F454444
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 493 | 291 | 986 | 559 |
Family's Representative Sequence
| Representative Sequence | 3300028573|Ga0265334_10000596|Ga0265334_100005961 |
| Length | 628 |
| Sequence | MSRLRLALAQVNPTLGDLPGNAELVLRWSGAAARAGADLVAFPEMVLTGYPVEDLALRSSFVDASRATTTKLAADLAGAGLGAMPVVLGYLDRVDPTSDAPGATRPGVPKGRPQNVAGVLHGGRVAARYAKHHLPNYGVFDEFRIFVPGSELTVVRTHGHDIALAICEDLWQDGGPVARTHVAGAGLLLVLNGSPYECGKGDVRRELVTRRAAEAGCTLAYVNLVGGQDDLVFDGDSIVVAADGTVLARAPQFEEHLLLVDLDLPDAVATPATGTGIARVHLNDRPGSGPGHPVAPTPAVVDSPVVAGNTGHDGGTGLGLDTSGGWSPATSAPGTVTPSLPLEAAVHRALVLGLSDYVRKNGFRSVVLGLSGGIDSALVASLAADAIGARNVVGVSLPSDYSSEHSRDDAADLAGRIGLDYRVVPIAPMVASFLAGVGAAGTTMSGVAEENLQSRVRGVILMGLANQEGHLTLTTGNKSELAVGYSTIYGDSVGGFAPLKDVPKTLVWRLAHWRNAEAERLGQVPPIPENSISKPPSAELRPDQTDQDTLPPYDLLDAVLEAYVGGALGRSELLADGFDQEVVDSVVTMVDRAEWKRRQSAPGPKISPIAFGRDRRLPITSRWREHES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 133 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 134 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 135 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 136 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 141 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 149 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 154 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 155 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 156 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 157 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 158 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 169 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 175 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 176 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 177 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 182 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 253 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 254 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 255 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 256 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 257 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 258 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 260 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 262 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 263 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 268 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 269 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 270 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 271 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 272 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 273 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 274 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 275 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 276 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 277 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 278 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 279 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 280 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 281 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 282 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 283 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 284 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 285 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 286 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 287 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 288 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 289 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 290 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 291 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.13 |
| Metatranscriptomes | 0 |
| Isolates | 4.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.69 |
| Nodule | 0 |
| Rhizoplane | 2.84 |
| Rhizosphere | 84.79 |
| Stem | 0 |
| Stem Tuber | 0.2 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265334_10000596 | 3300028573 | Bacteria | 18250 |
| 2 | JGI25153J46596_10000225 | 3300003215 | Bacteria | 48544 |
| 3 | Ga0065707_10085270 | 3300005295 | Bacteria | 6302 |
| 4 | Ga0070658_10000357 | 3300005327 | Bacteria | 39707 |
| 5 | Ga0070658_10000789 | 3300005327 | Bacteria | 27151 |
| 6 | Ga0070683_100004701 | 3300005329 | Bacteria | 11287 |
| 7 | Ga0070683_100162573 | 3300005329 | Bacteria | 2118 |
| 8 | Ga0070690_100045309 | 3300005330 | Bacteria | 2793 |
| 9 | Ga0068869_100037897 | 3300005334 | Bacteria | 3431 |
| 10 | Ga0068869_100081917 | 3300005334 | Bacteria | 2411 |
| 11 | Ga0068869_100097249 | 3300005334 | Bacteria | 2222 |
| 12 | Ga0070666_10018606 | 3300005335 | Bacteria | 4470 |
| 13 | Ga0070680_100048723 | 3300005336 | Bacteria | 3453 |
| 14 | Ga0070682_100031894 | 3300005337 | Bacteria | 3191 |
| 15 | Ga0070689_100015651 | 3300005340 | Bacteria | 5536 |
| 16 | Ga0070687_100003303 | 3300005343 | Bacteria | 6235 |
| 17 | Ga0070669_100023330 | 3300005353 | Bacteria | 4430 |
| 18 | Ga0070675_100001764 | 3300005354 | Bacteria | 15948 |
| 19 | Ga0070673_100003824 | 3300005364 | Bacteria | 9443 |
| 20 | Ga0070673_100055264 | 3300005364 | Bacteria | 3127 |
| 21 | Ga0070673_100113270 | 3300005364 | Bacteria | 2252 |
| 22 | Ga0070688_100013653 | 3300005365 | Bacteria | 4587 |
| 23 | Ga0070659_100000483 | 3300005366 | Bacteria | 29241 |
| 24 | Ga0070659_100057972 | 3300005366 | Bacteria | 3055 |
| 25 | Ga0070667_100083086 | 3300005367 | Bacteria | 2743 |
| 26 | Ga0070714_100010185 | 3300005435 | Bacteria | 7421 |
| 27 | Ga0070714_100067925 | 3300005435 | Bacteria | 3075 |
| 28 | Ga0070714_100088864 | 3300005435 | Bacteria | 2704 |
| 29 | Ga0070713_100011958 | 3300005436 | Bacteria | 6350 |
| 30 | Ga0070701_10022210 | 3300005438 | Bacteria | 3040 |
| 31 | Ga0070711_100080624 | 3300005439 | Bacteria | 2318 |
| 32 | Ga0070705_100018003 | 3300005440 | Bacteria | 3695 |
| 33 | Ga0070708_100006644 | 3300005445 | Bacteria | 9209 |
| 34 | Ga0070708_100161547 | 3300005445 | Unclassified | 2088 |
| 35 | Ga0070678_100009280 | 3300005456 | Bacteria | 5950 |
| 36 | Ga0070678_100081313 | 3300005456 | Bacteria | 2456 |
| 37 | Ga0070681_10005446 | 3300005458 | Bacteria | 12298 |
| 38 | Ga0068867_100047354 | 3300005459 | Bacteria | 3160 |
| 39 | Ga0068867_100088094 | 3300005459 | Bacteria | 2352 |
| 40 | Ga0068867_100135801 | 3300005459 | Bacteria | 1917 |
| 41 | Ga0070706_100006686 | 3300005467 | Bacteria | 10883 |
| 42 | Ga0070706_100061436 | 3300005467 | Bacteria | 3470 |
| 43 | Ga0070706_100069598 | 3300005467 | Bacteria | 3254 |
| 44 | Ga0070707_100034390 | 3300005468 | Bacteria | 4834 |
| 45 | Ga0070707_100063906 | 3300005468 | Bacteria | 3532 |
| 46 | Ga0070698_100001665 | 3300005471 | Bacteria | 24789 |
| 47 | Ga0070698_100001869 | 3300005471 | Bacteria | 23455 |
| 48 | Ga0070699_100013812 | 3300005518 | Bacteria | 6948 |
| 49 | Ga0070679_100004318 | 3300005530 | Bacteria | 13121 |
| 50 | Ga0070679_100054636 | 3300005530 | Bacteria | 3977 |
| 51 | Ga0070679_100081688 | 3300005530 | Bacteria | 3221 |
| 52 | Ga0070679_100102644 | 3300005530 | Bacteria | 2846 |
| 53 | Ga0070684_100007349 | 3300005535 | Bacteria | 8562 |
| 54 | Ga0070684_100032613 | 3300005535 | Bacteria | 4440 |
| 55 | Ga0070684_100070450 | 3300005535 | Bacteria | 3077 |
| 56 | Ga0070697_100005830 | 3300005536 | Bacteria | 9503 |
| 57 | Ga0070697_100008581 | 3300005536 | Bacteria | 7979 |
| 58 | Ga0070697_100009662 | 3300005536 | Bacteria | 7534 |
| 59 | Ga0070697_100042959 | 3300005536 | Unclassified | 3659 |
| 60 | Ga0070697_100062016 | 3300005536 | Bacteria | 3050 |
| 61 | Ga0068853_100002218 | 3300005539 | Bacteria | 14522 |
| 62 | Ga0070672_100023889 | 3300005543 | Bacteria | 4509 |
| 63 | Ga0070693_100003096 | 3300005547 | Bacteria | 7717 |
| 64 | Ga0070665_100032083 | 3300005548 | Bacteria | 5287 |
| 65 | Ga0070665_100117932 | 3300005548 | Bacteria | 2657 |
| 66 | Ga0070704_100007439 | 3300005549 | Bacteria | 6524 |
| 67 | Ga0068855_100073554 | 3300005563 | Bacteria | 3970 |
| 68 | Ga0068855_100136679 | 3300005563 | Bacteria | 2796 |
| 69 | Ga0068857_100118270 | 3300005577 | Bacteria | 2385 |
| 70 | Ga0068856_100027855 | 3300005614 | Bacteria | 5513 |
| 71 | Ga0068856_100122327 | 3300005614 | Bacteria | 2604 |
| 72 | Ga0070702_100001832 | 3300005615 | Bacteria | 8851 |
| 73 | Ga0068852_100002337 | 3300005616 | Bacteria | 13047 |
| 74 | Ga0068859_100007398 | 3300005617 | Bacteria | 11144 |
| 75 | Ga0068859_100024157 | 3300005617 | Bacteria | 6098 |
| 76 | Ga0068864_100045875 | 3300005618 | Bacteria | 3749 |
| 77 | Ga0068851_10008627 | 3300005834 | Bacteria | 4718 |
| 78 | Ga0068858_100013791 | 3300005842 | Bacteria | 7629 |
| 79 | Ga0068862_100108151 | 3300005844 | Bacteria | 2438 |
| 80 | Ga0081539_10000012 | 3300005985 | Bacteria | 440369 |
| 81 | Ga0081539_10001508 | 3300005985 | Bacteria | 39310 |
| 82 | Ga0075362_10016879 | 3300006177 | Bacteria | 2999 |
| 83 | Ga0075369_10011933 | 3300006186 | Bacteria | 3424 |
| 84 | Ga0075366_10005344 | 3300006195 | Bacteria | 6961 |
| 85 | Ga0075366_10066563 | 3300006195 | Bacteria | 2143 |
| 86 | Ga0097621_100005842 | 3300006237 | Bacteria | 8692 |
| 87 | Ga0075428_100024948 | 3300006844 | Bacteria | 6614 |
| 88 | Ga0075428_100053520 | 3300006844 | Bacteria | 4423 |
| 89 | Ga0075433_10000992 | 3300006852 | Bacteria | 20158 |
| 90 | Ga0075434_100159643 | 3300006871 | Bacteria | 2274 |
| 91 | Ga0075429_100018549 | 3300006880 | Bacteria | 6025 |
| 92 | Ga0097620_100007398 | 3300006931 | Bacteria | 11144 |
| 93 | Ga0097620_100024157 | 3300006931 | Bacteria | 6098 |
| 94 | Ga0075435_100001241 | 3300007076 | Bacteria | 16334 |
| 95 | Ga0105240_10007962 | 3300009093 | Bacteria | 15283 |
| 96 | Ga0105240_10035296 | 3300009093 | Bacteria | 6445 |
| 97 | Ga0105240_10056904 | 3300009093 | Bacteria | 4890 |
| 98 | Ga0105240_10076977 | 3300009093 | Bacteria | 4111 |
| 99 | Ga0111539_10000243 | 3300009094 | Bacteria | 65363 |
| 100 | Ga0111539_10040994 | 3300009094 | Bacteria | 5570 |
| 101 | Ga0105245_10047652 | 3300009098 | Bacteria | 3831 |
| 102 | Ga0114129_10016032 | 3300009147 | Bacteria | 10658 |
| 103 | Ga0114129_10165222 | 3300009147 | Bacteria | 3021 |
| 104 | Ga0105242_10042015 | 3300009176 | Bacteria | 3690 |
| 105 | Ga0105242_10063485 | 3300009176 | Bacteria | 3041 |
| 106 | Ga0105242_10080049 | 3300009176 | Bacteria | 2730 |
| 107 | Ga0105248_10010088 | 3300009177 | Bacteria | 10401 |
| 108 | Ga0105248_10016821 | 3300009177 | Bacteria | 8050 |
| 109 | Ga0105237_10004995 | 3300009545 | Bacteria | 15109 |
| 110 | Ga0105237_10065181 | 3300009545 | Bacteria | 3639 |
| 111 | Ga0105238_10022262 | 3300009551 | Bacteria | 6461 |
| 112 | Ga0105238_10022332 | 3300009551 | Bacteria | 6450 |
| 113 | Ga0105249_10026316 | 3300009553 | Bacteria | 5241 |
| 114 | Ga0157371_10002818 | 3300013102 | Bacteria | 16277 |
| 115 | Ga0157370_10003304 | 3300013104 | Bacteria | 19007 |
| 116 | Ga0157370_10005450 | 3300013104 | Bacteria | 14271 |
| 117 | Ga0157369_10026000 | 3300013105 | Bacteria | 6495 |
| 118 | Ga0157369_10060139 | 3300013105 | Bacteria | 4097 |
| 119 | Ga0157374_10056262 | 3300013296 | Bacteria | 3672 |
| 120 | Ga0157374_10165952 | 3300013296 | Bacteria | 2152 |
| 121 | Ga0157378_10022212 | 3300013297 | Bacteria | 5584 |
| 122 | Ga0163162_10168759 | 3300013306 | Bacteria | 2313 |
| 123 | Ga0157372_10051795 | 3300013307 | Bacteria | 4569 |
| 124 | Ga0157372_10093588 | 3300013307 | Bacteria | 3420 |
| 125 | Ga0157375_10079172 | 3300013308 | Bacteria | 3321 |
| 126 | Ga0157380_10022936 | 3300014326 | Bacteria | 4707 |
| 127 | Ga0157380_10055699 | 3300014326 | Bacteria | 3141 |
| 128 | Ga0157379_10011406 | 3300014968 | Bacteria | 7755 |
| 129 | Ga0157379_10180124 | 3300014968 | Bacteria | 1909 |
| 130 | Ga0157376_10021105 | 3300014969 | Bacteria | 5054 |
| 131 | Ga0157376_10054088 | 3300014969 | Bacteria | 3345 |
| 132 | Ga0209758_1000648 | 3300025297 | Bacteria | 52785 |
| 133 | Ga0207656_10000744 | 3300025321 | Bacteria | 10651 |
| 134 | Ga0207682_10022161 | 3300025893 | Bacteria | 2502 |
| 135 | Ga0207647_10018482 | 3300025904 | Bacteria | 4710 |
| 136 | Ga0207645_10001425 | 3300025907 | Bacteria | 19566 |
| 137 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 138 | Ga0207705_10063706 | 3300025909 | Bacteria | 2664 |
| 139 | Ga0207684_10014822 | 3300025910 | Bacteria | 6710 |
| 140 | Ga0207654_10071005 | 3300025911 | Bacteria | 2069 |
| 141 | Ga0207695_10001125 | 3300025913 | Bacteria | 46438 |
| 142 | Ga0207695_10043291 | 3300025913 | Bacteria | 4799 |
| 143 | Ga0207695_10098458 | 3300025913 | Bacteria | 2923 |
| 144 | Ga0207671_10000434 | 3300025914 | Bacteria | 57541 |
| 145 | Ga0207663_10018910 | 3300025916 | Bacteria | 3869 |
| 146 | Ga0207660_10043551 | 3300025917 | Bacteria | 3155 |
| 147 | Ga0207660_10099754 | 3300025917 | Bacteria | 2167 |
| 148 | Ga0207652_10012603 | 3300025921 | Bacteria | 6834 |
| 149 | Ga0207652_10029084 | 3300025921 | Bacteria | 4616 |
| 150 | Ga0207652_10170968 | 3300025921 | Bacteria | 1950 |
| 151 | Ga0207646_10013426 | 3300025922 | Bacteria | 7835 |
| 152 | Ga0207646_10035429 | 3300025922 | Bacteria | 4508 |
| 153 | Ga0207646_10082135 | 3300025922 | Bacteria | 2881 |
| 154 | Ga0207681_10002551 | 3300025923 | Bacteria | 11562 |
| 155 | Ga0207694_10024440 | 3300025924 | Bacteria | 4589 |
| 156 | Ga0207694_10026893 | 3300025924 | Bacteria | 4380 |
| 157 | Ga0207694_10042261 | 3300025924 | Bacteria | 3516 |
| 158 | Ga0207659_10028331 | 3300025926 | Bacteria | 3805 |
| 159 | Ga0207687_10027788 | 3300025927 | Bacteria | 3798 |
| 160 | Ga0207687_10111918 | 3300025927 | Bacteria | 2028 |
| 161 | Ga0207700_10005978 | 3300025928 | Bacteria | 7323 |
| 162 | Ga0207664_10045468 | 3300025929 | Unclassified | 3443 |
| 163 | Ga0207644_10088190 | 3300025931 | Bacteria | 2307 |
| 164 | Ga0207690_10002958 | 3300025932 | Bacteria | 10230 |
| 165 | Ga0207686_10008156 | 3300025934 | Bacteria | 5649 |
| 166 | Ga0207670_10041220 | 3300025936 | Bacteria | 3035 |
| 167 | Ga0207670_10086022 | 3300025936 | Bacteria | 2211 |
| 168 | Ga0207669_10015684 | 3300025937 | Bacteria | 3829 |
| 169 | Ga0207704_10052735 | 3300025938 | Bacteria | 2467 |
| 170 | Ga0207665_10026347 | 3300025939 | Bacteria | 3838 |
| 171 | Ga0207691_10033531 | 3300025940 | Bacteria | 4780 |
| 172 | Ga0207691_10039823 | 3300025940 | Bacteria | 4347 |
| 173 | Ga0207691_10063768 | 3300025940 | Bacteria | 3341 |
| 174 | Ga0207691_10097359 | 3300025940 | Bacteria | 2630 |
| 175 | Ga0207691_10097675 | 3300025940 | Bacteria | 2625 |
| 176 | Ga0207711_10079687 | 3300025941 | Bacteria | 2859 |
| 177 | Ga0207689_10016249 | 3300025942 | Bacteria | 6304 |
| 178 | Ga0207661_10003972 | 3300025944 | Bacteria | 10332 |
| 179 | Ga0207661_10076632 | 3300025944 | Bacteria | 2747 |
| 180 | Ga0207667_10035672 | 3300025949 | Bacteria | 5335 |
| 181 | Ga0207667_10038853 | 3300025949 | Bacteria | 5077 |
| 182 | Ga0207667_10055121 | 3300025949 | Bacteria | 4180 |
| 183 | Ga0207667_10080782 | 3300025949 | Bacteria | 3368 |
| 184 | Ga0207667_10141104 | 3300025949 | Bacteria | 2481 |
| 185 | Ga0207651_10006716 | 3300025960 | Bacteria | 6061 |
| 186 | Ga0207651_10020588 | 3300025960 | Bacteria | 3986 |
| 187 | Ga0207658_10031889 | 3300025986 | Bacteria | 3747 |
| 188 | Ga0207658_10040648 | 3300025986 | Bacteria | 3363 |
| 189 | Ga0207658_10050766 | 3300025986 | Bacteria | 3054 |
| 190 | Ga0207658_10067292 | 3300025986 | Bacteria | 2698 |
| 191 | Ga0207658_10071549 | 3300025986 | Bacteria | 2626 |
| 192 | Ga0207703_10081723 | 3300026035 | Bacteria | 2694 |
| 193 | Ga0207639_10014203 | 3300026041 | Bacteria | 5592 |
| 194 | Ga0207708_10000638 | 3300026075 | Bacteria | 26946 |
| 195 | Ga0207702_10058336 | 3300026078 | Bacteria | 3285 |
| 196 | Ga0207702_10096197 | 3300026078 | Bacteria | 2604 |
| 197 | Ga0207648_10012237 | 3300026089 | Bacteria | 8035 |
| 198 | Ga0207648_10052014 | 3300026089 | Bacteria | 3581 |
| 199 | Ga0207648_10115964 | 3300026089 | Bacteria | 2354 |
| 200 | Ga0207674_10070068 | 3300026116 | Bacteria | 3525 |
| 201 | Ga0207675_100042824 | 3300026118 | Bacteria | 4227 |
| 202 | Ga0207698_10000922 | 3300026142 | Bacteria | 17101 |
| 203 | Ga0209966_1000029 | 3300027695 | Bacteria | 65037 |
| 204 | Ga0207428_10026226 | 3300027907 | Bacteria | 4865 |
| 205 | Ga0207428_10029847 | 3300027907 | Bacteria | 4512 |
| 206 | Ga0207428_10048273 | 3300027907 | Bacteria | 3416 |
| 207 | Ga0265337_1000283 | 3300028556 | Bacteria | 27564 |
| 208 | Ga0265337_1003931 | 3300028556 | Bacteria | 6294 |
| 209 | Ga0265334_10024751 | 3300028573 | Bacteria | 2433 |
| 210 | Ga0265318_10000027 | 3300028577 | Bacteria | 153682 |
| 211 | Ga0265318_10009282 | 3300028577 | Bacteria | 4334 |
| 212 | Ga0265318_10014762 | 3300028577 | Bacteria | 3270 |
| 213 | Ga0265323_10000029 | 3300028653 | Bacteria | 78081 |
| 214 | Ga0265323_10008491 | 3300028653 | Bacteria | 4235 |
| 215 | Ga0265322_10003013 | 3300028654 | Bacteria | 5131 |
| 216 | Ga0307515_10000178 | 3300028794 | Bacteria | 157107 |
| 217 | Ga0307515_10134175 | 3300028794 | Bacteria | 2704 |
| 218 | Ga0265338_10000082 | 3300028800 | Bacteria | 176343 |
| 219 | Ga0265338_10048804 | 3300028800 | Bacteria | 3846 |
| 220 | Ga0265324_10006726 | 3300029957 | Bacteria | 4748 |
| 221 | Ga0265324_10007679 | 3300029957 | Bacteria | 4342 |
| 222 | Ga0316176_1055304 | 3300030732 | Bacteria | 3412 |
| 223 | Ga0314311_1045146 | 3300030733 | Bacteria | 3226 |
| 224 | Ga0316183_1061765 | 3300030742 | Bacteria | 6218 |
| 225 | Ga0316182_1110573 | 3300030745 | Bacteria | 5911 |
| 226 | Ga0265330_10000126 | 3300031235 | Bacteria | 62021 |
| 227 | Ga0265332_10000649 | 3300031238 | Bacteria | 22574 |
| 228 | Ga0265332_10034208 | 3300031238 | Bacteria | 2210 |
| 229 | Ga0265328_10002739 | 3300031239 | Bacteria | 7884 |
| 230 | Ga0265328_10005349 | 3300031239 | Bacteria | 5503 |
| 231 | Ga0265328_10017802 | 3300031239 | Bacteria | 2749 |
| 232 | Ga0265320_10000018 | 3300031240 | Bacteria | 183411 |
| 233 | Ga0265320_10001050 | 3300031240 | Bacteria | 20519 |
| 234 | Ga0265320_10005779 | 3300031240 | Bacteria | 7884 |
| 235 | Ga0265320_10007432 | 3300031240 | Bacteria | 6798 |
| 236 | Ga0265325_10003776 | 3300031241 | Bacteria | 9774 |
| 237 | Ga0265329_10002760 | 3300031242 | Bacteria | 7859 |
| 238 | Ga0265340_10000697 | 3300031247 | Bacteria | 18924 |
| 239 | Ga0265340_10040048 | 3300031247 | Bacteria | 2309 |
| 240 | Ga0265339_10002232 | 3300031249 | Bacteria | 14034 |
| 241 | Ga0265339_10019885 | 3300031249 | Bacteria | 3930 |
| 242 | Ga0265331_10000046 | 3300031250 | Bacteria | 183360 |
| 243 | Ga0265331_10000686 | 3300031250 | Bacteria | 29053 |
| 244 | Ga0265316_10001572 | 3300031344 | Bacteria | 24411 |
| 245 | Ga0265316_10002028 | 3300031344 | Bacteria | 21327 |
| 246 | Ga0265316_10005603 | 3300031344 | Bacteria | 12165 |
| 247 | Ga0265316_10049948 | 3300031344 | Bacteria | 3293 |
| 248 | Ga0307513_10000449 | 3300031456 | Bacteria | 59327 |
| 249 | Ga0265313_10000337 | 3300031595 | Bacteria | 50974 |
| 250 | Ga0265313_10000489 | 3300031595 | Bacteria | 41771 |
| 251 | Ga0265313_10012149 | 3300031595 | Bacteria | 5293 |
| 252 | Ga0265313_10013848 | 3300031595 | Bacteria | 4806 |
| 253 | Ga0307514_10016754 | 3300031649 | Bacteria | 6036 |
| 254 | Ga0316579_10000017 | 3300031691 | Bacteria | 39268 |
| 255 | Ga0316579_10005565 | 3300031691 | Bacteria | 5094 |
| 256 | Ga0265314_10000283 | 3300031711 | Bacteria | 73858 |
| 257 | Ga0265314_10001000 | 3300031711 | Bacteria | 33137 |
| 258 | Ga0265314_10012054 | 3300031711 | Bacteria | 7086 |
| 259 | Ga0265314_10044503 | 3300031711 | Bacteria | 3147 |
| 260 | Ga0265342_10000064 | 3300031712 | Bacteria | 113079 |
| 261 | Ga0265342_10001601 | 3300031712 | Bacteria | 20888 |
| 262 | Ga0265342_10003468 | 3300031712 | Bacteria | 12916 |
| 263 | Ga0265342_10005207 | 3300031712 | Bacteria | 9988 |
| 264 | Ga0265342_10006385 | 3300031712 | Bacteria | 8784 |
| 265 | Ga0316576_10002696 | 3300031727 | Bacteria | 10158 |
| 266 | Ga0316576_10007069 | 3300031727 | Bacteria | 7031 |
| 267 | Ga0316576_10011800 | 3300031727 | Bacteria | 5744 |
| 268 | Ga0316576_10022461 | 3300031727 | Bacteria | 4382 |
| 269 | Ga0316578_10025446 | 3300031728 | Bacteria | 3328 |
| 270 | Ga0316578_10031222 | 3300031728 | Bacteria | 3034 |
| 271 | Ga0316577_10006470 | 3300031733 | Bacteria | 6189 |
| 272 | Ga0316583_10005352 | 3300032133 | Bacteria | 4604 |
| 273 | Ga0316585_10000680 | 3300032137 | Bacteria | 8456 |
| 274 | Ga0316580_10003042 | 3300032139 | Bacteria | 4719 |
| 275 | Ga0373950_0000001 | 3300034818 | Bacteria | 1001987 |
| 276 | Ga0373950_0000038 | 3300034818 | Bacteria | 117886 |
| 277 | Ga0373954_0008345 | 3300035118 | Bacteria | 4543 |
| 278 | Ga0373954_0010646 | 3300035118 | Bacteria | 4063 |
| 279 | Ga0373957_0002871 | 3300035120 | Bacteria | 4985 |
| 280 | Ga0373955_0005731 | 3300035172 | Bacteria | 5596 |
| 281 | Ga0373955_0012718 | 3300035172 | Bacteria | 4053 |
| 282 | Ga0316574_0006611 | 3300035398 | Bacteria | 6282 |
| 283 | Ga0373924_0007323 | 3300035410 | Bacteria | 3981 |
| 284 | Ga0373931_0009090 | 3300035691 | Bacteria | 4740 |
| 285 | Ga0373935_0026616 | 3300035692 | Bacteria | 3572 |
| 286 | Ga0373933_0000365 | 3300035724 | Bacteria | 28941 |
| 287 | Ga0373933_0029639 | 3300035724 | Bacteria | 3166 |
| 288 | Ga0373937_0001210 | 3300036401 | Bacteria | 21731 |
| 289 | Ga0373937_0013602 | 3300036401 | Bacteria | 7170 |
| 290 | Ga0316582_0011628 | 3300036647 | Bacteria | 4874 |
| 291 | Ga0316584_0010778 | 3300036712 | Bacteria | 6400 |
| 292 | Ga0316584_0011763 | 3300036712 | Bacteria | 6158 |
| 293 | Ga0395899_0001405 | 3300037312 | Bacteria | 20644 |
| 294 | Ga0395900_0031793 | 3300037418 | Bacteria | 5425 |
| 295 | Ga0316581_0001268 | 3300037588 | Bacteria | 5594 |
| 296 | Ga0395901_0014681 | 3300038443 | Bacteria | 7960 |
| 297 | Ga0395901_0263711 | 3300038443 | Archaea | 1793 |
| 298 | Ga0436365_0843402 | 3300039437 | Bacteria | 4055 |
| 299 | Ga0451833_0148586 | 3300041491 | Bacteria | 8132 |
| 300 | Ga0451577_0000012 | 3300042876 | Bacteria | 575467 |
| 301 | Ga0451577_0005693 | 3300042876 | Bacteria | 12643 |
| 302 | Ga0451577_0016841 | 3300042876 | Bacteria | 6761 |
| 303 | Ga0451577_0167007 | 3300042876 | Bacteria | 1983 |
| 304 | Ga0453683_0000044 | 3300044673 | Bacteria | 211182 |
| 305 | Ga0466961_0031728 | 3300044693 | Bacteria | 3397 |
| 306 | Ga0466963_0003887 | 3300044694 | Bacteria | 8627 |
| 307 | Ga0453684_0000015 | 3300044712 | Bacteria | 969198 |
| 308 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 309 | Ga0453684_0007857 | 3300044712 | Bacteria | 19409 |
| 310 | Ga0453684_0260845 | 3300044712 | Bacteria | 1985 |
| 311 | Ga0466971_0005222 | 3300044719 | Bacteria | 5624 |
| 312 | Ga0466960_0009831 | 3300044901 | Bacteria | 3955 |
| 313 | Ga0466959_0008001 | 3300045049 | Bacteria | 7449 |
| 314 | Ga0466959_0031302 | 3300045049 | Bacteria | 3937 |
| 315 | Ga0451576_0003961 | 3300045051 | Bacteria | 19724 |
| 316 | Ga0451576_0013495 | 3300045051 | Bacteria | 9139 |
| 317 | Ga0451576_0027293 | 3300045051 | Bacteria | 6134 |
| 318 | Ga0451576_0086136 | 3300045051 | Bacteria | 3268 |
| 319 | Ga0451576_0208927 | 3300045051 | Bacteria | 2039 |
| 320 | Ga0495592_0085454 | 3300046454 | Bacteria | 2274 |
| 321 | Ga0495638_0056565 | 3300046460 | Bacteria | 2434 |
| 322 | Ga0495664_0016331 | 3300046477 | Bacteria | 4226 |
| 323 | Ga0495664_0071591 | 3300046477 | Bacteria | 2071 |
| 324 | Ga0495628_0014426 | 3300046516 | Bacteria | 6623 |
| 325 | Ga0495628_0071563 | 3300046516 | Bacteria | 2703 |
| 326 | Ga0495630_0018283 | 3300046517 | Bacteria | 5147 |
| 327 | Ga0495652_0085878 | 3300046529 | Bacteria | 2585 |
| 328 | Ga0495586_0009173 | 3300046535 | Bacteria | 5265 |
| 329 | Ga0495587_0092140 | 3300046536 | Bacteria | 1750 |
| 330 | Ga0495621_0005110 | 3300046539 | Bacteria | 3747 |
| 331 | Ga0495645_0015389 | 3300046543 | Bacteria | 5440 |
| 332 | Ga0495656_0001240 | 3300046615 | Bacteria | 8306 |
| 333 | Ga0495634_0026201 | 3300046642 | Bacteria | 4070 |
| 334 | Ga0495625_0013531 | 3300046660 | Bacteria | 6548 |
| 335 | Ga0495657_0012271 | 3300046675 | Bacteria | 6366 |
| 336 | Ga0495623_0029983 | 3300046679 | Bacteria | 3501 |
| 337 | Ga0495658_0037639 | 3300046683 | Bacteria | 2675 |
| 338 | Ga0495613_0048451 | 3300046689 | Bacteria | 3138 |
| 339 | Ga0495613_0066882 | 3300046689 | Bacteria | 2623 |
| 340 | Ga0495604_0009131 | 3300047317 | Bacteria | 7846 |
| 341 | Ga0495676_0008211 | 3300047321 | Bacteria | 9575 |
| 342 | Ga0495680_0015881 | 3300047322 | Bacteria | 6481 |
| 343 | Ga0495675_0022781 | 3300047444 | Bacteria | 3993 |
| 344 | Ga0495675_0089412 | 3300047444 | Bacteria | 1933 |
| 345 | Ga0496101_0021099 | 3300048904 | Bacteria | 4471 |
| 346 | Ga0496104_0013892 | 3300048907 | Bacteria | 7265 |
| 347 | Ga0496105_0061780 | 3300048908 | Bacteria | 3092 |
| 348 | Ga0496108_0111059 | 3300048911 | Bacteria | 2344 |
| 349 | Ga0496109_0030485 | 3300048912 | Bacteria | 4834 |
| 350 | Ga0496109_0071283 | 3300048912 | Bacteria | 3190 |
| 351 | Ga0496110_0005431 | 3300048913 | Bacteria | 9995 |
| 352 | Ga0496110_0053735 | 3300048913 | Bacteria | 3542 |
| 353 | Ga0496111_0059411 | 3300048914 | Bacteria | 2770 |
| 354 | Ga0496112_0037684 | 3300048915 | Bacteria | 4719 |
| 355 | Ga0496113_0019269 | 3300048916 | Bacteria | 4770 |
| 356 | Ga0496114_0009521 | 3300048917 | Bacteria | 7707 |
| 357 | Ga0496114_0097117 | 3300048917 | Bacteria | 2509 |
| 358 | Ga0496114_0103399 | 3300048917 | Bacteria | 2435 |
| 359 | Ga0496117_0000128 | 3300048920 | Bacteria | 166039 |
| 360 | Ga0496117_0097153 | 3300048920 | Bacteria | 1877 |
| 361 | Ga0496118_0053225 | 3300048921 | Bacteria | 3080 |
| 362 | Ga0496119_0000750 | 3300048922 | Bacteria | 43609 |
| 363 | Ga0496121_0000076 | 3300048924 | Bacteria | 239775 |
| 364 | Ga0496126_0048537 | 3300048929 | Bacteria | 3878 |
| 365 | Ga0496126_0085848 | 3300048929 | Bacteria | 2774 |
| 366 | Ga0501031_0000401 | 3300049568 | Bacteria | 25310 |
| 367 | Ga0501031_0052538 | 3300049568 | Bacteria | 2655 |
| 368 | Ga0501032_0000011 | 3300049569 | Bacteria | 198158 |
| 369 | Ga0501032_0033997 | 3300049569 | Bacteria | 3491 |
| 370 | Ga0501033_0000307 | 3300049570 | Bacteria | 46225 |
| 371 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 372 | Ga0501034_0000363 | 3300049571 | Bacteria | 77256 |
| 373 | Ga0501034_0001788 | 3300049571 | Bacteria | 27444 |
| 374 | Ga0501034_0018488 | 3300049571 | Bacteria | 7146 |
| 375 | Ga0501034_0179601 | 3300049571 | Bacteria | 2082 |
| 376 | Ga0501036_0001930 | 3300049572 | Bacteria | 16093 |
| 377 | Ga0501036_0104267 | 3300049572 | Bacteria | 2398 |
| 378 | Ga0501037_0010958 | 3300049573 | Bacteria | 6666 |
| 379 | Ga0501037_0076640 | 3300049573 | Bacteria | 2427 |
| 380 | Ga0501038_0000175 | 3300049574 | Bacteria | 54771 |
| 381 | Ga0501039_0000034 | 3300049575 | Bacteria | 126569 |
| 382 | Ga0501039_0031530 | 3300049575 | Bacteria | 4087 |
| 383 | Ga0501043_0085465 | 3300049579 | Bacteria | 2479 |
| 384 | Ga0501043_0085924 | 3300049579 | Bacteria | 2472 |
| 385 | Ga0501046_0000885 | 3300049580 | Bacteria | 29144 |
| 386 | Ga0501046_0033848 | 3300049580 | Bacteria | 4127 |
| 387 | Ga0501046_0037484 | 3300049580 | Bacteria | 3895 |
| 388 | Ga0501047_0000018 | 3300049581 | Bacteria | 274180 |
| 389 | Ga0501047_0000078 | 3300049581 | Bacteria | 123338 |
| 390 | Ga0501047_0017163 | 3300049581 | Bacteria | 6927 |
| 391 | Ga0501047_0017264 | 3300049581 | Bacteria | 6910 |
| 392 | Ga0501047_0020157 | 3300049581 | Bacteria | 6401 |
| 393 | Ga0501047_0024445 | 3300049581 | Bacteria | 5797 |
| 394 | Ga0501048_0002434 | 3300049582 | Bacteria | 14206 |
| 395 | Ga0501048_0002532 | 3300049582 | Bacteria | 13981 |
| 396 | Ga0501067_0000011 | 3300049583 | Bacteria | 115694 |
| 397 | Ga0501067_0007634 | 3300049583 | Bacteria | 6012 |
| 398 | Ga0501069_0013897 | 3300049585 | Bacteria | 4298 |
| 399 | Ga0501070_0001279 | 3300049586 | Bacteria | 22589 |
| 400 | Ga0501070_0005279 | 3300049586 | Bacteria | 11020 |
| 401 | Ga0501070_0036130 | 3300049586 | Bacteria | 4126 |
| 402 | Ga0501070_0047016 | 3300049586 | Bacteria | 3589 |
| 403 | Ga0501071_0003808 | 3300049587 | Bacteria | 9483 |
| 404 | Ga0501072_0000111 | 3300049588 | Bacteria | 59988 |
| 405 | Ga0501072_0047325 | 3300049588 | Bacteria | 3387 |
| 406 | Ga0501073_0000075 | 3300049589 | Bacteria | 61808 |
| 407 | Ga0501073_0000153 | 3300049589 | Bacteria | 45756 |
| 408 | Ga0501073_0000882 | 3300049589 | Bacteria | 21503 |
| 409 | Ga0501073_0015760 | 3300049589 | Bacteria | 5478 |
| 410 | Ga0501073_0020191 | 3300049589 | Bacteria | 4804 |
| 411 | Ga0501074_0007135 | 3300049590 | Bacteria | 8074 |
| 412 | Ga0501074_0007942 | 3300049590 | Bacteria | 7686 |
| 413 | Ga0501074_0011220 | 3300049590 | Bacteria | 6510 |
| 414 | Ga0501075_0017689 | 3300049591 | Bacteria | 5148 |
| 415 | Ga0501075_0033347 | 3300049591 | Bacteria | 3831 |
| 416 | Ga0501076_0001663 | 3300049592 | Bacteria | 15028 |
| 417 | Ga0501076_0104069 | 3300049592 | Bacteria | 2290 |
| 418 | Ga0501079_0002652 | 3300049741 | Bacteria | 13011 |
| 419 | Ga0501079_0004458 | 3300049741 | Bacteria | 10379 |
| 420 | Ga0501079_0010091 | 3300049741 | Bacteria | 7171 |
| 421 | Ga0501080_0001290 | 3300049742 | Bacteria | 20839 |
| 422 | Ga0501080_0003892 | 3300049742 | Bacteria | 13215 |
| 423 | Ga0501083_0000377 | 3300049744 | Bacteria | 28170 |
| 424 | Ga0501083_0001575 | 3300049744 | Bacteria | 15583 |
| 425 | Ga0501083_0010446 | 3300049744 | Bacteria | 6536 |
| 426 | Ga0501044_0004457 | 3300049823 | Bacteria | 15664 |
| 427 | Ga0501044_0006974 | 3300049823 | Bacteria | 12429 |
| 428 | Ga0501044_0007457 | 3300049823 | Bacteria | 12030 |
| 429 | Ga0501044_0049892 | 3300049823 | Bacteria | 4320 |
| 430 | Ga0501044_0070758 | 3300049823 | Bacteria | 3548 |
| 431 | Ga0501045_0038421 | 3300049824 | Bacteria | 3481 |
| 432 | nmdc:mga0k408_54259_c1 | 3300050493 | Bacteria | 2323 |
| 433 | nmdc:mga08y16_168161_c1 | 3300050511 | Bacteria | 2278 |
| 434 | nmdc:mga08y16_2492_c1 | 3300050511 | Bacteria | 18920 |
| 435 | nmdc:mga08y16_42132_c1 | 3300050511 | Bacteria | 4782 |
| 436 | nmdc:mga0rr50_4022_c1 | 3300050513 | Bacteria | 8580 |
| 437 | nmdc:mga0a205_107226_c1 | 3300050515 | Bacteria | 2691 |
| 438 | Ga0495601_0003939 | 3300053077 | Bacteria | 8547 |
| 439 | Ga0500643_006290 | 3300053087 | Bacteria | 4982 |
| 440 | Ga0500651_0000097 | 3300053093 | Bacteria | 53876 |
| 441 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 442 | Ga0500556_0000839 | 3300053104 | Bacteria | 17653 |
| 443 | Ga0500571_005809 | 3300053110 | Bacteria | 6629 |
| 444 | Ga0500642_0000467 | 3300053130 | Bacteria | 12599 |
| 445 | Ga0500655_000923 | 3300053133 | Bacteria | 5685 |
| 446 | Ga0500658_0001247 | 3300053134 | Bacteria | 10330 |
| 447 | Ga0500658_0001369 | 3300053134 | Bacteria | 9857 |
| 448 | Ga0500559_0000263 | 3300053136 | Bacteria | 41139 |
| 449 | Ga0500559_0000338 | 3300053136 | Bacteria | 35118 |
| 450 | Ga0500559_0031652 | 3300053136 | Bacteria | 2269 |
| 451 | Ga0500568_0000006 | 3300053139 | Bacteria | 522235 |
| 452 | Ga0500568_0000026 | 3300053139 | Bacteria | 165582 |
| 453 | Ga0500568_0000529 | 3300053139 | Bacteria | 28228 |
| 454 | Ga0500568_0028048 | 3300053139 | Bacteria | 2349 |
| 455 | Ga0500573_0003293 | 3300053140 | Bacteria | 8333 |
| 456 | Ga0500573_0003818 | 3300053140 | Bacteria | 7857 |
| 457 | Ga0500573_0022848 | 3300053140 | Bacteria | 3590 |
| 458 | Ga0500573_0058005 | 3300053140 | Bacteria | 2220 |
| 459 | Ga0500577_0010337 | 3300053142 | Bacteria | 2745 |
| 460 | Ga0500616_0000021 | 3300053153 | Bacteria | 484527 |
| 461 | Ga0500616_0000111 | 3300053153 | Bacteria | 152320 |
| 462 | Ga0500616_0001006 | 3300053153 | Bacteria | 30305 |
| 463 | Ga0500616_0010674 | 3300053153 | Bacteria | 5481 |
| 464 | Ga0500645_009103 | 3300053730 | Bacteria | 3350 |
| 465 | Ga0501084_0000015 | 3300054114 | Bacteria | 159007 |
| 466 | Ga0501084_0004929 | 3300054114 | Bacteria | 10908 |
| 467 | Ga0501082_0000686 | 3300060353 | Bacteria | 29836 |
| 468 | Ga0501082_0094553 | 3300060353 | Bacteria | 2583 |
| 469 | Ga0530510_0076261 | 3300061734 | Bacteria | 2436 |
| 470 | 2644083085 | 2643221613 | Bacteria | 4622396 |
| 471 | 2644199172 | 2643221635 | Bacteria | 2632343 |
| 472 | 2644337487 | 2643221660 | Bacteria | 4208257 |
| 473 | 2644446324 | 2643221679 | Bacteria | 3839507 |
| 474 | 2644468054 | 2643221683 | Bacteria | 5749203 |
| 475 | 2644666100 | 2643221721 | Bacteria | 4486924 |
| 476 | 2676488100 | 2675903060 | Bacteria | 10051191 |
| 477 | 2687580559 | 2687453129 | Bacteria | 4387428 |
| 478 | 2729906007 | 2728369276 | Bacteria | 5610032 |
| 479 | 2844855606 | 2844852863 | Bacteria | 3849151 |
| 480 | 2870623669 | 2870622029 | Bacteria | 3643329 |
| 481 | 2884697310 | 2884693830 | Bacteria | 11273186 |
| 482 | 2884995783 | 2884994152 | Bacteria | 4492978 |
| 483 | 2895430915 | 2895427314 | Bacteria | 13147766 |
| 484 | 2895452818 | 2895442618 | Bacteria | 11027144 |
| 485 | 2899360366 | 2899359706 | Bacteria | 10940472 |
| 486 | 2899372699 | 2899370129 | Bacteria | 6781179 |
| 487 | 2928084203 | 2928084124 | Bacteria | 7159212 |
| 488 | 2932433059 | 2932431166 | Bacteria | 4215299 |
| 489 | 2935891446 | 2935890801 | Bacteria | 4593001 |
| 490 | 2966924959 | 2966924647 | Bacteria | 3268643 |
| 491 | 8056037404 | 8056037122 | Bacteria | 3854319 |
| 492 | 8056064577 | 8056060235 | Bacteria | 7259403 |
| 493 | 8057348839 | 8057345674 | Bacteria | 4160394 |
| 494 | Ga0265334_10000596 | |||
| 495 | JGI25153J46596_10000225 | |||
| 496 | Ga0065707_10085270 | |||
| 497 | Ga0070658_10000357 | |||
| 498 | Ga0070658_10000789 | |||
| 499 | Ga0070683_100004701 | |||
| 500 | Ga0070683_100162573 | |||
| 501 | Ga0070690_100045309 | |||
| 502 | Ga0068869_100037897 | |||
| 503 | Ga0068869_100081917 | |||
| 504 | Ga0068869_100097249 | |||
| 505 | Ga0070666_10018606 | |||
| 506 | Ga0070680_100048723 | |||
| 507 | Ga0070682_100031894 | |||
| 508 | Ga0070689_100015651 | |||
| 509 | Ga0070687_100003303 | |||
| 510 | Ga0070669_100023330 | |||
| 511 | Ga0070675_100001764 | |||
| 512 | Ga0070673_100003824 | |||
| 513 | Ga0070673_100055264 | |||
| 514 | Ga0070673_100113270 | |||
| 515 | Ga0070688_100013653 | |||
| 516 | Ga0070659_100000483 | |||
| 517 | Ga0070659_100057972 | |||
| 518 | Ga0070667_100083086 | |||
| 519 | Ga0070714_100010185 | |||
| 520 | Ga0070714_100067925 | |||
| 521 | Ga0070714_100088864 | |||
| 522 | Ga0070713_100011958 | |||
| 523 | Ga0070701_10022210 | |||
| 524 | Ga0070711_100080624 | |||
| 525 | Ga0070705_100018003 | |||
| 526 | Ga0070708_100006644 | |||
| 527 | Ga0070708_100161547 | |||
| 528 | Ga0070678_100009280 | |||
| 529 | Ga0070678_100081313 | |||
| 530 | Ga0070681_10005446 | |||
| 531 | Ga0068867_100047354 | |||
| 532 | Ga0068867_100088094 | |||
| 533 | Ga0068867_100135801 | |||
| 534 | Ga0070706_100006686 | |||
| 535 | Ga0070706_100061436 | |||
| 536 | Ga0070706_100069598 | |||
| 537 | Ga0070707_100034390 | |||
| 538 | Ga0070707_100063906 | |||
| 539 | Ga0070698_100001665 | |||
| 540 | Ga0070698_100001869 | |||
| 541 | Ga0070699_100013812 | |||
| 542 | Ga0070679_100004318 | |||
| 543 | Ga0070679_100054636 | |||
| 544 | Ga0070679_100081688 | |||
| 545 | Ga0070679_100102644 | |||
| 546 | Ga0070684_100007349 | |||
| 547 | Ga0070684_100032613 | |||
| 548 | Ga0070684_100070450 | |||
| 549 | Ga0070697_100005830 | |||
| 550 | Ga0070697_100008581 | |||
| 551 | Ga0070697_100009662 | |||
| 552 | Ga0070697_100042959 | |||
| 553 | Ga0070697_100062016 | |||
| 554 | Ga0068853_100002218 | |||
| 555 | Ga0070672_100023889 | |||
| 556 | Ga0070693_100003096 | |||
| 557 | Ga0070665_100032083 | |||
| 558 | Ga0070665_100117932 | |||
| 559 | Ga0070704_100007439 | |||
| 560 | Ga0068855_100073554 | |||
| 561 | Ga0068855_100136679 | |||
| 562 | Ga0068857_100118270 | |||
| 563 | Ga0068856_100027855 | |||
| 564 | Ga0068856_100122327 | |||
| 565 | Ga0070702_100001832 | |||
| 566 | Ga0068852_100002337 | |||
| 567 | Ga0068859_100007398 | |||
| 568 | Ga0068859_100024157 | |||
| 569 | Ga0068864_100045875 | |||
| 570 | Ga0068851_10008627 | |||
| 571 | Ga0068858_100013791 | |||
| 572 | Ga0068862_100108151 | |||
| 573 | Ga0081539_10000012 | |||
| 574 | Ga0081539_10001508 | |||
| 575 | Ga0075362_10016879 | |||
| 576 | Ga0075369_10011933 | |||
| 577 | Ga0075366_10005344 | |||
| 578 | Ga0075366_10066563 | |||
| 579 | Ga0097621_100005842 | |||
| 580 | Ga0075428_100024948 | |||
| 581 | Ga0075428_100053520 | |||
| 582 | Ga0075433_10000992 | |||
| 583 | Ga0075434_100159643 | |||
| 584 | Ga0075429_100018549 | |||
| 585 | Ga0097620_100007398 | |||
| 586 | Ga0097620_100024157 | |||
| 587 | Ga0075435_100001241 | |||
| 588 | Ga0105240_10007962 | |||
| 589 | Ga0105240_10035296 | |||
| 590 | Ga0105240_10056904 | |||
| 591 | Ga0105240_10076977 | |||
| 592 | Ga0111539_10000243 | |||
| 593 | Ga0111539_10040994 | |||
| 594 | Ga0105245_10047652 | |||
| 595 | Ga0114129_10016032 | |||
| 596 | Ga0114129_10165222 | |||
| 597 | Ga0105242_10042015 | |||
| 598 | Ga0105242_10063485 | |||
| 599 | Ga0105242_10080049 | |||
| 600 | Ga0105248_10010088 | |||
| 601 | Ga0105248_10016821 | |||
| 602 | Ga0105237_10004995 | |||
| 603 | Ga0105237_10065181 | |||
| 604 | Ga0105238_10022262 | |||
| 605 | Ga0105238_10022332 | |||
| 606 | Ga0105249_10026316 | |||
| 607 | Ga0157371_10002818 | |||
| 608 | Ga0157370_10003304 | |||
| 609 | Ga0157370_10005450 | |||
| 610 | Ga0157369_10026000 | |||
| 611 | Ga0157369_10060139 | |||
| 612 | Ga0157374_10056262 | |||
| 613 | Ga0157374_10165952 | |||
| 614 | Ga0157378_10022212 | |||
| 615 | Ga0163162_10168759 | |||
| 616 | Ga0157372_10051795 | |||
| 617 | Ga0157372_10093588 | |||
| 618 | Ga0157375_10079172 | |||
| 619 | Ga0157380_10022936 | |||
| 620 | Ga0157380_10055699 | |||
| 621 | Ga0157379_10011406 | |||
| 622 | Ga0157379_10180124 | |||
| 623 | Ga0157376_10021105 | |||
| 624 | Ga0157376_10054088 | |||
| 625 | Ga0209758_1000648 | |||
| 626 | Ga0207656_10000744 | |||
| 627 | Ga0207682_10022161 | |||
| 628 | Ga0207647_10018482 | |||
| 629 | Ga0207645_10001425 | |||
| 630 | Ga0207705_10000006 | |||
| 631 | Ga0207705_10063706 | |||
| 632 | Ga0207684_10014822 | |||
| 633 | Ga0207654_10071005 | |||
| 634 | Ga0207695_10001125 | |||
| 635 | Ga0207695_10043291 | |||
| 636 | Ga0207695_10098458 | |||
| 637 | Ga0207671_10000434 | |||
| 638 | Ga0207663_10018910 | |||
| 639 | Ga0207660_10043551 | |||
| 640 | Ga0207660_10099754 | |||
| 641 | Ga0207652_10012603 | |||
| 642 | Ga0207652_10029084 | |||
| 643 | Ga0207652_10170968 | |||
| 644 | Ga0207646_10013426 | |||
| 645 | Ga0207646_10035429 | |||
| 646 | Ga0207646_10082135 | |||
| 647 | Ga0207681_10002551 | |||
| 648 | Ga0207694_10024440 | |||
| 649 | Ga0207694_10026893 | |||
| 650 | Ga0207694_10042261 | |||
| 651 | Ga0207659_10028331 | |||
| 652 | Ga0207687_10027788 | |||
| 653 | Ga0207687_10111918 | |||
| 654 | Ga0207700_10005978 | |||
| 655 | Ga0207664_10045468 | |||
| 656 | Ga0207644_10088190 | |||
| 657 | Ga0207690_10002958 | |||
| 658 | Ga0207686_10008156 | |||
| 659 | Ga0207670_10041220 | |||
| 660 | Ga0207670_10086022 | |||
| 661 | Ga0207669_10015684 | |||
| 662 | Ga0207704_10052735 | |||
| 663 | Ga0207665_10026347 | |||
| 664 | Ga0207691_10033531 | |||
| 665 | Ga0207691_10039823 | |||
| 666 | Ga0207691_10063768 | |||
| 667 | Ga0207691_10097359 | |||
| 668 | Ga0207691_10097675 | |||
| 669 | Ga0207711_10079687 | |||
| 670 | Ga0207689_10016249 | |||
| 671 | Ga0207661_10003972 | |||
| 672 | Ga0207661_10076632 | |||
| 673 | Ga0207667_10035672 | |||
| 674 | Ga0207667_10038853 | |||
| 675 | Ga0207667_10055121 | |||
| 676 | Ga0207667_10080782 | |||
| 677 | Ga0207667_10141104 | |||
| 678 | Ga0207651_10006716 | |||
| 679 | Ga0207651_10020588 | |||
| 680 | Ga0207658_10031889 | |||
| 681 | Ga0207658_10040648 | |||
| 682 | Ga0207658_10050766 | |||
| 683 | Ga0207658_10067292 | |||
| 684 | Ga0207658_10071549 | |||
| 685 | Ga0207703_10081723 | |||
| 686 | Ga0207639_10014203 | |||
| 687 | Ga0207708_10000638 | |||
| 688 | Ga0207702_10058336 | |||
| 689 | Ga0207702_10096197 | |||
| 690 | Ga0207648_10012237 | |||
| 691 | Ga0207648_10052014 | |||
| 692 | Ga0207648_10115964 | |||
| 693 | Ga0207674_10070068 | |||
| 694 | Ga0207675_100042824 | |||
| 695 | Ga0207698_10000922 | |||
| 696 | Ga0209966_1000029 | |||
| 697 | Ga0207428_10026226 | |||
| 698 | Ga0207428_10029847 | |||
| 699 | Ga0207428_10048273 | |||
| 700 | Ga0265337_1000283 | |||
| 701 | Ga0265337_1003931 | |||
| 702 | Ga0265334_10024751 | |||
| 703 | Ga0265318_10000027 | |||
| 704 | Ga0265318_10009282 | |||
| 705 | Ga0265318_10014762 | |||
| 706 | Ga0265323_10000029 | |||
| 707 | Ga0265323_10008491 | |||
| 708 | Ga0265322_10003013 | |||
| 709 | Ga0307515_10000178 | |||
| 710 | Ga0307515_10134175 | |||
| 711 | Ga0265338_10000082 | |||
| 712 | Ga0265338_10048804 | |||
| 713 | Ga0265324_10006726 | |||
| 714 | Ga0265324_10007679 | |||
| 715 | Ga0316176_1055304 | |||
| 716 | Ga0314311_1045146 | |||
| 717 | Ga0316183_1061765 | |||
| 718 | Ga0316182_1110573 | |||
| 719 | Ga0265330_10000126 | |||
| 720 | Ga0265332_10000649 | |||
| 721 | Ga0265332_10034208 | |||
| 722 | Ga0265328_10002739 | |||
| 723 | Ga0265328_10005349 | |||
| 724 | Ga0265328_10017802 | |||
| 725 | Ga0265320_10000018 | |||
| 726 | Ga0265320_10001050 | |||
| 727 | Ga0265320_10005779 | |||
| 728 | Ga0265320_10007432 | |||
| 729 | Ga0265325_10003776 | |||
| 730 | Ga0265329_10002760 | |||
| 731 | Ga0265340_10000697 | |||
| 732 | Ga0265340_10040048 | |||
| 733 | Ga0265339_10002232 | |||
| 734 | Ga0265339_10019885 | |||
| 735 | Ga0265331_10000046 | |||
| 736 | Ga0265331_10000686 | |||
| 737 | Ga0265316_10001572 | |||
| 738 | Ga0265316_10002028 | |||
| 739 | Ga0265316_10005603 | |||
| 740 | Ga0265316_10049948 | |||
| 741 | Ga0307513_10000449 | |||
| 742 | Ga0265313_10000337 | |||
| 743 | Ga0265313_10000489 | |||
| 744 | Ga0265313_10012149 | |||
| 745 | Ga0265313_10013848 | |||
| 746 | Ga0307514_10016754 | |||
| 747 | Ga0316579_10000017 | |||
| 748 | Ga0316579_10005565 | |||
| 749 | Ga0265314_10000283 | |||
| 750 | Ga0265314_10001000 | |||
| 751 | Ga0265314_10012054 | |||
| 752 | Ga0265314_10044503 | |||
| 753 | Ga0265342_10000064 | |||
| 754 | Ga0265342_10001601 | |||
| 755 | Ga0265342_10003468 | |||
| 756 | Ga0265342_10005207 | |||
| 757 | Ga0265342_10006385 | |||
| 758 | Ga0316576_10002696 | |||
| 759 | Ga0316576_10007069 | |||
| 760 | Ga0316576_10011800 | |||
| 761 | Ga0316576_10022461 | |||
| 762 | Ga0316578_10025446 | |||
| 763 | Ga0316578_10031222 | |||
| 764 | Ga0316577_10006470 | |||
| 765 | Ga0316583_10005352 | |||
| 766 | Ga0316585_10000680 | |||
| 767 | Ga0316580_10003042 | |||
| 768 | Ga0373950_0000001 | |||
| 769 | Ga0373950_0000038 | |||
| 770 | Ga0373954_0008345 | |||
| 771 | Ga0373954_0010646 | |||
| 772 | Ga0373957_0002871 | |||
| 773 | Ga0373955_0005731 | |||
| 774 | Ga0373955_0012718 | |||
| 775 | Ga0316574_0006611 | |||
| 776 | Ga0373924_0007323 | |||
| 777 | Ga0373931_0009090 | |||
| 778 | Ga0373935_0026616 | |||
| 779 | Ga0373933_0000365 | |||
| 780 | Ga0373933_0029639 | |||
| 781 | Ga0373937_0001210 | |||
| 782 | Ga0373937_0013602 | |||
| 783 | Ga0316582_0011628 | |||
| 784 | Ga0316584_0010778 | |||
| 785 | Ga0316584_0011763 | |||
| 786 | Ga0395899_0001405 | |||
| 787 | Ga0395900_0031793 | |||
| 788 | Ga0316581_0001268 | |||
| 789 | Ga0395901_0014681 | |||
| 790 | Ga0395901_0263711 | |||
| 791 | Ga0436365_0843402 | |||
| 792 | Ga0451833_0148586 | |||
| 793 | Ga0451577_0000012 | |||
| 794 | Ga0451577_0005693 | |||
| 795 | Ga0451577_0016841 | |||
| 796 | Ga0451577_0167007 | |||
| 797 | Ga0453683_0000044 | |||
| 798 | Ga0466961_0031728 | |||
| 799 | Ga0466963_0003887 | |||
| 800 | Ga0453684_0000015 | |||
| 801 | Ga0453684_0000020 | |||
| 802 | Ga0453684_0007857 | |||
| 803 | Ga0453684_0260845 | |||
| 804 | Ga0466971_0005222 | |||
| 805 | Ga0466960_0009831 | |||
| 806 | Ga0466959_0008001 | |||
| 807 | Ga0466959_0031302 | |||
| 808 | Ga0451576_0003961 | |||
| 809 | Ga0451576_0013495 | |||
| 810 | Ga0451576_0027293 | |||
| 811 | Ga0451576_0086136 | |||
| 812 | Ga0451576_0208927 | |||
| 813 | Ga0495592_0085454 | |||
| 814 | Ga0495638_0056565 | |||
| 815 | Ga0495664_0016331 | |||
| 816 | Ga0495664_0071591 | |||
| 817 | Ga0495628_0014426 | |||
| 818 | Ga0495628_0071563 | |||
| 819 | Ga0495630_0018283 | |||
| 820 | Ga0495652_0085878 | |||
| 821 | Ga0495586_0009173 | |||
| 822 | Ga0495587_0092140 | |||
| 823 | Ga0495621_0005110 | |||
| 824 | Ga0495645_0015389 | |||
| 825 | Ga0495656_0001240 | |||
| 826 | Ga0495634_0026201 | |||
| 827 | Ga0495625_0013531 | |||
| 828 | Ga0495657_0012271 | |||
| 829 | Ga0495623_0029983 | |||
| 830 | Ga0495658_0037639 | |||
| 831 | Ga0495613_0048451 | |||
| 832 | Ga0495613_0066882 | |||
| 833 | Ga0495604_0009131 | |||
| 834 | Ga0495676_0008211 | |||
| 835 | Ga0495680_0015881 | |||
| 836 | Ga0495675_0022781 | |||
| 837 | Ga0495675_0089412 | |||
| 838 | Ga0496101_0021099 | |||
| 839 | Ga0496104_0013892 | |||
| 840 | Ga0496105_0061780 | |||
| 841 | Ga0496108_0111059 | |||
| 842 | Ga0496109_0030485 | |||
| 843 | Ga0496109_0071283 | |||
| 844 | Ga0496110_0005431 | |||
| 845 | Ga0496110_0053735 | |||
| 846 | Ga0496111_0059411 | |||
| 847 | Ga0496112_0037684 | |||
| 848 | Ga0496113_0019269 | |||
| 849 | Ga0496114_0009521 | |||
| 850 | Ga0496114_0097117 | |||
| 851 | Ga0496114_0103399 | |||
| 852 | Ga0496117_0000128 | |||
| 853 | Ga0496117_0097153 | |||
| 854 | Ga0496118_0053225 | |||
| 855 | Ga0496119_0000750 | |||
| 856 | Ga0496121_0000076 | |||
| 857 | Ga0496126_0048537 | |||
| 858 | Ga0496126_0085848 | |||
| 859 | Ga0501031_0000401 | |||
| 860 | Ga0501031_0052538 | |||
| 861 | Ga0501032_0000011 | |||
| 862 | Ga0501032_0033997 | |||
| 863 | Ga0501033_0000307 | |||
| 864 | Ga0501034_0000001 | |||
| 865 | Ga0501034_0000363 | |||
| 866 | Ga0501034_0001788 | |||
| 867 | Ga0501034_0018488 | |||
| 868 | Ga0501034_0179601 | |||
| 869 | Ga0501036_0001930 | |||
| 870 | Ga0501036_0104267 | |||
| 871 | Ga0501037_0010958 | |||
| 872 | Ga0501037_0076640 | |||
| 873 | Ga0501038_0000175 | |||
| 874 | