F454435

General Info

Members Datasets Scaffolds Average Seq Length
493 332 986 260

Family's Representative Sequence

Representative Sequence 3300025256|Ga0209759_1001140|Ga0209759_10011405
Length 287
Sequence MALPNLPELFAMPDFDALLPIALHGLALIALLGLGTWVASLVRHDASLVDRMWSLMIAGPALVYAAQTSWTTPRAIAVQVLVLTWGLRLAAYITWRNWGHGEDRRYQQIRARNEPHFALKSLLIVFALQMVLAWIVTAPALAALVGRRGLGALDVAGITVALAGFLFEAIGDAQMAAFKREPANRGRVMDRGLWRFTRHPNYFGEACFWWGVWLIALAAGGLGAAWTVVSPLLMTVLLLKVSGVALLEKDIGERRPAYRDYIARTNAFIPGRPRGLASPAPAPGSRR

Samples

Sample ID Description Type Environment
1 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
175 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
176 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
177 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
270 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
283 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
287 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
288 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
289 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
290 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
295 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
296 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
300 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
301 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
305 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
306 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
307 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
308 2738541277 Variovorax sp. GV051 Isolate Unclassified
309 2738541307 Variovorax sp. GV008 Isolate Unclassified
310 2738543019 Variovorax sp. GV040 Isolate Unclassified
311 2818991446 Variovorax sp. 1180 Isolate Unclassified
312 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
313 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
314 2842677519 Variovorax sp. R-72495 Isolate Unclassified
315 2842733646 Variovorax sp. R-72446 Isolate Unclassified
316 2842747753 Variovorax sp. R-72060 Isolate Unclassified
317 2885198086 Variovorax sp. 679 Isolate Unclassified
318 2885211737 Variovorax sp. 553 Isolate Unclassified
319 2899924645 Variovorax sp. 369 Isolate Unclassified
320 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
321 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
322 2928037797 Variovorax sp. 1126 Isolate Unclassified
323 2928044640 Variovorax sp. 1128 Isolate Unclassified
324 2928051484 Variovorax sp. 1133 Isolate Unclassified
325 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
326 2928070936 Variovorax gossypii 1167 Isolate Unclassified
327 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
328 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
329 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
330 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
331 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
332 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.71
Metatranscriptomes 0.41
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.17
Nodule 0.41
Rhizoplane 2.23
Rhizosphere 58.01
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209759_1001140 3300025256 Bacteria 16991
2 JGI24740J21852_10011266 3300001979 Bacteria 3409
3 JGI24739J22299_10028999 3300001989 Bacteria 1928
4 JGI25156J39149_1000250 3300002705 Bacteria 37027
5 JGI25154J39366_1000822 3300002738 Bacteria 13468
6 JGI25157J39369_1000027 3300002741 Bacteria 147448
7 JGI25152J39213_1001782 3300002773 Bacteria 8760
8 JGI25152J39213_1003930 3300002773 Bacteria 4870
9 JGI25150J39212_1000489 3300002774 Bacteria 16689
10 JGI25159J45721_1000405 3300002987 Bacteria 20050
11 JGI25159J45721_1005983 3300002987 Bacteria 3722
12 JGI25151J46595_10001020 3300003187 Bacteria 21030
13 JGI25151J46595_10017389 3300003187 Bacteria 3119
14 JGI25406J46586_10024516 3300003203 Bacteria 2361
15 JGI25153J46596_10000667 3300003215 Bacteria 21030
16 JGI25153J46596_10004269 3300003215 Bacteria 7733
17 JGI25153J46596_10013036 3300003215 Bacteria 3542
18 rootH1_10084040 3300003316 Bacteria 3430
19 rootH2_10001994 3300003320 Bacteria 2434
20 rootH2_10001995 3300003320 Bacteria 4135
21 rootH2_10038664 3300003320 Bacteria 8477
22 rootH1_10028275 3300003323 Bacteria 6357
23 rootH1_10038052 3300003323 Bacteria 7931
24 JGI25160J50197_1000610 3300003354 Bacteria 20050
25 JGI25160J50197_1004983 3300003354 Bacteria 5633
26 JGI25161J50226_1000462 3300003374 Bacteria 18715
27 JGI25161J50226_1001148 3300003374 Bacteria 8829
28 Ga0006562J51391_1187520 3300003578 Bacteria 3185
29 Ga0006562J51391_1187522 3300003578 Bacteria 1470
30 Ga0055539_1000213 3300003752 Bacteria 42508
31 Ga0055533_1000073 3300003756 Bacteria 142476
32 Ga0055535_1000338 3300003761 Bacteria 46755
33 Ga0055542_1000103 3300003762 Bacteria 114989
34 Ga0055526_1001065 3300003771 Bacteria 20050
35 Ga0055526_1003242 3300003771 Bacteria 10479
