F454444

General Info

Members Datasets Scaffolds Average Seq Length
493 291 986 559

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10000596|Ga0265334_100005961
Length 628
Sequence MSRLRLALAQVNPTLGDLPGNAELVLRWSGAAARAGADLVAFPEMVLTGYPVEDLALRSSFVDASRATTTKLAADLAGAGLGAMPVVLGYLDRVDPTSDAPGATRPGVPKGRPQNVAGVLHGGRVAARYAKHHLPNYGVFDEFRIFVPGSELTVVRTHGHDIALAICEDLWQDGGPVARTHVAGAGLLLVLNGSPYECGKGDVRRELVTRRAAEAGCTLAYVNLVGGQDDLVFDGDSIVVAADGTVLARAPQFEEHLLLVDLDLPDAVATPATGTGIARVHLNDRPGSGPGHPVAPTPAVVDSPVVAGNTGHDGGTGLGLDTSGGWSPATSAPGTVTPSLPLEAAVHRALVLGLSDYVRKNGFRSVVLGLSGGIDSALVASLAADAIGARNVVGVSLPSDYSSEHSRDDAADLAGRIGLDYRVVPIAPMVASFLAGVGAAGTTMSGVAEENLQSRVRGVILMGLANQEGHLTLTTGNKSELAVGYSTIYGDSVGGFAPLKDVPKTLVWRLAHWRNAEAERLGQVPPIPENSISKPPSAELRPDQTDQDTLPPYDLLDAVLEAYVGGALGRSELLADGFDQEVVDSVVTMVDRAEWKRRQSAPGPKISPIAFGRDRRLPITSRWREHES

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
133 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
134 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
135 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
157 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
158 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
256 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
257 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
262 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2643221613 Oerskovia sp. Root22 Isolate Unclassified
269 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
270 2643221660 Methylibium sp. Root1272 Isolate Unclassified
271 2643221679 Angustibacter sp. Root456 Isolate Unclassified
272 2643221683 Variovorax sp. Root473 Isolate Unclassified
273 2643221721 Oerskovia sp. Root918 Isolate Unclassified
274 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
275 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
276 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
277 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
278 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
279 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
280 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
281 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
282 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
283 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
284 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
285 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
286 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
287 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
288 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
289 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
290 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
291 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.13
Metatranscriptomes 0
Isolates 4.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.69
Nodule 0
Rhizoplane 2.84
Rhizosphere 84.79
Stem 0
Stem Tuber 0.2
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10000596 3300028573 Bacteria 18250
2 JGI25153J46596_10000225 3300003215 Bacteria 48544
3 Ga0065707_10085270 3300005295 Bacteria 6302
4 Ga0070658_10000357 3300005327 Bacteria 39707
5 Ga0070658_10000789 3300005327 Bacteria 27151
6 Ga0070683_100004701 3300005329 Bacteria 11287
7 Ga0070683_100162573 3300005329 Bacteria 2118
8 Ga0070690_100045309 3300005330 Bacteria 2793
9 Ga0068869_100037897 3300005334 Bacteria 3431
10 Ga0068869_100081917 3300005334 Bacteria 2411
11 Ga0068869_100097249 3300005334 Bacteria 2222
12 Ga0070666_10018606 3300005335 Bacteria 4470
13 Ga0070680_100048723 3300005336 Bacteria 3453
14 Ga0070682_100031894 3300005337 Bacteria 3191
15 Ga0070689_100015651 3300005340 Bacteria 5536
16 Ga0070687_100003303 3300005343 Bacteria 6235
17 Ga0070669_100023330 3300005353 Bacteria 4430
18 Ga0070675_100001764 3300005354 Bacteria 15948
19 Ga0070673_100003824 3300005364 Bacteria 9443
20 Ga0070673_100055264 3300005364 Bacteria 3127
21 Ga0070673_100113270 3300005364 Bacteria 2252
22 Ga0070688_100013653 3300005365 Bacteria 4587
23 Ga0070659_100000483 3300005366 Bacteria 29241
24 Ga0070659_100057972 3300005366 Bacteria 3055
25 Ga0070667_100083086 3300005367 Bacteria 2743
26 Ga0070714_100010185 3300005435 Bacteria 7421
27 Ga0070714_100067925 3300005435 Bacteria 3075
28 Ga0070714_100088864 3300005435 Bacteria 2704
29 Ga0070713_100011958 3300005436 Bacteria 6350
30 Ga0070701_10022210 3300005438 Bacteria 3040
31 Ga0070711_100080624 3300005439 Bacteria 2318
32 Ga0070705_100018003 3300005440 Bacteria 3695
33 Ga0070708_100006644 3300005445 Bacteria 9209
34 Ga0070708_100161547 3300005445 Unclassified 2088
35 Ga0070678_100009280 3300005456 Bacteria 5950
36 Ga0070678_100081313 3300005456 Bacteria 2456
37 Ga0070681_10005446 3300005458 Bacteria 12298
38 Ga0068867_100047354 3300005459 Bacteria 3160
39 Ga0068867_100088094 3300005459 Bacteria 2352
40 Ga0068867_100135801 3300005459 Bacteria 1917
41 Ga0070706_100006686 3300005467 Bacteria 10883
42 Ga0070706_100061436 3300005467 Bacteria 3470
