300027312 Ga0209371_1000086 Ga0209371_100008623 307
358 3300027312 Ga0209371_1000616 Ga0209371_100061628 307
359 3300027312 Ga0209371_1002095 Ga0209371_100209514 307
360 3300027312 Ga0209371_1003591 Ga0209371_10035911 307
361 3300027312 Ga0209371_1004146 Ga0209371_10041467 307
362 3300027312 Ga0209371_1009627 Ga0209371_10096274 307
363 3300027312 Ga0209371_1010630 Ga0209371_10106302 307
364 3300027312 Ga0209371_1013777 Ga0209371_10137771 307
365 3300028379 Ga0268266_10000282 Ga0268266_1000028223 307
366 3300030083 Ga0237817_10167 Ga0237817_1016715 307
367 3300030083 Ga0237817_10395 Ga0237817_103951 307
368 3300030500 Ga0268256_1000001 Ga0268256_10000011822 307
369 3300030500 Ga0268256_1000003 Ga0268256_1000003789 307
370 3300030500 Ga0268256_1000175 Ga0268256_100017529 307
371 3300030500 Ga0268256_1000920 Ga0268256_10009209 307
372 3300030500 Ga0268256_1001749 Ga0268256_10017495 307
373 3300030500 Ga0268256_1003892 Ga0268256_10038927 307
374 3300030500 Ga0268256_1008788 Ga0268256_10087884 307
375 3300030500 Ga0268256_1011424 Ga0268256_10114242 307
376 3300030500 Ga0268256_1016067 Ga0268256_10160673 307
377 3300038705 Ga0237819_00266 Ga0237819_00266_2939_3913 307
378 3300038705 Ga0237819_01016 Ga0237819_01016_183_1157 307
379 3300041405 Ga0439438_004342 Ga0439438_004342_3945_4868 307
380 3300041512 Ga0451853_1484765 Ga0451853_1484765_2332_3255 307
381 3300042006 Ga0439432_023186 Ga0439432_023186_88_1011 307
382 3300042010 Ga0439452_000008 Ga0439452_000008_251917_252840 307
383 3300042010 Ga0439452_000161 Ga0439452_000161_29996_30919 307
384 3300042010 Ga0439452_000216 Ga0439452_000216_21128_22051 307
385 3300042010 Ga0439452_002880 Ga0439452_002880_3918_4841 307
386 3300044669 Ga0466981_0000016 Ga0466981_0000016_84812_85735 307
387 3300045976 Ga0466967_0000101 Ga0466967_0000101_17946_18872 307
388 3300046458 Ga0495591_000238 Ga0495591_000238_21417_22340 307
389 3300046458 Ga0495591_002382 Ga0495591_002382_5396_6319 307
390 3300046460 Ga0495638_0002381 Ga0495638_0002381_12116_13042 307
391 3300046471 Ga0495650_0000021 Ga0495650_0000021_148197_149120 307
392 3300046471 Ga0495650_0000032 Ga0495650_0000032_258986_259909 307
393 3300046491 Ga0495584_0002351 Ga0495584_0002351_2310_3233 307
394 3300046501 Ga0495607_0007488 Ga0495607_0007488_1198_2121 307
395 3300046507 Ga0495606_0001314 Ga0495606_0001314_15841_16764 307
396 3300046513 Ga0495616_0021328 Ga0495616_0021328_1472_2395 307
397 3300046515 Ga0495620_0003066 Ga0495620_0003066_922_1848 307
398 3300046522 Ga0495643_0098228 Ga0495643_0098228_560_1483 307
399 3300046523 Ga0495644_0006862 Ga0495644_0006862_59_982 307
400 3300046524 Ga0495648_0006462 Ga0495648_0006462_130_1053 307
401 3300046530 Ga0495654_0011962 Ga0495654_0011962_3467_4390 307
402 3300046530 Ga0495654_0094073 Ga0495654_0094073_296_1219 307
403 3300046542 Ga0495597_0000537 Ga0495597_0000537_24101_25024 307
404 3300046660 Ga0495625_0008966 Ga0495625_0008966_5002_5925 307
405 3300046674 Ga0495588_0004121 Ga0495588_0004121_630_1553 307
406 3300046692 Ga0495671_0006021 Ga0495671_0006021_4133_5056 307
407 3300046694 Ga0495649_0015407 Ga0495649_0015407_2297_3223 307
408 3300046694 Ga0495649_0048499 Ga0495649_0048499_120_1046 307
409 3300046794 Ga0495589_0028080 Ga0495589_0028080_590_1513 307
410 3300046810 Ga0495660_0000021 Ga0495660_0000021_106907_107830 307
411 3300047320 Ga0495672_0000002 Ga0495672_0000002_219849_220772 307
412 3300047320 Ga0495672_0000020 Ga0495672_0000020_46480_47403 307
413 3300047323 Ga0495683_0143795 Ga0495683_0143795_177_1100 307
414 3300047446 Ga0495679_000020 Ga0495679_000020_21601_22524 307
415 3300047446 Ga0495679_009670 Ga0495679_009670_41_967 307
416 3300047446 Ga0495679_029913 Ga0495679_029913_745_1671 307
417 3300047469 Ga0495673_0000065 Ga0495673_0000065_30709_31632 307
418 3300047469 Ga0495673_0000081 Ga0495673_0000081_24289_25212 307
419 3300047470 Ga0495681_0007465 Ga0495681_0007465_3534_4466 307
420 3300048903 Ga0496100_0043881 Ga0496100_0043881_782_1705 307
421 3300048903 Ga0496100_0147435 Ga0496100_0147435_594_1517 307
422 3300048904 Ga0496101_0088123 Ga0496101_0088123_523_1446 307
423 3300048907 Ga0496104_0000893 Ga0496104_0000893_1226_2149 307
424 3300048907 Ga0496104_0295567 Ga0496104_0295567_498_1421 307
425 3300048908 Ga0496105_0026844 Ga0496105_0026844_748_1671 307
426 3300048919 Ga0496116_0000392 Ga0496116_0000392_62646_63569 307
427 3300048919 Ga0496116_0000930 Ga0496116_0000930_18634_19557 307
428 3300048919 Ga0496116_0023587 Ga0496116_0023587_3176_4099 307
429 3300048919 Ga0496116_0047741 Ga0496116_0047741_108_1031 307
430 3300048920 Ga0496117_0001414 Ga0496117_0001414_15178_16101 307
431 3300048920 Ga0496117_0002170 Ga0496117_0002170_1847_2770 307
432 3300048920 Ga0496117_0002234 Ga0496117_0002234_17550_18473 307
433 3300048920 Ga0496117_0064937 Ga0496117_0064937_261_1184 307
434 3300048920 Ga0496117_0070283 Ga0496117_0070283_950_1873 307
435 3300048920 Ga0496117_0136289 Ga0496117_0136289_71_994 307
436 3300048921 Ga0496118_0002508 Ga0496118_0002508_12090_13013 307
437 3300048921 Ga0496118_0008590 Ga0496118_0008590_7744_8667 307
438 3300048921 Ga0496118_0015079 Ga0496118_0015079_113_1036 307
439 3300048922 Ga0496119_0000008 Ga0496119_0000008_357121_358044 307
440 3300048922 Ga0496119_0000080 Ga0496119_0000080_24971_25894 307
441 3300048922 Ga0496119_0002686 Ga0496119_0002686_3099_4022 307
442 3300048922 Ga0496119_0004122 Ga0496119_0004122_7781_8704 307
443 3300048922 Ga0496119_0085864 Ga0496119_0085864_769_1692 307
444 3300048922 Ga0496119_0140351 Ga0496119_0140351_305_1228 307
445 3300048923 Ga0496120_0000075 Ga0496120_0000075_137622_138545 307
446 3300048923 Ga0496120_0000128 Ga0496120_0000128_24269_25192 307
447 3300048923 Ga0496120_0006896 Ga0496120_0006896_1757_2680 307
448 3300048923 Ga0496120_0009817 Ga0496120_0009817_2639_3562 307
449 3300048923 Ga0496120_0023153 Ga0496120_0023153_464_1387 307
450 3300048923 Ga0496120_0107419 Ga0496120_0107419_78_1001 307
451 3300048923 Ga0496120_0117770 Ga0496120_0117770_423_1346 307
452 3300048924 Ga0496121_0001134 Ga0496121_0001134_27232_28155 307
453 3300048924 Ga0496121_0002930 Ga0496121_0002930_17718_18641 307
454 3300048924 Ga0496121_0003880 Ga0496121_0003880_18656_19579 307
455 3300048924 Ga0496121_0029389 Ga0496121_0029389_223_1146 307
456 3300048924 Ga0496121_0031328 Ga0496121_0031328_640_1563 307
457 3300048924 Ga0496121_0056449 Ga0496121_0056449_519_1442 307
458 3300048924 Ga0496121_0174032 Ga0496121_0174032_560_1483 307
459 3300048924 Ga0496121_0262152 Ga0496121_0262152_224_1147 307
460 3300048925 Ga0496122_0000356 Ga0496122_0000356_25671_26594 307
461 3300048925 Ga0496122_0001535 Ga0496122_0001535_22937_23860 307
462 3300048925 Ga0496122_0004658 Ga0496122_0004658_15864_16787 307
463 3300048925 Ga0496122_0017955 Ga0496122_0017955_3390_4313 307
464 3300048925 Ga0496122_0050743 Ga0496122_0050743_910_1833 307
465 3300048925 Ga0496122_0091004 Ga0496122_0091004_840_1763 307
466 3300048926 Ga0496123_0000309 Ga0496123_0000309_21489_22412 307
467 3300048926 Ga0496123_0001080 Ga0496123_0001080_14496_15419 307
468 3300048926 Ga0496123_0002455 Ga0496123_0002455_2938_3861 307
469 3300048926 Ga0496123_0008295 Ga0496123_0008295_4434_5357 307
470 3300048926 Ga0496123_0023863 Ga0496123_0023863_3390_4313 307
471 3300048926 Ga0496123_0047822 Ga0496123_0047822_1295_2218 307
472 3300048926 Ga0496123_0085933 Ga0496123_0085933_440_1363 307
473 3300048927 Ga0496124_0000097 Ga0496124_0000097_63066_63989 307
474 3300048927 Ga0496124_0000659 Ga0496124_0000659_37367_38290 307
475 3300048927 Ga0496124_0001496 Ga0496124_0001496_13258_14181 307
476 3300048927 Ga0496124_0011293 Ga0496124_0011293_6209_7132 307
477 3300048927 Ga0496124_0083078 Ga0496124_0083078_978_1901 307
478 3300048927 Ga0496124_0174397 Ga0496124_0174397_170_1093 307
479 3300048928 Ga0496125_0000055 Ga0496125_0000055_145468_146424 307
480 3300048928 Ga0496125_0002587 Ga0496125_0002587_733_1656 307
481 3300048928 Ga0496125_0003192 Ga0496125_0003192_1482_2405 307
482 3300048928 Ga0496125_0008301 Ga0496125_0008301_8730_9653 307
483 3300048928 Ga0496125_0024948 Ga0496125_0024948_2534_3457 307
484 3300048928 Ga0496125_0053161 Ga0496125_0053161_1253_2176 307
485 3300048928 Ga0496125_0108944 Ga0496125_0108944_17_940 307
486 3300048929 Ga0496126_0001242 Ga0496126_0001242_29863_30786 307
487 3300048929 Ga0496126_0001275 Ga0496126_0001275_21072_21995 307
488 3300048929 Ga0496126_0114238 Ga0496126_0114238_166_1089 307
489 3300049459 Ga0495678_000817 Ga0495678_000817_17520_18443 307
490 3300049460 Ga0495682_0000015 Ga0495682_0000015_17658_18581 307
491 3300050491 nmdc:mga00v17_629_c1 nmdc:mga00v17_629_c1_12261_13184 307
492 3300050493 nmdc:mga0k408_5660_c1 nmdc:mga0k408_5660_c1_3122_4045 307
493 3300053126 Ga0500621_000001 Ga0500621_000001_855463_856386 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21378

YceM-like_C

YceM-like, C-terminal domain

143

263

0.98

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

20

137

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tlt-assembly1.cif.gz_B crystal structure of a putative oxidoreductase (virulence factor mvim homolog) 0.9872 4 307
3uuw-assembly1.cif.gz_D 1.63 angstrom resolution crystal structure of dehydrogenase (mvim) from clostridium difficile. 0.9815 2 303
1tlt-assembly1.cif.gz_B crystal structure of a putative oxidoreductase (virulence factor mvim homolog) 0.9808 4 307
3uuw-assembly1.cif.gz_D 1.63 angstrom resolution crystal structure of dehydrogenase (mvim) from clostridium difficile. 0.9752 2 303
1xea-assembly1.cif.gz_D crystal structure of a gfo/idh/moca family oxidoreductase from vibrio cholerae 0.8893 4 305
ID Description Score Start End Superfamily
af_P75931_1_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9995 1 120 3.40.50.720
af_P75931_1_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9912 1 120 3.40.50.720
1tltB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9906 122 307 3.30.360.10
1tltB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9801 122 307 3.30.360.10
3uuwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9793 2 120 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7G3EQ98-F1-model_v4 deleted 1.002 1 121
AF-A0A3S4CTE2-F1-model_v4 deleted 0.9991 1 120
AF-A0A2X3KC47-F1-model_v4 Putative oxidoreductase 0.9909 145 307
AF-A0A3D2B3J2-F1-model_v4 Virulence factor MviM 0.987 171 307
AF-A0A7G3EQ98-F1-model_v4 deleted 0.9858 1 121

Feature Viewer

pLDDT pTM Quality
94.51 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map