36 Ga0055526_1021208 3300003771 Bacteria 2270
37 Ga0055537_1000558 3300003773 Bacteria 21027
38 Ga0055537_1001751 3300003773 Bacteria 7982
39 Ga0055524_1000454 3300003775 Bacteria 33792
40 Ga0055524_1000847 3300003775 Bacteria 20050
41 Ga0055524_1001073 3300003775 Bacteria 16793
42 Ga0055536_1002194 3300003781 Bacteria 11122
43 Ga0055536_1033357 3300003781 Bacteria 1317
44 Ga0055534_1000524 3300003784 Bacteria 20674
45 Ga0055528_1000834 3300003790 Bacteria 21027
46 Ga0055528_1007360 3300003790 Bacteria 4872
47 Ga0055530_10000342 3300003791 Bacteria 42139
48 Ga0055540_1001923 3300003792 Bacteria 11609
49 Ga0055540_1013330 3300003792 Bacteria 2519
50 Ga0055531_10002005 3300003794 Bacteria 14137
51 Ga0055531_10002643 3300003794 Bacteria 11837
52 Ga0055531_10025658 3300003794 Bacteria 2132
53 Ga0055543_1000420 3300004625 Bacteria 26756
54 Ga0055543_1000674 3300004625 Bacteria 17821
55 Ga0065165_1000727 3300005262 Bacteria 46035
56 Ga0065165_1001375 3300005262 Bacteria 26747
57 Ga0065165_1003647 3300005262 Bacteria 10519
58 Ga0070658_10009746 3300005327 Bacteria 7714
59 Ga0070658_10019306 3300005327 Bacteria 5459
60 Ga0070658_10122956 3300005327 Bacteria 2158
61 Ga0070658_10407827 3300005327 Bacteria 1168
62 Ga0070676_10002168 3300005328 Bacteria 10013
63 Ga0070683_100197544 3300005329 Bacteria 1910
64 Ga0070690_100165934 3300005330 Bacteria 1517
65 Ga0070670_100101334 3300005331 Bacteria 2479
66 Ga0070670_100293365 3300005331 Bacteria 1421
67 Ga0070677_10002636 3300005333 Bacteria 5738
68 Ga0068869_100039148 3300005334 Bacteria 3383
69 Ga0070660_100034574 3300005339 Bacteria 3819
70 Ga0070660_100196629 3300005339 Bacteria 1635
71 Ga0070669_100062853 3300005353 Bacteria 2731
72 Ga0070669_100327288 3300005353 Bacteria 1239
73 Ga0070675_100048834 3300005354 Bacteria 3471
74 Ga0070675_100107370 3300005354 Bacteria 2357
75 Ga0070671_100039946 3300005355 Bacteria 3895
76 Ga0070671_100190626 3300005355 Bacteria 1737
77 Ga0070674_100021368 3300005356 Bacteria 4153
78 Ga0070674_100031753 3300005356 Bacteria 3502
79 Ga0070674_100445044 3300005356 Bacteria 1068
80 Ga0070673_100014147 3300005364 Bacteria 5545
81 Ga0070673_100057112 3300005364 Bacteria 3083
82 Ga0070673_100058750 3300005364 Bacteria 3042
83 Ga0070673_100063496 3300005364 Bacteria 2939
84 Ga0070673_100436403 3300005364 Bacteria 1176
85 Ga0070688_100209736 3300005365 Bacteria 1367
86 Ga0070688_100216897 3300005365 Unclassified 1346
87 Ga0070667_100030174 3300005367 Bacteria 4521
88 Ga0070667_100063789 3300005367 Bacteria 3124
89 Ga0070701_10125537 3300005438 Bacteria 1452
90 Ga0070663_100010056 3300005455 Bacteria 5883
91 Ga0070678_100059442 3300005456 Bacteria 2809
92 Ga0070678_100125427 3300005456 Bacteria 2032
93 Ga0070678_100339855 3300005456 Bacteria 1287
94 Ga0070662_100063142 3300005457 Bacteria 2708
95 Ga0070662_100136498 3300005457 Bacteria 1897
96 Ga0068867_100282914 3300005459 Bacteria 1360
97 Ga0070685_10143304 3300005466 Unclassified 1507
98 Ga0068853_100011269 3300005539 Bacteria 7256
99 Ga0070672_100006556 3300005543 Bacteria 7831
100 Ga0070672_100056419 3300005543 Bacteria 3080
101 Ga0070672_100066157 3300005543 Bacteria 2861
102 Ga0070665_100048395 3300005548 Bacteria 4269
103 Ga0068855_100012007 3300005563 Bacteria 10473
104 Ga0068855_100062920 3300005563 Bacteria 4331
105 Ga0068855_100162338 3300005563 Bacteria 2535
106 Ga0070664_100047846 3300005564 Bacteria 3614
107 Ga0070664_100098539 3300005564 Bacteria 2539
108 Ga0068857_100000496 3300005577 Bacteria 28278
109 Ga0068854_100001904 3300005578 Bacteria 12709
110 Ga0068856_100013896 3300005614 Bacteria 7787
111 Ga0070702_100143369 3300005615 Unclassified 1524
112 Ga0068852_100095558 3300005616 Bacteria 2669
113 Ga0068852_100254537 3300005616 Bacteria 1683
114 Ga0068864_100316068 3300005618 Bacteria 1465
115 Ga0068861_100084371 3300005719 Bacteria 2494
116 Ga0068870_10183822 3300005840 Bacteria 1257
117 Ga0068863_100283419 3300005841 Bacteria 1606
118 Ga0068858_100024019 3300005842 Bacteria 5680
119 Ga0068860_100017865 3300005843 Bacteria 6907
120 Ga0068862_100008022 3300005844 Bacteria 8738
121 Ga0081539_10003186 3300005985 Bacteria 20762
122 Ga0075364_10008608 3300006051 Bacteria 6102
123 Ga0075366_10008924 3300006195 Bacteria 5588
124 Ga0097621_100145011 3300006237 Bacteria 2032
125 Ga0075370_10001046 3300006353 Bacteria 11505
126 Ga0075370_10091311 3300006353 Bacteria 1757
127 Ga0068871_100183307 3300006358 Bacteria 1800
128 Ga0075430_100021253 3300006846 Bacteria 5518
129 Ga0075429_100048946 3300006880 Bacteria 3675
130 Ga0105244_10085212 3300009036 Bacteria 1559
131 Ga0105240_10080524 3300009093 Bacteria 4005
132 Ga0105240_10147254 3300009093 Bacteria 2808
133 Ga0105240_10302339 3300009093 Bacteria 1830
134 Ga0111539_10442492 3300009094 Bacteria 1513
135 Ga0111539_10847105 3300009094 Bacteria 1064
136 Ga0105245_10133495 3300009098 Bacteria 2330
137 Ga0105241_10155862 3300009174 Bacteria 1873
138 Ga0105242_10007627 3300009176 Bacteria 8327
139 Ga0105248_10174487 3300009177 Bacteria 2423
140 Ga0105237_10051539 3300009545 Bacteria 4134
141 Ga0105238_10058996 3300009551 Bacteria 3845
142 Ga0105238_10725233 3300009551 Bacteria 1007
143 Ga0105239_10148120 3300010375 Bacteria 2619
144 Ga0105246_10117303 3300011119 Bacteria 1966
145 Ga0157319_1000006 3300012497 Bacteria 361506
146 Ga0157370_10004322 3300013104 Bacteria 16333
147 Ga0157369_10058014 3300013105 Bacteria 4176
148 Ga0157378_10624954 3300013297 Bacteria 1090
149 Ga0163162_10028639 3300013306 Bacteria 5513
150 Ga0163162_10174960 3300013306 Bacteria 2272
151 Ga0163162_10529534 3300013306 Bacteria 1307
152 Ga0157375_10050672 3300013308 Bacteria 4073
153 Ga0157375_10056482 3300013308 Bacteria 3875
154 Ga0157375_10668361 3300013308 Bacteria 1194
155 Ga0163163_10276978 3300014325 Bacteria 1729
156 Ga0182008_10000400 3300014497 Bacteria 33653
157 Ga0182008_10005123 3300014497 Bacteria 7523
158 Ga0157377_10011592 3300014745 Bacteria 4407
159 Ga0157379_10110992 3300014968 Bacteria 2463
160 Ga0182006_1083814 3300015261 Bacteria 1159
161 Ga0182007_10002167 3300015262 Bacteria 9970
162 Ga0163161_10008137 3300017792 Bacteria 7252
163 Ga0163161_10088345 3300017792 Bacteria 2291
164 Ga0163161_10211315 3300017792 Bacteria 1499
165 Ga0213876_10018611 3300021384 Bacteria 3668
166 Ga0209436_101114 3300025208 Bacteria 9960
167 Ga0209436_102111 3300025208 Bacteria 6233
168 Ga0209674_100039 3300025226 Bacteria 402292
169 Ga0209672_101942 3300025228 Bacteria 5849
170 Ga0209147_100483 3300025229 Bacteria 23927
171 Ga0209563_100110 3300025230 Bacteria 142518
172 Ga0207427_100388 3300025231 Bacteria 26461
173 Ga0209258_100133 3300025242 Bacteria 174846
174 Ga0209258_100567 3300025242 Bacteria 31694
175 Ga0207425_1000260 3300025245 Bacteria 39085
176 Ga0207425_1000282 3300025245 Bacteria 37515
177 Ga0207425_1001985 3300025245 Bacteria 7650
178 Ga0209646_1000231 3300025246 Bacteria 59119
179 Ga0209026_1000011 3300025250 Bacteria 507291
180 Ga0209677_100123 3300025253 Bacteria 80295
181 Ga0209677_100287 3300025253 Bacteria 33491
182 Ga0209677_104139 3300025253 Bacteria 4335
183 Ga0209148_1000188 3300025254 Bacteria 117310
184 Ga0209759_1000107 3300025256 Bacteria 147025
185 Ga0209129_1000012 3300025258 Bacteria 541516
186 Ga0209129_1000425 3300025258 Bacteria 32039
187 Ga0209129_1000436 3300025258 Bacteria 31077
188 Ga0209565_1000165 3300025263 Bacteria 86871
189 Ga0209565_1000820 3300025263 Bacteria 17662
190 Ga0209673_1000454 3300025273 Bacteria 69331
191 Ga0209673_1001101 3300025273 Bacteria 30262
192 Ga0209673_1011107 3300025273 Bacteria 3738
193 Ga0209673_1011231 3300025273 Bacteria 3706
194 Ga0209130_1000427 3300025284 Bacteria 45224
195 Ga0209130_1000924 3300025284 Bacteria 23585
196 Ga0209675_1000321 3300025291 Bacteria 43024
197 Ga0209675_1001260 3300025291 Bacteria 15176
198 Ga0209675_1002144 3300025291 Bacteria 10409
199 Ga0209676_1000111 3300025292 Bacteria 213411
200 Ga0209676_1001670 3300025292 Bacteria 19271
201 Ga0209676_1030213 3300025292 Bacteria 1660
202 Ga0209025_1000686 3300025294 Bacteria 58086
203 Ga0209025_1001318 3300025294 Bacteria 33769
204 Ga0209025_1010672 3300025294 Bacteria 6187
205 Ga0209025_1026829 3300025294 Bacteria 2876
206 Ga0209564_1000022 3300025295 Bacteria 555109
207 Ga0209564_1000070 3300025295 Bacteria 303126
208 Ga0209564_1000352 3300025295 Bacteria 85941
209 Ga0209758_1000198 3300025297 Bacteria 133584
210 Ga0209758_1000297 3300025297 Bacteria 97664
211 Ga0209758_1003512 3300025297 Bacteria 14157
212 Ga0209050_1000111 3300025298 Bacteria 213411
213 Ga0209256_1000047 3300025299 Bacteria 314709
214 Ga0209256_1000238 3300025299 Bacteria 97664
215 Ga0209256_1001030 3300025299 Bacteria 32745
216 Ga0207426_1000194 3300025302 Bacteria 150009
217 Ga0207426_1000294 3300025302 Bacteria 98700
218 Ga0209051_1000340 3300025303 Bacteria 70080
219 Ga0209051_1012012 3300025303 Bacteria 4226
220 Ga0209257_1000690 3300025304 Bacteria 52373
221 Ga0209257_1001321 3300025304 Bacteria 30158
222 Ga0209257_1001472 3300025304 Bacteria 27715
223 Ga0207697_10011631 3300025315 Bacteria 3716
224 Ga0207656_10007230 3300025321 Bacteria 4032
225 Ga0207682_10005031 3300025893 Bacteria 5419
226 Ga0207682_10024121 3300025893 Bacteria 2407
227 Ga0207688_10012812 3300025901 Bacteria 4559
228 Ga0207645_10001804 3300025907 Bacteria 17289
229 Ga0207705_10090331 3300025909 Bacteria 2242
230 Ga0207705_10217374 3300025909 Bacteria 1451
231 Ga0207654_10105101 3300025911 Bacteria 1746
232 Ga0207695_10021906 3300025913 Bacteria 7274
233 Ga0207695_10105599 3300025913 Bacteria 2803
234 Ga0207695_10233343 3300025913 Bacteria 1743
235 Ga0207671_10278100 3300025914 Bacteria 1320
236 Ga0207657_10011824 3300025919 Bacteria 8641
237 Ga0207657_10209456 3300025919 Bacteria 1565
238 Ga0207681_10077086 3300025923 Bacteria 2342
239 Ga0207681_10218224 3300025923 Bacteria 1474
240 Ga0207694_10038070 3300025924 Bacteria 3697
241 Ga0207650_10005595 3300025925 Bacteria 8585
242 Ga0207650_10157511 3300025925 Bacteria 1797
243 Ga0207659_10078880 3300025926 Bacteria 2427
244 Ga0207659_10126095 3300025926 Bacteria 1969
245 Ga0207644_10123995 3300025931 Bacteria 1970
246 Ga0207644_10401475 3300025931 Bacteria 1120
247 Ga0207706_10067774 3300025933 Bacteria 3141
248 Ga0207706_10080743 3300025933 Bacteria 2859
249 Ga0207706_10111615 3300025933 Bacteria 2405
250 Ga0207706_10176295 3300025933 Bacteria 1878
251 Ga0207686_10001268 3300025934 Bacteria 14522
252 Ga0207686_10206254 3300025934 Bacteria 1410
253 Ga0207670_10338474 3300025936 Bacteria 1188
254 Ga0207669_10069638 3300025937 Bacteria 2202
255 Ga0207669_10254891 3300025937 Bacteria 1309
256 Ga0207691_10007218 3300025940 Bacteria 10717
257 Ga0207691_10010611 3300025940 Bacteria 8838
258 Ga0207691_10107584 3300025940 Bacteria 2482
259 Ga0207689_10014750 3300025942 Bacteria 6635
260 Ga0207661_10145681 3300025944 Bacteria 2043
261 Ga0207679_10115166 3300025945 Bacteria 2129
262 Ga0207679_10200584 3300025945 Bacteria 1666
263 Ga0207667_10014499 3300025949 Bacteria 8983
264 Ga0207651_10060165 3300025960 Bacteria 2635
265 Ga0207640_10010683 3300025981 Bacteria 5179
266 Ga0207658_10244132 3300025986 Bacteria 1523
267 Ga0207658_10426312 3300025986 Bacteria 1171
268 Ga0207677_10115355 3300026023 Bacteria 2009
269 Ga0207703_10035895 3300026035 Bacteria 3942
270 Ga0207639_10008330 3300026041 Bacteria 7105
271 Ga0207639_10206998 3300026041 Bacteria 1686
272 Ga0207678_10006442 3300026067 Bacteria 10413
273 Ga0207678_10334383 3300026067 Bacteria 1304
274 Ga0207702_10000270 3300026078 Bacteria 59607
275 Ga0207648_10007828 3300026089 Bacteria 10431
276 Ga0207648_10070575 3300026089 Bacteria 3045
277 Ga0207648_10203906 3300026089 Bacteria 1755
278 Ga0207676_10100829 3300026095 Bacteria 2393
279 Ga0207674_10003612 3300026116 Bacteria 18862
280 Ga0207675_100013307 3300026118 Bacteria 7680
281 Ga0207675_100045092 3300026118 Bacteria 4120
282 Ga0207675_100133237 3300026118 Unclassified 2357
283 Ga0207683_10011446 3300026121 Bacteria 7571
284 Ga0207683_10017558 3300026121 Bacteria 6100
285 Ga0207683_10040285 3300026121 Bacteria 4075
286 Ga0207683_10067781 3300026121 Bacteria 3149
287 Ga0207698_10419850 3300026142 Bacteria 1283
288 Ga0209282_1217279 3300027666 Bacteria 868
289 Ga0265334_10042817 3300028573 Bacteria 1764
290 Ga0265336_10000022 3300028666 Bacteria 192716
291 Ga0307515_10021161 3300028794 Bacteria 11549
292 Ga0265324_10005667 3300029957 Bacteria 5336
293 Ga0316177_1131487 3300030731 Bacteria 2440
294 Ga0316178_1107021 3300030735 Bacteria 10593
295 Ga0316183_1091282 3300030742 Bacteria 20839
296 Ga0316181_1090846 3300030744 Bacteria 5072
297 Ga0265330_10019835 3300031235 Bacteria 3074
298 Ga0265327_10000327 3300031251 Bacteria 90721
299 Ga0307509_10205357 3300031507 Bacteria 1801
300 Ga0316575_10123220 3300031665 Bacteria 1061
301 Ga0316579_10068157 3300031691 Bacteria 1682
302 Ga0316578_10125863 3300031728 Unclassified 1541
303 Ga0307516_10025219 3300031730 Bacteria 6056
304 Ga0307405_10691042 3300031731 Bacteria 844
305 Ga0307412_10003587 3300031911 Bacteria 8620
306 Ga0307416_100011500 3300032002 Bacteria 5908
307 Ga0307411_10366764 3300032005 Bacteria 1180
308 Ga0373931_0010782 3300035691 Bacteria 4400
309 Ga0373937_0067294 3300036401 Bacteria 3300
310 Ga0373937_0179714 3300036401 Unclassified 1987
311 Ga0373925_0247764 3300037068 Bacteria 1428
312 Ga0395898_0069276 3300037466 Bacteria 3413
313 Ga0395905_0096937 3300037471 Bacteria 2769
314 Ga0395905_0665512 3300037471 Bacteria 943
315 Ga0436365_1480692 3300039437 Bacteria 10773
316 Ga0451853_2804152 3300041512 Bacteria 1294
317 Ga0439445_0002631 3300042004 Bacteria 3997
318 Ga0439455_0005516 3300042012 Bacteria 2575
319 Ga0450911_000185 3300042115 Bacteria 24854
320 Ga0451577_0095219 3300042876 Bacteria 2658
321 Ga0466963_0035097 3300044694 Bacteria 3266
322 Ga0466963_0179685 3300044694 Bacteria 1477
323 Ga0453684_0101220 3300044712 Bacteria 3525
324 Ga0453684_0593910 3300044712 Bacteria 1214
325 Ga0466957_0020924 3300044842 Bacteria 3850
326 Ga0451576_0104504 3300045051 Bacteria 2946
327 Ga0466967_0021387 3300045976 Bacteria 5253
328 Ga0495629_0113153 3300046459 Bacteria 1892
329 Ga0495651_0134467 3300046462 Bacteria 1801
330 Ga0495651_0235537 3300046462 Bacteria 1258
331 Ga0495650_0001042 3300046471 Bacteria 30968
332 Ga0495650_0004944 3300046471 Bacteria 8892
333 Ga0495639_0011236 3300046475 Bacteria 3858
334 Ga0495583_0000164 3300046506 Bacteria 112062
335 Ga0495606_0001489 3300046507 Bacteria 31133
336 Ga0495608_0156646 3300046511 Bacteria 1450
337 Ga0495610_0048904 3300046512 Bacteria 2073
338 Ga0495610_0085071 3300046512 Bacteria 1444
339 Ga0495616_0000350 3300046513 Bacteria 36334
340 Ga0495620_0010958 3300046515 Bacteria 4755
341 Ga0495620_0123504 3300046515 Bacteria 1019
342 Ga0495628_0251874 3300046516 Bacteria 1318
343 Ga0495630_0000714 3300046517 Bacteria 23478
344 Ga0495631_0000182 3300046518 Bacteria 42891
345 Ga0495637_0005214 3300046520 Bacteria 6658
346 Ga0495637_0049029 3300046520 Bacteria 1776
347 Ga0495652_0048602 3300046529 Bacteria 3634
348 Ga0495621_0015140 3300046539 Bacteria 2455
349 Ga0495656_0005544 3300046615 Bacteria 4360
350 Ga0495625_0026207 3300046660 Bacteria 4408
351 Ga0495625_0033000 3300046660 Bacteria 3833
352 Ga0495625_0037321 3300046660 Bacteria 3566
353 Ga0495635_0067847 3300046663 Bacteria 2446
354 Ga0495661_0097486 3300046665 Bacteria 1661
355 Ga0495588_0003415 3300046674 Bacteria 6905
356 Ga0495657_0030285 3300046675 Bacteria 3792
357 Ga0495670_0305038 3300046691 Bacteria 853
358 Ga0495671_0011682 3300046692 Bacteria 4817
359 Ga0495649_0001452 3300046694 Bacteria 17830
360 Ga0495589_0024524 3300046794 Bacteria 3066
361 Ga0495600_0049428 3300046809 Bacteria 2744
362 Ga0495581_0297656 3300047315 Bacteria 943
363 Ga0495604_0030421 3300047317 Bacteria 4288
364 Ga0495676_0347900 3300047321 Bacteria 991
365 Ga0495686_0023741 3300047472 Bacteria 4038
366 Ga0495614_0031447 3300048089 Bacteria 2284
367 Ga0496103_0306873 3300048906 Bacteria 1021
368 Ga0496108_0025314 3300048911 Bacteria 4890
369 Ga0496109_0160511 3300048912 Bacteria 2106
370 Ga0496110_0100793 3300048913 Bacteria 2588
371 Ga0496110_0328938 3300048913 Bacteria 1392
372 Ga0496113_0013520 3300048916 Bacteria 5535
373 Ga0496114_0018095 3300048917 Bacteria 5694
374 Ga0496114_0065814 3300048917 Bacteria 3037
375 Ga0496117_0015763 3300048920 Bacteria 6417
376 Ga0496117_0253971 3300048920 Bacteria 957
377 Ga0496118_0044115 3300048921 Bacteria 3495
378 Ga0496119_0032738 3300048922 Bacteria 3460
379 Ga0496121_0002770 3300048924 Bacteria 26007
380 Ga0496121_0003970 3300048924 Bacteria 20411
381 Ga0496121_0006784 3300048924 Bacteria 14029
382 Ga0496121_0103534 3300048924 Bacteria 2189
383 Ga0496121_0157683 3300048924 Bacteria 1663
384 Ga0496122_0000034 3300048925 Bacteria 320661
385 Ga0496122_0056202 3300048925 Bacteria 2936
386 Ga0496122_0176058 3300048925 Bacteria 1282
387 Ga0496122_0248869 3300048925 Bacteria 996
388 Ga0496123_0000069 3300048926 Bacteria 201579
389 Ga0496123_0012813 3300048926 Bacteria 7108
390 Ga0496123_0066207 3300048926 Bacteria 2290
391 Ga0496124_0002098 3300048927 Bacteria 26914
392 Ga0496124_0039338 3300048927 Bacteria 4100
393 Ga0496124_0109204 3300048927 Bacteria 2230
394 Ga0496124_0172180 3300048927 Bacteria 1675
395 Ga0496125_0005512 3300048928 Bacteria 14021
396 Ga0496125_0024648 3300048928 Bacteria 5526
397 Ga0496125_0028303 3300048928 Bacteria 5065
398 Ga0496125_0080178 3300048928 Bacteria 2499
399 Ga0496125_0131428 3300048928 Bacteria 1761
400 Ga0496125_0305786 3300048928 Bacteria 971
401 Ga0496126_0055580 3300048929 Bacteria 3581
402 Ga0501032_0178871 3300049569 Bacteria 1389
403 Ga0501033_0089603 3300049570 Bacteria 2250
404 Ga0501034_0000224 3300049571 Bacteria 107481
405 Ga0501039_0087218 3300049575 Bacteria 2431
406 Ga0501041_0029940 3300049577 Bacteria 3285
407 Ga0501042_0041450 3300049578 Bacteria 3274
408 Ga0501046_0186616 3300049580 Bacteria 1548
409 Ga0501047_0007163 3300049581 Bacteria 10480
410 Ga0501048_0011300 3300049582 Bacteria 6657
411 Ga0501067_0110412 3300049583 Bacteria 1529
412 Ga0501068_0004405 3300049584 Bacteria 7658
413 Ga0501068_0126029 3300049584 Bacteria 1599
414 Ga0501070_0420078 3300049586 Bacteria 1080
415 Ga0501072_0002629 3300049588 Bacteria 13467
416 Ga0501072_0069187 3300049588 Bacteria 2787
417 Ga0501073_0004182 3300049589 Bacteria 10828
418 Ga0501074_0017231 3300049590 Bacteria 5242
419 Ga0501074_0083986 3300049590 Bacteria 2283
420 Ga0501075_0247688 3300049591 Bacteria 1358
421 Ga0501077_0119224 3300049593 Bacteria 1672
422 Ga0501249_001690 3300049679 Bacteria 4501
423 Ga0501225_0001600 3300049705 Bacteria 7080
424 Ga0501080_0003598 3300049742 Bacteria 13645
425 Ga0501080_0107340 3300049742 Bacteria 2588
426 Ga0501083_0021092 3300049744 Bacteria 4528
427 Ga0501262_000243 3300049759 Bacteria 6726
428 Ga0501035_0351930 3300049822 Bacteria 1232
429 Ga0501044_0101201 3300049823 Bacteria 2899
430 Ga0501045_0022744 3300049824 Bacteria 4490
431 nmdc:mga00v17_6785_c2 3300050491 Bacteria 2840
432 nmdc:mga0k408_3538_c1 3300050493 Bacteria 8251
433 nmdc:mga07m45_10440_c1 3300050496 Bacteria 4851
434 nmdc:mga07m45_1090_c1 3300050496 Bacteria 12102
435 nmdc:mga0qj67_123767_c1 3300050509 Bacteria 2092
436 Ga0495601_0006750 3300053077 Bacteria 6721
437 Ga0500610_0000424 3300053079 Bacteria 13016
438 Ga0500610_0000721 3300053079 Bacteria 10319
439 Ga0500635_0000237 3300053080 Bacteria 24396
440 Ga0500635_0006347 3300053080 Bacteria 3154
441 Ga0495619_0004392 3300053085 Bacteria 8994
442 Ga0495619_0016762 3300053085 Bacteria 4639
443 Ga0500643_009531 3300053087 Bacteria 3701
444 Ga0500643_062510 3300053087 Bacteria 1043
445 Ga0500644_0019949 3300053088 Bacteria 1986
446 Ga0500593_002973 3300053117 Bacteria 6311
447 Ga0500594_0000469 3300053118 Bacteria 8865
448 Ga0500607_114868 3300053121 Bacteria 1313
449 Ga0500655_000096 3300053133 Bacteria 23067
450 Ga0500658_0001231 3300053134 Bacteria 10410
451 Ga0500559_0004378 3300053136 Bacteria 6723
452 Ga0500559_0060760 3300053136 Bacteria 1684
453 Ga0500564_065359 3300053138 Bacteria 1646
454 Ga0500568_0000111 3300053139 Bacteria 75413
455 Ga0500573_0014690 3300053140 Bacteria 4433
456 Ga0500590_010171 3300053148 Bacteria 4745
457 Ga0500616_0069065 3300053153 Bacteria 1807
458 Ga0500622_0004724 3300053156 Bacteria 8418
459 Ga0500627_0001793 3300053158 Bacteria 6105
460 Ga0500634_0028374 3300053161 Bacteria 3049
461 Ga0500634_0030027 3300053161 Bacteria 2962
462 Ga0500638_033270 3300053162 Bacteria 2492
463 Ga0501084_0303825 3300054114 Bacteria 1348
464 Ga0501082_0074400 3300060353 Bacteria 2926
465 2599625296 2599185214 Bacteria 8209958
466 2599673252 2599185226 Bacteria 8233575
467 2599682922 2599185227 Bacteria 8246414
468 2599694860 2599185229 Bacteria 8216126
469 2738723314 2738541277 Bacteria 7458140
470 2738882949 2738541307 Bacteria 8606193
471 2739284045 2738543019 Bacteria 7459457
472 2819602186 2818991446 Bacteria 7757362
473 2831267469 2831265667 Bacteria 7184833
474 2838060422 2838054893 Bacteria 7451788
475 2842679252 2842677519 Bacteria 5615038
476 2842735116 2842733646 Bacteria 5716726
477 2842751115 2842747753 Bacteria 5578255
478 2885198238 2885198086 Bacteria 7212419
479 2885212382 2885211737 Bacteria 7212420
480 2899928748 2899924645 Bacteria 7487985
481 2904550001 2904541872 Bacteria 8915136
482 2919466183 2919462493 Bacteria 5817112
483 2928043315 2928037797 Bacteria 7273642
484 2928050757 2928044640 Bacteria 7271509
485 2928058751 2928051484 Bacteria 7773759
486 2928066176 2928064002 Bacteria 7419480
487 2928077793 2928070936 Bacteria 8062541
488 2928088099 2928084124 Bacteria 7159212
489 2928118634 2928115317 Bacteria 6477646
490 2929164887 2929160207 Bacteria 9075316
491 2945910504 2945909444 Bacteria 7065066
492 2945987440 2945984333 Bacteria 7358892
493 2974321052 2974320154 Bacteria 4571377
494 Ga0209759_1001140
495 JGI24740J21852_10011266
496 JGI24739J22299_10028999
497 JGI25156J39149_1000250
498 JGI25154J39366_1000822
499 JGI25157J39369_1000027
500 JGI25152J39213_1001782
501 JGI25152J39213_1003930
502 JGI25150J39212_1000489
503 JGI25159J45721_1000405
504 JGI25159J45721_1005983
505 JGI25151J46595_10001020
506 JGI25151J46595_10017389
507 JGI25406J46586_10024516
508 JGI25153J46596_10000667
509 JGI25153J46596_10004269
510 JGI25153J46596_10013036
511 rootH1_10084040
512 rootH2_10001994
513 rootH2_10001995
514 rootH2_10038664
515 rootH1_10028275
516 rootH1_10038052
517 JGI25160J50197_1000610
518 JGI25160J50197_1004983
519 JGI25161J50226_1000462
520 JGI25161J50226_1001148
521 Ga0006562J51391_1187520
522 Ga0006562J51391_1187522
523 Ga0055539_1000213
524 Ga0055533_1000073
525 Ga0055535_1000338
526 Ga0055542_1000103
527 Ga0055526_1001065
528 Ga0055526_1003242
529 Ga0055526_1021208
530 Ga0055537_1000558
531 Ga0055537_1001751
532 Ga0055524_1000454
533 Ga0055524_1000847
534 Ga0055524_1001073
535 Ga0055536_1002194
536 Ga0055536_1033357
537 Ga0055534_1000524
538 Ga0055528_1000834
539 Ga0055528_1007360
540 Ga0055530_10000342
541 Ga0055540_1001923
542 Ga0055540_1013330
543 Ga0055531_10002005
544 Ga0055531_10002643
545 Ga0055531_10025658
546 Ga0055543_1000420
547 Ga0055543_1000674
548 Ga0065165_1000727
549 Ga0065165_1001375
550 Ga0065165_1003647
551 Ga0070658_10009746
552 Ga0070658_10019306
553 Ga0070658_10122956
554 Ga0070658_10407827
555 Ga0070676_10002168
556 Ga0070683_100197544
557 Ga0070690_100165934
558 Ga0070670_100101334
559 Ga0070670_100293365
560 Ga0070677_10002636
561 Ga0068869_100039148
562 Ga0070660_100034574
563 Ga0070660_100196629
564 Ga0070669_100062853
565 Ga0070669_100327288
566 Ga0070675_100048834
567 Ga0070675_100107370
568 Ga0070671_100039946
569 Ga0070671_100190626
570 Ga0070674_100021368
571 Ga0070674_100031753
572 Ga0070674_100445044
573 Ga0070673_100014147
574 Ga0070673_100057112
575 Ga0070673_100058750
576 Ga0070673_100063496
577 Ga0070673_100436403
578 Ga0070688_100209736
579 Ga0070688_100216897
580 Ga0070667_100030174
581 Ga0070667_100063789
582 Ga0070701_10125537
583 Ga0070663_100010056
584 Ga0070678_100059442
585 Ga0070678_100125427
586 Ga0070678_100339855
587 Ga0070662_100063142
588 Ga0070662_100136498
589 Ga0068867_100282914
590 Ga0070685_10143304
591 Ga0068853_100011269
592 Ga0070672_100006556
593 Ga0070672_100056419
594 Ga0070672_100066157
595 Ga0070665_100048395
596 Ga0068855_100012007
597 Ga0068855_100062920
598 Ga0068855_100162338
599 Ga0070664_100047846
600 Ga0070664_100098539
601 Ga0068857_100000496
602 Ga0068854_100001904
603 Ga0068856_100013896
604 Ga0070702_100143369
605 Ga0068852_100095558
606 Ga0068852_100254537
607 Ga0068864_100316068
608 Ga0068861_100084371
609 Ga0068870_10183822
610 Ga0068863_100283419
611 Ga0068858_100024019
612 Ga0068860_100017865
613 Ga0068862_100008022
614 Ga0081539_10003186
615 Ga0075364_10008608
616 Ga0075366_10008924
617 Ga0097621_100145011
618 Ga0075370_10001046
619 Ga0075370_10091311
620 Ga0068871_100183307
621 Ga0075430_100021253
622 Ga0075429_100048946
623 Ga0105244_10085212
624 Ga0105240_10080524
625 Ga0105240_10147254
626 Ga0105240_10302339
627 Ga0111539_10442492
628 Ga0111539_10847105
629 Ga0105245_10133495
630 Ga0105241_10155862
631 Ga0105242_10007627
632 Ga0105248_10174487
633 Ga0105237_10051539
634 Ga0105238_10058996
635 Ga0105238_10725233
636 Ga0105239_10148120
637 Ga0105246_10117303
638 Ga0157319_1000006
639 Ga0157370_10004322
640 Ga0157369_10058014
641 Ga0157378_10624954
642 Ga0163162_10028639
643 Ga0163162_10174960
644 Ga0163162_10529534
645 Ga0157375_10050672
646 Ga0157375_10056482
647 Ga0157375_10668361
648 Ga0163163_10276978
649 Ga0182008_10000400
650 Ga0182008_10005123
651 Ga0157377_10011592
652 Ga0157379_10110992
653 Ga0182006_1083814
654 Ga0182007_10002167
655 Ga0163161_10008137
656 Ga0163161_10088345
657 Ga0163161_10211315
658 Ga0213876_10018611
659 Ga0209436_101114
660 Ga0209436_102111
661 Ga0209674_100039
662 Ga0209672_101942
663 Ga0209147_100483
664 Ga0209563_100110
665 Ga0207427_100388
666 Ga0209258_100133
667 Ga0209258_100567
668 Ga0207425_1000260
669 Ga0207425_1000282
670 Ga0207425_1001985
671 Ga0209646_1000231
672 Ga0209026_1000011
673 Ga0209677_100123
674 Ga0209677_100287
675 Ga0209677_104139
676 Ga0209148_1000188
677 Ga0209759_1000107
678 Ga0209129_1000012
679 Ga0209129_1000425
680 Ga0209129_1000436
681 Ga0209565_1000165
682 Ga0209565_1000820
683 Ga0209673_1000454
684 Ga0209673_1001101
685 Ga0209673_1011107
686 Ga0209673_1011231
687 Ga0209130_1000427
688 Ga0209130_1000924
689 Ga0209675_1000321
690 Ga0209675_1001260
691 Ga0209675_1002144
692 Ga0209676_1000111
693 Ga0209676_1001670
694 Ga0209676_1030213
695 Ga0209025_1000686
696 Ga0209025_1001318
697 Ga0209025_1010672
698 Ga0209025_1026829
699 Ga0209564_1000022
700 Ga0209564_1000070
701 Ga0209564_1000352
702 Ga0209758_1000198
703 Ga0209758_1000297
704 Ga0209758_1003512
705 Ga0209050_1000111
706 Ga0209256_1000047
707 Ga0209256_1000238
708 Ga0209256_1001030
709 Ga0207426_1000194
710 Ga0207426_1000294
711 Ga0209051_1000340
712 Ga0209051_1012012
713 Ga0209257_1000690
714 Ga0209257_1001321
715 Ga0209257_1001472
716 Ga0207697_10011631
717 Ga0207656_10007230
718 Ga0207682_10005031
719 Ga0207682_10024121
720 Ga0207688_10012812
721 Ga0207645_10001804
722 Ga0207705_10090331
723 Ga0207705_10217374
724 Ga0207654_10105101
725 Ga0207695_10021906
726 Ga0207695_10105599
727 Ga0207695_10233343
728 Ga0207671_10278100
729 Ga0207657_10011824
730 Ga0207657_10209456
731 Ga0207681_10077086
732 Ga0207681_10218224
733 Ga0207694_10038070
734 Ga0207650_10005595
735 Ga0207650_10157511
736 Ga0207659_10078880
737 Ga0207659_10126095
738 Ga0207644_10123995
739 Ga0207644_10401475
740 Ga0207706_10067774
741 Ga0207706_10080743
742 Ga0207706_10111615
743 Ga0207706_10176295
744 Ga0207686_10001268
745 Ga0207686_10206254
746 Ga0207670_10338474
747 Ga0207669_10069638
748 Ga0207669_10254891
749 Ga0207691_10007218
750 Ga0207691_10010611
751 Ga0207691_10107584
752 Ga0207689_10014750
753 Ga0207661_10145681
754 Ga0207679_10115166
755 Ga0207679_10200584
756 Ga0207667_10014499
757 Ga0207651_10060165
758 Ga0207640_10010683
759 Ga0207658_10244132
760 Ga0207658_10426312
761 Ga0207677_10115355
762 Ga0207703_10035895
763 Ga0207639_10008330
764 Ga0207639_10206998
765 Ga0207678_10006442
766 Ga0207678_10334383
767 Ga0207702_10000270
768 Ga0207648_10007828
769 Ga0207648_10070575
770 Ga0207648_10203906
771 Ga0207676_10100829
772 Ga0207674_10003612
773 Ga0207675_100013307
774 Ga0207675_100045092
775 Ga0207675_100133237
776 Ga0207683_10011446
777 Ga0207683_10017558
778 Ga0207683_10040285
779 Ga0207683_10067781
780 Ga0207698_10419850
781 Ga0209282_1217279
782 Ga0265334_10042817
783 Ga0265336_10000022
784 Ga0307515_10021161
785 Ga0265324_10005667
786 Ga0316177_1131487
787 Ga0316178_1107021
788 Ga0316183_1091282
789 Ga0316181_1090846
790 Ga0265330_10019835
791 Ga0265327_10000327
792 Ga0307509_10205357
793 Ga0316575_10123220
794 Ga0316579_10068157
795 Ga0316578_10125863
796 Ga0307516_10025219
797 Ga0307405_10691042
798 Ga0307412_10003587
799 Ga0307416_100011500
800 Ga0307411_10366764
801 Ga0373931_0010782
802 Ga0373937_0067294
803 Ga0373937_0179714
804 Ga0373925_0247764
805 Ga0395898_0069276
806 Ga0395905_0096937
807 Ga0395905_0665512
808 Ga0436365_1480692
809 Ga0451853_2804152
810 Ga0439445_0002631
811 Ga0439455_0005516
812 Ga0450911_000185
813 Ga0451577_0095219
814 Ga0466963_0035097
815 Ga0466963_0179685
816 Ga0453684_0101220
817 Ga0453684_0593910
818 Ga0466957_0020924
819 Ga0451576_0104504
820 Ga0466967_0021387
821 Ga0495629_0113153
822 Ga0495651_0134467
823 Ga0495651_0235537
824 Ga0495650_0001042
825 Ga0495650_0004944
826 Ga0495639_0011236
827 Ga0495583_0000164
828 Ga0495606_0001489
829 Ga0495608_0156646
830 Ga0495610_0048904
831 Ga0495610_0085071
832 Ga0495616_0000350
833 Ga0495620_0010958
834 Ga0495620_0123504
835 Ga0495628_0251874
836 Ga0495630_0000714
837 Ga0495631_0000182
838 Ga0495637_0005214
839 Ga0495637_0049029
840 Ga0495652_0048602
841 Ga0495621_0015140
842 Ga0495656_0005544
843 Ga0495625_0026207
844 Ga0495625_0033000
845 Ga0495625_0037321
846 Ga0495635_0067847
847 Ga0495661_0097486
848 Ga0495588_0003415
849 Ga0495657_0030285
850 Ga0495670_0305038
851 Ga0495671_0011682
852 Ga0495649_0001452
853 Ga0495589_0024524
854 Ga0495600_0049428
855 Ga0495581_0297656
856 Ga0495604_0030421
857 Ga0495676_0347900
858 Ga0495686_0023741
859 Ga0495614_0031447
860 Ga0496103_0306873
861 Ga0496108_0025314
862 Ga0496109_0160511
863 Ga0496110_0100793
864 Ga0496110_0328938
865 Ga0496113_0013520
866 Ga0496114_0018095
867 Ga0496114_0065814
868 Ga0496117_0015763
869 Ga0496117_0253971
870 Ga0496118_0044115
871 Ga0496119_0032738
872 Ga0496121_0002770
873 Ga0496121_0003970
874 Ga0496121_0006784
875 Ga0496121_0103534
876 Ga0496121_0157683
877 Ga0496122_0000034
878 Ga0496122_0056202
879 Ga0496122_0176058
880 Ga0496122_0248869
881 Ga0496123_0000069
882 Ga0496123_0012813
883 Ga0496123_0066207
884 Ga0496124_0002098
885 Ga0496124_0039338
886 Ga0496124_0109204
887 Ga0496124_0172180
888 Ga0496125_0005512
889 Ga0496125_0024648
890 Ga0496125_0028303
891 Ga0496125_0080178
892 Ga0496125_0131428
893 Ga0496125_0305786
894 Ga0496126_0055580
895 Ga0501032_0178871
896 Ga0501033_0089603
897 Ga0501034_0000224
898 Ga0501039_0087218
899 Ga0501041_0029940
900 Ga0501042_0041450
901 Ga0501046_0186616
902 Ga0501047_0007163
903 Ga0501048_0011300
904 Ga0501067_0110412
905 Ga0501068_0004405
906 Ga0501068_0126029
907 Ga0501070_0420078
908 Ga0501072_0002629
909 Ga0501072_0069187
910 Ga0501073_0004182
911 Ga0501074_0017231
912 Ga0501074_0083986
913 Ga0501075_0247688
914 Ga0501077_0119224
915 Ga0501249_001690
916 Ga0501225_0001600
917 Ga0501080_0003598
918 Ga0501080_0107340
919 Ga0501083_0021092
920 Ga0501262_000243
921 Ga0501035_0351930
922 Ga0501044_0101201
923 Ga0501045_0022744
924 nmdc:mga00v17_6785_c2
925 nmdc:mga0k408_3538_c1
926 nmdc:mga07m45_10440_c1
927 nmdc:mga07m45_1090_c1
928 nmdc:mga0qj67_123767_c1
929 Ga0495601_0006750
930 Ga0500610_0000424
931 Ga0500610_0000721
932 Ga0500635_0000237
933 Ga0500635_0006347
934 Ga0495619_0004392
935 Ga0495619_0016762
936 Ga0500643_009531
937 Ga0500643_062510
938 Ga0500644_0019949
939 Ga0500593_002973
940 Ga0500594_0000469
941 Ga0500607_114868
942 Ga0500655_000096
943 Ga0500658_0001231
944 Ga0500559_0004378
945 Ga0500559_0060760
946 Ga0500564_065359
947 Ga0500568_0000111
948 Ga0500573_0014690
949 Ga0500590_010171
950 Ga0500616_0069065
951 Ga0500622_0004724
952 Ga0500627_0001793
953 Ga0500634_0028374
954 Ga0500634_0030027
955 Ga0500638_033270
956 Ga0501084_0303825
957 Ga0501082_0074400
958 2599625296
959 2599673252
960 2599682922
961 2599694860
962 2738723314
963 2738882949
964 2739284045
965 2819602186
966 2831267469
967 2838060422
968 2842679252
969 2842735116
970 2842751115
971 2885198238
972 2885212382
973 2899928748
974 2904550001
975 2919466183
976 2928043315
977 2928050757
978 2928058751
979 2928066176
980 2928077793
981 2928088099
982 2928118634
983 2929164887
984 2945910504
985 2945987440
986 2974321052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06966

DUF1295

Protein of unknown function (DUF1295)

36

265

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.721 19 244
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.6037 19 244
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5101 2 244
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.4912 2 244
4hyj-assembly1.cif.gz_A crystal structure of exiguobacterium sibiricum rhodopsin 0.4306 13 245
ID Description Score Start End Superfamily
af_O53731_51_249_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9228 44 245 1.20.120.1630
af_O53731_51_249_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9183 44 245 1.20.120.1630
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8971 48 245 1.20.120.1630
af_C6TD75_105_305_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8928 48 244 1.20.120.1630
af_I1KQJ7_60_258_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8851 48 245 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A1S9CYB9-F1-model_v4 Uncharacterized protein 0.9808 106 247 GO:0016020
AF-A0A7C5F542-F1-model_v4 DUF1295 domain-containing protein 0.9698 54 247 GO:0016020
AF-A0A2R7S3V4-F1-model_v4 deleted 0.9651 109 247
AF-A0A1W9ID13-F1-model_v4 Uncharacterized protein 0.9647 18 253 GO:0016020
AF-A0A1S9CYB9-F1-model_v4 Uncharacterized protein 0.9604 106 247 GO:0016020

Map