43 Ga0070706_100069598 3300005467 Bacteria 3254
44 Ga0070707_100034390 3300005468 Bacteria 4834
45 Ga0070707_100063906 3300005468 Bacteria 3532
46 Ga0070698_100001665 3300005471 Bacteria 24789
47 Ga0070698_100001869 3300005471 Bacteria 23455
48 Ga0070699_100013812 3300005518 Bacteria 6948
49 Ga0070679_100004318 3300005530 Bacteria 13121
50 Ga0070679_100054636 3300005530 Bacteria 3977
51 Ga0070679_100081688 3300005530 Bacteria 3221
52 Ga0070679_100102644 3300005530 Bacteria 2846
53 Ga0070684_100007349 3300005535 Bacteria 8562
54 Ga0070684_100032613 3300005535 Bacteria 4440
55 Ga0070684_100070450 3300005535 Bacteria 3077
56 Ga0070697_100005830 3300005536 Bacteria 9503
57 Ga0070697_100008581 3300005536 Bacteria 7979
58 Ga0070697_100009662 3300005536 Bacteria 7534
59 Ga0070697_100042959 3300005536 Unclassified 3659
60 Ga0070697_100062016 3300005536 Bacteria 3050
61 Ga0068853_100002218 3300005539 Bacteria 14522
62 Ga0070672_100023889 3300005543 Bacteria 4509
63 Ga0070693_100003096 3300005547 Bacteria 7717
64 Ga0070665_100032083 3300005548 Bacteria 5287
65 Ga0070665_100117932 3300005548 Bacteria 2657
66 Ga0070704_100007439 3300005549 Bacteria 6524
67 Ga0068855_100073554 3300005563 Bacteria 3970
68 Ga0068855_100136679 3300005563 Bacteria 2796
69 Ga0068857_100118270 3300005577 Bacteria 2385
70 Ga0068856_100027855 3300005614 Bacteria 5513
71 Ga0068856_100122327 3300005614 Bacteria 2604
72 Ga0070702_100001832 3300005615 Bacteria 8851
73 Ga0068852_100002337 3300005616 Bacteria 13047
74 Ga0068859_100007398 3300005617 Bacteria 11144
75 Ga0068859_100024157 3300005617 Bacteria 6098
76 Ga0068864_100045875 3300005618 Bacteria 3749
77 Ga0068851_10008627 3300005834 Bacteria 4718
78 Ga0068858_100013791 3300005842 Bacteria 7629
79 Ga0068862_100108151 3300005844 Bacteria 2438
80 Ga0081539_10000012 3300005985 Bacteria 440369
81 Ga0081539_10001508 3300005985 Bacteria 39310
82 Ga0075362_10016879 3300006177 Bacteria 2999
83 Ga0075369_10011933 3300006186 Bacteria 3424
84 Ga0075366_10005344 3300006195 Bacteria 6961
85 Ga0075366_10066563 3300006195 Bacteria 2143
86 Ga0097621_100005842 3300006237 Bacteria 8692
87 Ga0075428_100024948 3300006844 Bacteria 6614
88 Ga0075428_100053520 3300006844 Bacteria 4423
89 Ga0075433_10000992 3300006852 Bacteria 20158
90 Ga0075434_100159643 3300006871 Bacteria 2274
91 Ga0075429_100018549 3300006880 Bacteria 6025
92 Ga0097620_100007398 3300006931 Bacteria 11144
93 Ga0097620_100024157 3300006931 Bacteria 6098
94 Ga0075435_100001241 3300007076 Bacteria 16334
95 Ga0105240_10007962 3300009093 Bacteria 15283
96 Ga0105240_10035296 3300009093 Bacteria 6445
97 Ga0105240_10056904 3300009093 Bacteria 4890
98 Ga0105240_10076977 3300009093 Bacteria 4111
99 Ga0111539_10000243 3300009094 Bacteria 65363
100 Ga0111539_10040994 3300009094 Bacteria 5570
101 Ga0105245_10047652 3300009098 Bacteria 3831
102 Ga0114129_10016032 3300009147 Bacteria 10658
103 Ga0114129_10165222 3300009147 Bacteria 3021
104 Ga0105242_10042015 3300009176 Bacteria 3690
105 Ga0105242_10063485 3300009176 Bacteria 3041
106 Ga0105242_10080049 3300009176 Bacteria 2730
107 Ga0105248_10010088 3300009177 Bacteria 10401
108 Ga0105248_10016821 3300009177 Bacteria 8050
109 Ga0105237_10004995 3300009545 Bacteria 15109
110 Ga0105237_10065181 3300009545 Bacteria 3639
111 Ga0105238_10022262 3300009551 Bacteria 6461
112 Ga0105238_10022332 3300009551 Bacteria 6450
113 Ga0105249_10026316 3300009553 Bacteria 5241
114 Ga0157371_10002818 3300013102 Bacteria 16277
115 Ga0157370_10003304 3300013104 Bacteria 19007
116 Ga0157370_10005450 3300013104 Bacteria 14271
117 Ga0157369_10026000 3300013105 Bacteria 6495
118 Ga0157369_10060139 3300013105 Bacteria 4097
119 Ga0157374_10056262 3300013296 Bacteria 3672
120 Ga0157374_10165952 3300013296 Bacteria 2152
121 Ga0157378_10022212 3300013297 Bacteria 5584
122 Ga0163162_10168759 3300013306 Bacteria 2313
123 Ga0157372_10051795 3300013307 Bacteria 4569
124 Ga0157372_10093588 3300013307 Bacteria 3420
125 Ga0157375_10079172 3300013308 Bacteria 3321
126 Ga0157380_10022936 3300014326 Bacteria 4707
127 Ga0157380_10055699 3300014326 Bacteria 3141
128 Ga0157379_10011406 3300014968 Bacteria 7755
129 Ga0157379_10180124 3300014968 Bacteria 1909
130 Ga0157376_10021105 3300014969 Bacteria 5054
131 Ga0157376_10054088 3300014969 Bacteria 3345
132 Ga0209758_1000648 3300025297 Bacteria 52785
133 Ga0207656_10000744 3300025321 Bacteria 10651
134 Ga0207682_10022161 3300025893 Bacteria 2502
135 Ga0207647_10018482 3300025904 Bacteria 4710
136 Ga0207645_10001425 3300025907 Bacteria 19566
137 Ga0207705_10000006 3300025909 Bacteria 657147
138 Ga0207705_10063706 3300025909 Bacteria 2664
139 Ga0207684_10014822 3300025910 Bacteria 6710
140 Ga0207654_10071005 3300025911 Bacteria 2069
141 Ga0207695_10001125 3300025913 Bacteria 46438
142 Ga0207695_10043291 3300025913 Bacteria 4799
143 Ga0207695_10098458 3300025913 Bacteria 2923
144 Ga0207671_10000434 3300025914 Bacteria 57541
145 Ga0207663_10018910 3300025916 Bacteria 3869
146 Ga0207660_10043551 3300025917 Bacteria 3155
147 Ga0207660_10099754 3300025917 Bacteria 2167
148 Ga0207652_10012603 3300025921 Bacteria 6834
149 Ga0207652_10029084 3300025921 Bacteria 4616
150 Ga0207652_10170968 3300025921 Bacteria 1950
151 Ga0207646_10013426 3300025922 Bacteria 7835
152 Ga0207646_10035429 3300025922 Bacteria 4508
153 Ga0207646_10082135 3300025922 Bacteria 2881
154 Ga0207681_10002551 3300025923 Bacteria 11562
155 Ga0207694_10024440 3300025924 Bacteria 4589
156 Ga0207694_10026893 3300025924 Bacteria 4380
157 Ga0207694_10042261 3300025924 Bacteria 3516
158 Ga0207659_10028331 3300025926 Bacteria 3805
159 Ga0207687_10027788 3300025927 Bacteria 3798
160 Ga0207687_10111918 3300025927 Bacteria 2028
161 Ga0207700_10005978 3300025928 Bacteria 7323
162 Ga0207664_10045468 3300025929 Unclassified 3443
163 Ga0207644_10088190 3300025931 Bacteria 2307
164 Ga0207690_10002958 3300025932 Bacteria 10230
165 Ga0207686_10008156 3300025934 Bacteria 5649
166 Ga0207670_10041220 3300025936 Bacteria 3035
167 Ga0207670_10086022 3300025936 Bacteria 2211
168 Ga0207669_10015684 3300025937 Bacteria 3829
169 Ga0207704_10052735 3300025938 Bacteria 2467
170 Ga0207665_10026347 3300025939 Bacteria 3838
171 Ga0207691_10033531 3300025940 Bacteria 4780
172 Ga0207691_10039823 3300025940 Bacteria 4347
173 Ga0207691_10063768 3300025940 Bacteria 3341
174 Ga0207691_10097359 3300025940 Bacteria 2630
175 Ga0207691_10097675 3300025940 Bacteria 2625
176 Ga0207711_10079687 3300025941 Bacteria 2859
177 Ga0207689_10016249 3300025942 Bacteria 6304
178 Ga0207661_10003972 3300025944 Bacteria 10332
179 Ga0207661_10076632 3300025944 Bacteria 2747
180 Ga0207667_10035672 3300025949 Bacteria 5335
181 Ga0207667_10038853 3300025949 Bacteria 5077
182 Ga0207667_10055121 3300025949 Bacteria 4180
183 Ga0207667_10080782 3300025949 Bacteria 3368
184 Ga0207667_10141104 3300025949 Bacteria 2481
185 Ga0207651_10006716 3300025960 Bacteria 6061
186 Ga0207651_10020588 3300025960 Bacteria 3986
187 Ga0207658_10031889 3300025986 Bacteria 3747
188 Ga0207658_10040648 3300025986 Bacteria 3363
189 Ga0207658_10050766 3300025986 Bacteria 3054
190 Ga0207658_10067292 3300025986 Bacteria 2698
191 Ga0207658_10071549 3300025986 Bacteria 2626
192 Ga0207703_10081723 3300026035 Bacteria 2694
193 Ga0207639_10014203 3300026041 Bacteria 5592
194 Ga0207708_10000638 3300026075 Bacteria 26946
195 Ga0207702_10058336 3300026078 Bacteria 3285
196 Ga0207702_10096197 3300026078 Bacteria 2604
197 Ga0207648_10012237 3300026089 Bacteria 8035
198 Ga0207648_10052014 3300026089 Bacteria 3581
199 Ga0207648_10115964 3300026089 Bacteria 2354
200 Ga0207674_10070068 3300026116 Bacteria 3525
201 Ga0207675_100042824 3300026118 Bacteria 4227
202 Ga0207698_10000922 3300026142 Bacteria 17101
203 Ga0209966_1000029 3300027695 Bacteria 65037
204 Ga0207428_10026226 3300027907 Bacteria 4865
205 Ga0207428_10029847 3300027907 Bacteria 4512
206 Ga0207428_10048273 3300027907 Bacteria 3416
207 Ga0265337_1000283 3300028556 Bacteria 27564
208 Ga0265337_1003931 3300028556 Bacteria 6294
209 Ga0265334_10024751 3300028573 Bacteria 2433
210 Ga0265318_10000027 3300028577 Bacteria 153682
211 Ga0265318_10009282 3300028577 Bacteria 4334
212 Ga0265318_10014762 3300028577 Bacteria 3270
213 Ga0265323_10000029 3300028653 Bacteria 78081
214 Ga0265323_10008491 3300028653 Bacteria 4235
215 Ga0265322_10003013 3300028654 Bacteria 5131
216 Ga0307515_10000178 3300028794 Bacteria 157107
217 Ga0307515_10134175 3300028794 Bacteria 2704
218 Ga0265338_10000082 3300028800 Bacteria 176343
219 Ga0265338_10048804 3300028800 Bacteria 3846
220 Ga0265324_10006726 3300029957 Bacteria 4748
221 Ga0265324_10007679 3300029957 Bacteria 4342
222 Ga0316176_1055304 3300030732 Bacteria 3412
223 Ga0314311_1045146 3300030733 Bacteria 3226
224 Ga0316183_1061765 3300030742 Bacteria 6218
225 Ga0316182_1110573 3300030745 Bacteria 5911
226 Ga0265330_10000126 3300031235 Bacteria 62021
227 Ga0265332_10000649 3300031238 Bacteria 22574
228 Ga0265332_10034208 3300031238 Bacteria 2210
229 Ga0265328_10002739 3300031239 Bacteria 7884
230 Ga0265328_10005349 3300031239 Bacteria 5503
231 Ga0265328_10017802 3300031239 Bacteria 2749
232 Ga0265320_10000018 3300031240 Bacteria 183411
233 Ga0265320_10001050 3300031240 Bacteria 20519
234 Ga0265320_10005779 3300031240 Bacteria 7884
235 Ga0265320_10007432 3300031240 Bacteria 6798
236 Ga0265325_10003776 3300031241 Bacteria 9774
237 Ga0265329_10002760 3300031242 Bacteria 7859
238 Ga0265340_10000697 3300031247 Bacteria 18924
239 Ga0265340_10040048 3300031247 Bacteria 2309
240 Ga0265339_10002232 3300031249 Bacteria 14034
241 Ga0265339_10019885 3300031249 Bacteria 3930
242 Ga0265331_10000046 3300031250 Bacteria 183360
243 Ga0265331_10000686 3300031250 Bacteria 29053
244 Ga0265316_10001572 3300031344 Bacteria 24411
245 Ga0265316_10002028 3300031344 Bacteria 21327
246 Ga0265316_10005603 3300031344 Bacteria 12165
247 Ga0265316_10049948 3300031344 Bacteria 3293
248 Ga0307513_10000449 3300031456 Bacteria 59327
249 Ga0265313_10000337 3300031595 Bacteria 50974
250 Ga0265313_10000489 3300031595 Bacteria 41771
251 Ga0265313_10012149 3300031595 Bacteria 5293
252 Ga0265313_10013848 3300031595 Bacteria 4806
253 Ga0307514_10016754 3300031649 Bacteria 6036
254 Ga0316579_10000017 3300031691 Bacteria 39268
255 Ga0316579_10005565 3300031691 Bacteria 5094
256 Ga0265314_10000283 3300031711 Bacteria 73858
257 Ga0265314_10001000 3300031711 Bacteria 33137
258 Ga0265314_10012054 3300031711 Bacteria 7086
259 Ga0265314_10044503 3300031711 Bacteria 3147
260 Ga0265342_10000064 3300031712 Bacteria 113079
261 Ga0265342_10001601 3300031712 Bacteria 20888
262 Ga0265342_10003468 3300031712 Bacteria 12916
263 Ga0265342_10005207 3300031712 Bacteria 9988
264 Ga0265342_10006385 3300031712 Bacteria 8784
265 Ga0316576_10002696 3300031727 Bacteria 10158
266 Ga0316576_10007069 3300031727 Bacteria 7031
267 Ga0316576_10011800 3300031727 Bacteria 5744
268 Ga0316576_10022461 3300031727 Bacteria 4382
269 Ga0316578_10025446 3300031728 Bacteria 3328
270 Ga0316578_10031222 3300031728 Bacteria 3034
271 Ga0316577_10006470 3300031733 Bacteria 6189
272 Ga0316583_10005352 3300032133 Bacteria 4604
273 Ga0316585_10000680 3300032137 Bacteria 8456
274 Ga0316580_10003042 3300032139 Bacteria 4719
275 Ga0373950_0000001 3300034818 Bacteria 1001987
276 Ga0373950_0000038 3300034818 Bacteria 117886
277 Ga0373954_0008345 3300035118 Bacteria 4543
278 Ga0373954_0010646 3300035118 Bacteria 4063
279 Ga0373957_0002871 3300035120 Bacteria 4985
280 Ga0373955_0005731 3300035172 Bacteria 5596
281 Ga0373955_0012718 3300035172 Bacteria 4053
282 Ga0316574_0006611 3300035398 Bacteria 6282
283 Ga0373924_0007323 3300035410 Bacteria 3981
284 Ga0373931_0009090 3300035691 Bacteria 4740
285 Ga0373935_0026616 3300035692 Bacteria 3572
286 Ga0373933_0000365 3300035724 Bacteria 28941
287 Ga0373933_0029639 3300035724 Bacteria 3166
288 Ga0373937_0001210 3300036401 Bacteria 21731
289 Ga0373937_0013602 3300036401 Bacteria 7170
290 Ga0316582_0011628 3300036647 Bacteria 4874
291 Ga0316584_0010778 3300036712 Bacteria 6400
292 Ga0316584_0011763 3300036712 Bacteria 6158
293 Ga0395899_0001405 3300037312 Bacteria 20644
294 Ga0395900_0031793 3300037418 Bacteria 5425
295 Ga0316581_0001268 3300037588 Bacteria 5594
296 Ga0395901_0014681 3300038443 Bacteria 7960
297 Ga0395901_0263711 3300038443 Archaea 1793
298 Ga0436365_0843402 3300039437 Bacteria 4055
299 Ga0451833_0148586 3300041491 Bacteria 8132
300 Ga0451577_0000012 3300042876 Bacteria 575467
301 Ga0451577_0005693 3300042876 Bacteria 12643
302 Ga0451577_0016841 3300042876 Bacteria 6761
303 Ga0451577_0167007 3300042876 Bacteria 1983
304 Ga0453683_0000044 3300044673 Bacteria 211182
305 Ga0466961_0031728 3300044693 Bacteria 3397
306 Ga0466963_0003887 3300044694 Bacteria 8627
307 Ga0453684_0000015 3300044712 Bacteria 969198
308 Ga0453684_0000020 3300044712 Bacteria 879938
309 Ga0453684_0007857 3300044712 Bacteria 19409
310 Ga0453684_0260845 3300044712 Bacteria 1985
311 Ga0466971_0005222 3300044719 Bacteria 5624
312 Ga0466960_0009831 3300044901 Bacteria 3955
313 Ga0466959_0008001 3300045049 Bacteria 7449
314 Ga0466959_0031302 3300045049 Bacteria 3937
315 Ga0451576_0003961 3300045051 Bacteria 19724
316 Ga0451576_0013495 3300045051 Bacteria 9139
317 Ga0451576_0027293 3300045051 Bacteria 6134
318 Ga0451576_0086136 3300045051 Bacteria 3268
319 Ga0451576_0208927 3300045051 Bacteria 2039
320 Ga0495592_0085454 3300046454 Bacteria 2274
321 Ga0495638_0056565 3300046460 Bacteria 2434
322 Ga0495664_0016331 3300046477 Bacteria 4226
323 Ga0495664_0071591 3300046477 Bacteria 2071
324 Ga0495628_0014426 3300046516 Bacteria 6623
325 Ga0495628_0071563 3300046516 Bacteria 2703
326 Ga0495630_0018283 3300046517 Bacteria 5147
327 Ga0495652_0085878 3300046529 Bacteria 2585
328 Ga0495586_0009173 3300046535 Bacteria 5265
329 Ga0495587_0092140 3300046536 Bacteria 1750
330 Ga0495621_0005110 3300046539 Bacteria 3747
331 Ga0495645_0015389 3300046543 Bacteria 5440
332 Ga0495656_0001240 3300046615 Bacteria 8306
333 Ga0495634_0026201 3300046642 Bacteria 4070
334 Ga0495625_0013531 3300046660 Bacteria 6548
335 Ga0495657_0012271 3300046675 Bacteria 6366
336 Ga0495623_0029983 3300046679 Bacteria 3501
337 Ga0495658_0037639 3300046683 Bacteria 2675
338 Ga0495613_0048451 3300046689 Bacteria 3138
339 Ga0495613_0066882 3300046689 Bacteria 2623
340 Ga0495604_0009131 3300047317 Bacteria 7846
341 Ga0495676_0008211 3300047321 Bacteria 9575
342 Ga0495680_0015881 3300047322 Bacteria 6481
343 Ga0495675_0022781 3300047444 Bacteria 3993
344 Ga0495675_0089412 3300047444 Bacteria 1933
345 Ga0496101_0021099 3300048904 Bacteria 4471
346 Ga0496104_0013892 3300048907 Bacteria 7265
347 Ga0496105_0061780 3300048908 Bacteria 3092
348 Ga0496108_0111059 3300048911 Bacteria 2344
349 Ga0496109_0030485 3300048912 Bacteria 4834
350 Ga0496109_0071283 3300048912 Bacteria 3190
351 Ga0496110_0005431 3300048913 Bacteria 9995
352 Ga0496110_0053735 3300048913 Bacteria 3542
353 Ga0496111_0059411 3300048914 Bacteria 2770
354 Ga0496112_0037684 3300048915 Bacteria 4719
355 Ga0496113_0019269 3300048916 Bacteria 4770
356 Ga0496114_0009521 3300048917 Bacteria 7707
357 Ga0496114_0097117 3300048917 Bacteria 2509
358 Ga0496114_0103399 3300048917 Bacteria 2435
359 Ga0496117_0000128 3300048920 Bacteria 166039
360 Ga0496117_0097153 3300048920 Bacteria 1877
361 Ga0496118_0053225 3300048921 Bacteria 3080
362 Ga0496119_0000750 3300048922 Bacteria 43609
363 Ga0496121_0000076 3300048924 Bacteria 239775
364 Ga0496126_0048537 3300048929 Bacteria 3878
365 Ga0496126_0085848 3300048929 Bacteria 2774
366 Ga0501031_0000401 3300049568 Bacteria 25310
367 Ga0501031_0052538 3300049568 Bacteria 2655
368 Ga0501032_0000011 3300049569 Bacteria 198158
369 Ga0501032_0033997 3300049569 Bacteria 3491
370 Ga0501033_0000307 3300049570 Bacteria 46225
371 Ga0501034_0000001 3300049571 Bacteria 2184493
372 Ga0501034_0000363 3300049571 Bacteria 77256
373 Ga0501034_0001788 3300049571 Bacteria 27444
374 Ga0501034_0018488 3300049571 Bacteria 7146
375 Ga0501034_0179601 3300049571 Bacteria 2082
376 Ga0501036_0001930 3300049572 Bacteria 16093
377 Ga0501036_0104267 3300049572 Bacteria 2398
378 Ga0501037_0010958 3300049573 Bacteria 6666
379 Ga0501037_0076640 3300049573 Bacteria 2427
380 Ga0501038_0000175 3300049574 Bacteria 54771
381 Ga0501039_0000034 3300049575 Bacteria 126569
382 Ga0501039_0031530 3300049575 Bacteria 4087
383 Ga0501043_0085465 3300049579 Bacteria 2479
384 Ga0501043_0085924 3300049579 Bacteria 2472
385 Ga0501046_0000885 3300049580 Bacteria 29144
386 Ga0501046_0033848 3300049580 Bacteria 4127
387 Ga0501046_0037484 3300049580 Bacteria 3895
388 Ga0501047_0000018 3300049581 Bacteria 274180
389 Ga0501047_0000078 3300049581 Bacteria 123338
390 Ga0501047_0017163 3300049581 Bacteria 6927
391 Ga0501047_0017264 3300049581 Bacteria 6910
392 Ga0501047_0020157 3300049581 Bacteria 6401
393 Ga0501047_0024445 3300049581 Bacteria 5797
394 Ga0501048_0002434 3300049582 Bacteria 14206
395 Ga0501048_0002532 3300049582 Bacteria 13981
396 Ga0501067_0000011 3300049583 Bacteria 115694
397 Ga0501067_0007634 3300049583 Bacteria 6012
398 Ga0501069_0013897 3300049585 Bacteria 4298
399 Ga0501070_0001279 3300049586 Bacteria 22589
400 Ga0501070_0005279 3300049586 Bacteria 11020
401 Ga0501070_0036130 3300049586 Bacteria 4126
402 Ga0501070_0047016 3300049586 Bacteria 3589
403 Ga0501071_0003808 3300049587 Bacteria 9483
404 Ga0501072_0000111 3300049588 Bacteria 59988
405 Ga0501072_0047325 3300049588 Bacteria 3387
406 Ga0501073_0000075 3300049589 Bacteria 61808
407 Ga0501073_0000153 3300049589 Bacteria 45756
408 Ga0501073_0000882 3300049589 Bacteria 21503
409 Ga0501073_0015760 3300049589 Bacteria 5478
410 Ga0501073_0020191 3300049589 Bacteria 4804
411 Ga0501074_0007135 3300049590 Bacteria 8074
412 Ga0501074_0007942 3300049590 Bacteria 7686
413 Ga0501074_0011220 3300049590 Bacteria 6510
414 Ga0501075_0017689 3300049591 Bacteria 5148
415 Ga0501075_0033347 3300049591 Bacteria 3831
416 Ga0501076_0001663 3300049592 Bacteria 15028
417 Ga0501076_0104069 3300049592 Bacteria 2290
418 Ga0501079_0002652 3300049741 Bacteria 13011
419 Ga0501079_0004458 3300049741 Bacteria 10379
420 Ga0501079_0010091 3300049741 Bacteria 7171
421 Ga0501080_0001290 3300049742 Bacteria 20839
422 Ga0501080_0003892 3300049742 Bacteria 13215
423 Ga0501083_0000377 3300049744 Bacteria 28170
424 Ga0501083_0001575 3300049744 Bacteria 15583
425 Ga0501083_0010446 3300049744 Bacteria 6536
426 Ga0501044_0004457 3300049823 Bacteria 15664
427 Ga0501044_0006974 3300049823 Bacteria 12429
428 Ga0501044_0007457 3300049823 Bacteria 12030
429 Ga0501044_0049892 3300049823 Bacteria 4320
430 Ga0501044_0070758 3300049823 Bacteria 3548
431 Ga0501045_0038421 3300049824 Bacteria 3481
432 nmdc:mga0k408_54259_c1 3300050493 Bacteria 2323
433 nmdc:mga08y16_168161_c1 3300050511 Bacteria 2278
434 nmdc:mga08y16_2492_c1 3300050511 Bacteria 18920
435 nmdc:mga08y16_42132_c1 3300050511 Bacteria 4782
436 nmdc:mga0rr50_4022_c1 3300050513 Bacteria 8580
437 nmdc:mga0a205_107226_c1 3300050515 Bacteria 2691
438 Ga0495601_0003939 3300053077 Bacteria 8547
439 Ga0500643_006290 3300053087 Bacteria 4982
440 Ga0500651_0000097 3300053093 Bacteria 53876
441 Ga0500556_0000001 3300053104 Bacteria 1135060
442 Ga0500556_0000839 3300053104 Bacteria 17653
443 Ga0500571_005809 3300053110 Bacteria 6629
444 Ga0500642_0000467 3300053130 Bacteria 12599
445 Ga0500655_000923 3300053133 Bacteria 5685
446 Ga0500658_0001247 3300053134 Bacteria 10330
447 Ga0500658_0001369 3300053134 Bacteria 9857
448 Ga0500559_0000263 3300053136 Bacteria 41139
449 Ga0500559_0000338 3300053136 Bacteria 35118
450 Ga0500559_0031652 3300053136 Bacteria 2269
451 Ga0500568_0000006 3300053139 Bacteria 522235
452 Ga0500568_0000026 3300053139 Bacteria 165582
453 Ga0500568_0000529 3300053139 Bacteria 28228
454 Ga0500568_0028048 3300053139 Bacteria 2349
455 Ga0500573_0003293 3300053140 Bacteria 8333
456 Ga0500573_0003818 3300053140 Bacteria 7857
457 Ga0500573_0022848 3300053140 Bacteria 3590
458 Ga0500573_0058005 3300053140 Bacteria 2220
459 Ga0500577_0010337 3300053142 Bacteria 2745
460 Ga0500616_0000021 3300053153 Bacteria 484527
461 Ga0500616_0000111 3300053153 Bacteria 152320
462 Ga0500616_0001006 3300053153 Bacteria 30305
463 Ga0500616_0010674 3300053153 Bacteria 5481
464 Ga0500645_009103 3300053730 Bacteria 3350
465 Ga0501084_0000015 3300054114 Bacteria 159007
466 Ga0501084_0004929 3300054114 Bacteria 10908
467 Ga0501082_0000686 3300060353 Bacteria 29836
468 Ga0501082_0094553 3300060353 Bacteria 2583
469 Ga0530510_0076261 3300061734 Bacteria 2436
470 2644083085 2643221613 Bacteria 4622396
471 2644199172 2643221635 Bacteria 2632343
472 2644337487 2643221660 Bacteria 4208257
473 2644446324 2643221679 Bacteria 3839507
474 2644468054 2643221683 Bacteria 5749203
475 2644666100 2643221721 Bacteria 4486924
476 2676488100 2675903060 Bacteria 10051191
477 2687580559 2687453129 Bacteria 4387428
478 2729906007 2728369276 Bacteria 5610032
479 2844855606 2844852863 Bacteria 3849151
480 2870623669 2870622029 Bacteria 3643329
481 2884697310 2884693830 Bacteria 11273186
482 2884995783 2884994152 Bacteria 4492978
483 2895430915 2895427314 Bacteria 13147766
484 2895452818 2895442618 Bacteria 11027144
485 2899360366 2899359706 Bacteria 10940472
486 2899372699 2899370129 Bacteria 6781179
487 2928084203 2928084124 Bacteria 7159212
488 2932433059 2932431166 Bacteria 4215299
489 2935891446 2935890801 Bacteria 4593001
490 2966924959 2966924647 Bacteria 3268643
491 8056037404 8056037122 Bacteria 3854319
492 8056064577 8056060235 Bacteria 7259403
493 8057348839 8057345674 Bacteria 4160394
494 Ga0265334_10000596
495 JGI25153J46596_10000225
496 Ga0065707_10085270
497 Ga0070658_10000357
498 Ga0070658_10000789
499 Ga0070683_100004701
500 Ga0070683_100162573
501 Ga0070690_100045309
502 Ga0068869_100037897
503 Ga0068869_100081917
504 Ga0068869_100097249
505 Ga0070666_10018606
506 Ga0070680_100048723
507 Ga0070682_100031894
508 Ga0070689_100015651
509 Ga0070687_100003303
510 Ga0070669_100023330
511 Ga0070675_100001764
512 Ga0070673_100003824
513 Ga0070673_100055264
514 Ga0070673_100113270
515 Ga0070688_100013653
516 Ga0070659_100000483
517 Ga0070659_100057972
518 Ga0070667_100083086
519 Ga0070714_100010185
520 Ga0070714_100067925
521 Ga0070714_100088864
522 Ga0070713_100011958
523 Ga0070701_10022210
524 Ga0070711_100080624
525 Ga0070705_100018003
526 Ga0070708_100006644
527 Ga0070708_100161547
528 Ga0070678_100009280
529 Ga0070678_100081313
530 Ga0070681_10005446
531 Ga0068867_100047354
532 Ga0068867_100088094
533 Ga0068867_100135801
534 Ga0070706_100006686
535 Ga0070706_100061436
536 Ga0070706_100069598
537 Ga0070707_100034390
538 Ga0070707_100063906
539 Ga0070698_100001665
540 Ga0070698_100001869
541 Ga0070699_100013812
542 Ga0070679_100004318
543 Ga0070679_100054636
544 Ga0070679_100081688
545 Ga0070679_100102644
546 Ga0070684_100007349
547 Ga0070684_100032613
548 Ga0070684_100070450
549 Ga0070697_100005830
550 Ga0070697_100008581
551 Ga0070697_100009662
552 Ga0070697_100042959
553 Ga0070697_100062016
554 Ga0068853_100002218
555 Ga0070672_100023889
556 Ga0070693_100003096
557 Ga0070665_100032083
558 Ga0070665_100117932
559 Ga0070704_100007439
560 Ga0068855_100073554
561 Ga0068855_100136679
562 Ga0068857_100118270
563 Ga0068856_100027855
564 Ga0068856_100122327
565 Ga0070702_100001832
566 Ga0068852_100002337
567 Ga0068859_100007398
568 Ga0068859_100024157
569 Ga0068864_100045875
570 Ga0068851_10008627
571 Ga0068858_100013791
572 Ga0068862_100108151
573 Ga0081539_10000012
574 Ga0081539_10001508
575 Ga0075362_10016879
576 Ga0075369_10011933
577 Ga0075366_10005344
578 Ga0075366_10066563
579 Ga0097621_100005842
580 Ga0075428_100024948
581 Ga0075428_100053520
582 Ga0075433_10000992
583 Ga0075434_100159643
584 Ga0075429_100018549
585 Ga0097620_100007398
586 Ga0097620_100024157
587 Ga0075435_100001241
588 Ga0105240_10007962
589 Ga0105240_10035296
590 Ga0105240_10056904
591 Ga0105240_10076977
592 Ga0111539_10000243
593 Ga0111539_10040994
594 Ga0105245_10047652
595 Ga0114129_10016032
596 Ga0114129_10165222
597 Ga0105242_10042015
598 Ga0105242_10063485
599 Ga0105242_10080049
600 Ga0105248_10010088
601 Ga0105248_10016821
602 Ga0105237_10004995
603 Ga0105237_10065181
604 Ga0105238_10022262
605 Ga0105238_10022332
606 Ga0105249_10026316
607 Ga0157371_10002818
608 Ga0157370_10003304
609 Ga0157370_10005450
610 Ga0157369_10026000
611 Ga0157369_10060139
612 Ga0157374_10056262
613 Ga0157374_10165952
614 Ga0157378_10022212
615 Ga0163162_10168759
616 Ga0157372_10051795
617 Ga0157372_10093588
618 Ga0157375_10079172
619 Ga0157380_10022936
620 Ga0157380_10055699
621 Ga0157379_10011406
622 Ga0157379_10180124
623 Ga0157376_10021105
624 Ga0157376_10054088
625 Ga0209758_1000648
626 Ga0207656_10000744
627 Ga0207682_10022161
628 Ga0207647_10018482
629 Ga0207645_10001425
630 Ga0207705_10000006
631 Ga0207705_10063706
632 Ga0207684_10014822
633 Ga0207654_10071005
634 Ga0207695_10001125
635 Ga0207695_10043291
636 Ga0207695_10098458
637 Ga0207671_10000434
638 Ga0207663_10018910
639 Ga0207660_10043551
640 Ga0207660_10099754
641 Ga0207652_10012603
642 Ga0207652_10029084
643 Ga0207652_10170968
644 Ga0207646_10013426
645 Ga0207646_10035429
646 Ga0207646_10082135
647 Ga0207681_10002551
648 Ga0207694_10024440
649 Ga0207694_10026893
650 Ga0207694_10042261
651 Ga0207659_10028331
652 Ga0207687_10027788
653 Ga0207687_10111918
654 Ga0207700_10005978
655 Ga0207664_10045468
656 Ga0207644_10088190
657 Ga0207690_10002958
658 Ga0207686_10008156
659 Ga0207670_10041220
660 Ga0207670_10086022
661 Ga0207669_10015684
662 Ga0207704_10052735
663 Ga0207665_10026347
664 Ga0207691_10033531
665 Ga0207691_10039823
666 Ga0207691_10063768
667 Ga0207691_10097359
668 Ga0207691_10097675
669 Ga0207711_10079687
670 Ga0207689_10016249
671 Ga0207661_10003972
672 Ga0207661_10076632
673 Ga0207667_10035672
674 Ga0207667_10038853
675 Ga0207667_10055121
676 Ga0207667_10080782
677 Ga0207667_10141104
678 Ga0207651_10006716
679 Ga0207651_10020588
680 Ga0207658_10031889
681 Ga0207658_10040648
682 Ga0207658_10050766
683 Ga0207658_10067292
684 Ga0207658_10071549
685 Ga0207703_10081723
686 Ga0207639_10014203
687 Ga0207708_10000638
688 Ga0207702_10058336
689 Ga0207702_10096197
690 Ga0207648_10012237
691 Ga0207648_10052014
692 Ga0207648_10115964
693 Ga0207674_10070068
694 Ga0207675_100042824
695 Ga0207698_10000922
696 Ga0209966_1000029
697 Ga0207428_10026226
698 Ga0207428_10029847
699 Ga0207428_10048273
700 Ga0265337_1000283
701 Ga0265337_1003931
702 Ga0265334_10024751
703 Ga0265318_10000027
704 Ga0265318_10009282
705 Ga0265318_10014762
706 Ga0265323_10000029
707 Ga0265323_10008491
708 Ga0265322_10003013
709 Ga0307515_10000178
710 Ga0307515_10134175
711 Ga0265338_10000082
712 Ga0265338_10048804
713 Ga0265324_10006726
714 Ga0265324_10007679
715 Ga0316176_1055304
716 Ga0314311_1045146
717 Ga0316183_1061765
718 Ga0316182_1110573
719 Ga0265330_10000126
720 Ga0265332_10000649
721 Ga0265332_10034208
722 Ga0265328_10002739
723 Ga0265328_10005349
724 Ga0265328_10017802
725 Ga0265320_10000018
726 Ga0265320_10001050
727 Ga0265320_10005779
728 Ga0265320_10007432
729 Ga0265325_10003776
730 Ga0265329_10002760
731 Ga0265340_10000697
732 Ga0265340_10040048
733 Ga0265339_10002232
734 Ga0265339_10019885
735 Ga0265331_10000046
736 Ga0265331_10000686
737 Ga0265316_10001572
738 Ga0265316_10002028
739 Ga0265316_10005603
740 Ga0265316_10049948
741 Ga0307513_10000449
742 Ga0265313_10000337
743 Ga0265313_10000489
744 Ga0265313_10012149
745 Ga0265313_10013848
746 Ga0307514_10016754
747 Ga0316579_10000017
748 Ga0316579_10005565
749 Ga0265314_10000283
750 Ga0265314_10001000
751 Ga0265314_10012054
752 Ga0265314_10044503
753 Ga0265342_10000064
754 Ga0265342_10001601
755 Ga0265342_10003468
756 Ga0265342_10005207
757 Ga0265342_10006385
758 Ga0316576_10002696
759 Ga0316576_10007069
760 Ga0316576_10011800
761 Ga0316576_10022461
762 Ga0316578_10025446
763 Ga0316578_10031222
764 Ga0316577_10006470
765 Ga0316583_10005352
766 Ga0316585_10000680
767 Ga0316580_10003042
768 Ga0373950_0000001
769 Ga0373950_0000038
770 Ga0373954_0008345
771 Ga0373954_0010646
772 Ga0373957_0002871
773 Ga0373955_0005731
774 Ga0373955_0012718
775 Ga0316574_0006611
776 Ga0373924_0007323
777 Ga0373931_0009090
778 Ga0373935_0026616
779 Ga0373933_0000365
780 Ga0373933_0029639
781 Ga0373937_0001210
782 Ga0373937_0013602
783 Ga0316582_0011628
784 Ga0316584_0010778
785 Ga0316584_0011763
786 Ga0395899_0001405
787 Ga0395900_0031793
788 Ga0316581_0001268
789 Ga0395901_0014681
790 Ga0395901_0263711
791 Ga0436365_0843402
792 Ga0451833_0148586
793 Ga0451577_0000012
794 Ga0451577_0005693
795 Ga0451577_0016841
796 Ga0451577_0167007
797 Ga0453683_0000044
798 Ga0466961_0031728
799 Ga0466963_0003887
800 Ga0453684_0000015
801 Ga0453684_0000020
802 Ga0453684_0007857
803 Ga0453684_0260845
804 Ga0466971_0005222
805 Ga0466960_0009831
806 Ga0466959_0008001
807 Ga0466959_0031302
808 Ga0451576_0003961
809 Ga0451576_0013495
810 Ga0451576_0027293
811 Ga0451576_0086136
812 Ga0451576_0208927
813 Ga0495592_0085454
814 Ga0495638_0056565
815 Ga0495664_0016331
816 Ga0495664_0071591
817 Ga0495628_0014426
818 Ga0495628_0071563
819 Ga0495630_0018283
820 Ga0495652_0085878
821 Ga0495586_0009173
822 Ga0495587_0092140
823 Ga0495621_0005110
824 Ga0495645_0015389
825 Ga0495656_0001240
826 Ga0495634_0026201
827 Ga0495625_0013531
828 Ga0495657_0012271
829 Ga0495623_0029983
830 Ga0495658_0037639
831 Ga0495613_0048451
832 Ga0495613_0066882
833 Ga0495604_0009131
834 Ga0495676_0008211
835 Ga0495680_0015881
836 Ga0495675_0022781
837 Ga0495675_0089412
838 Ga0496101_0021099
839 Ga0496104_0013892
840 Ga0496105_0061780
841 Ga0496108_0111059
842 Ga0496109_0030485
843 Ga0496109_0071283
844 Ga0496110_0005431
845 Ga0496110_0053735
846 Ga0496111_0059411
847 Ga0496112_0037684
848 Ga0496113_0019269
849 Ga0496114_0009521
850 Ga0496114_0097117
851 Ga0496114_0103399
852 Ga0496117_0000128
853 Ga0496117_0097153
854 Ga0496118_0053225
855 Ga0496119_0000750
856 Ga0496121_0000076
857 Ga0496126_0048537
858 Ga0496126_0085848
859 Ga0501031_0000401
860 Ga0501031_0052538
861 Ga0501032_0000011
862 Ga0501032_0033997
863 Ga0501033_0000307
864 Ga0501034_0000001
865 Ga0501034_0000363
866 Ga0501034_0001788
867 Ga0501034_0018488
868 Ga0501034_0179601
869 Ga0501036_0001930
870 Ga0501036_0104267
871 Ga0501037_0010958
872 Ga0501037_0076640
873 Ga0501038_0000175
874 Ga0501039_0000034
875 Ga0501039_0031530
876 Ga0501043_0085465
877 Ga0501043_0085924
878 Ga0501046_0000885
879 Ga0501046_0033848
880 Ga0501046_0037484
881 Ga0501047_0000018
882 Ga0501047_0000078
883 Ga0501047_0017163
884 Ga0501047_0017264
885 Ga0501047_0020157
886 Ga0501047_0024445
887 Ga0501048_0002434
888 Ga0501048_0002532
889 Ga0501067_0000011
890 Ga0501067_0007634
891 Ga0501069_0013897
892 Ga0501070_0001279
893 Ga0501070_0005279
894 Ga0501070_0036130
895 Ga0501070_0047016
896 Ga0501071_0003808
897 Ga0501072_0000111
898 Ga0501072_0047325
899 Ga0501073_0000075
900 Ga0501073_0000153
901 Ga0501073_0000882
902 Ga0501073_0015760
903 Ga0501073_0020191
904 Ga0501074_0007135
905 Ga0501074_0007942
906 Ga0501074_0011220
907 Ga0501075_0017689
908 Ga0501075_0033347
909 Ga0501076_0001663
910 Ga0501076_0104069
911 Ga0501079_0002652
912 Ga0501079_0004458
913 Ga0501079_0010091
914 Ga0501080_0001290
915 Ga0501080_0003892
916 Ga0501083_0000377
917 Ga0501083_0001575
918 Ga0501083_0010446
919 Ga0501044_0004457
920 Ga0501044_0006974
921 Ga0501044_0007457
922 Ga0501044_0049892
923 Ga0501044_0070758
924 Ga0501045_0038421
925 nmdc:mga0k408_54259_c1
926 nmdc:mga08y16_168161_c1
927 nmdc:mga08y16_2492_c1
928 nmdc:mga08y16_42132_c1
929 nmdc:mga0rr50_4022_c1
930 nmdc:mga0a205_107226_c1
931 Ga0495601_0003939
932 Ga0500643_006290
933 Ga0500651_0000097
934 Ga0500556_0000001
935 Ga0500556_0000839
936 Ga0500571_005809
937 Ga0500642_0000467
938 Ga0500655_000923
939 Ga0500658_0001247
940 Ga0500658_0001369
941 Ga0500559_0000263
942 Ga0500559_0000338
943 Ga0500559_0031652
944 Ga0500568_0000006
945 Ga0500568_0000026
946 Ga0500568_0000529
947 Ga0500568_0028048
948 Ga0500573_0003293
949 Ga0500573_0003818
950 Ga0500573_0022848
951 Ga0500573_0058005
952 Ga0500577_0010337
953 Ga0500616_0000021
954 Ga0500616_0000111
955 Ga0500616_0001006
956 Ga0500616_0010674
957 Ga0500645_009103
958 Ga0501084_0000015
959 Ga0501084_0004929
960 Ga0501082_0000686
961 Ga0501082_0094553
962 Ga0530510_0076261
963 2644083085
964 2644199172
965 2644337487
966 2644446324
967 2644468054
968 2644666100
969 2676488100
970 2687580559
971 2729906007
972 2844855606
973 2870623669
974 2884697310
975 2884995783
976 2895430915
977 2895452818
978 2899360366
979 2899372699
980 2928084203
981 2932433059
982 2935891446
983 2966924959
984 8056037404
985 8056064577
986 8057348839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

346

600

0.97

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

5

272

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e18-assembly1.cif.gz_B crystal structure of project ph0182 from pyrococcus horikoshii ot3 0.92 266 524
4izw-assembly1.cif.gz_A-2 the e41l mutant of the amidase from nesterenkonia sp. an1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine 0.9122 5 241
4izt-assembly1.cif.gz_A-2 the e41q mutant of the amidase from nesterenkonia sp. an1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine 0.9108 5 241
3fiu-assembly2.cif.gz_D structure of nmn synthetase from francisella tularensis 0.9108 266 524
4izs-assembly1.cif.gz_A the c145a mutant of the amidase from nesterenkonia sp. an1 in complex with butyramide 0.9107 5 241
ID Description Score Start End Superfamily
5khaB01 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9462 2 265 3.60.110.10
5khaB01 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9391 2 265 3.60.110.10
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9367 266 461 3.40.50.620
3n05B03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9307 479 553 1.10.10.1510
4f4hA01 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9265 5 265 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A534NNB0-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9967 269 402 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A3D2JLK1-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9962 300 406 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A4Q3J553-F1-model_v4 NAD+ synthase 0.9899 1 232 GO:0003952
GO:0004359
GO:0005737
GO:0009435
AF-A0A7V8D8R0-F1-model_v4 NAD+ synthase 0.9888 5 167 GO:0003952
GO:0004359
GO:0005737
GO:0009435
AF-A0A350AGR7-F1-model_v4 NAD+ synthase (EC 6.3.5.1) 0.9887 1 154 GO:0003952
GO:0004359
GO:0005737
GO:0009435

Map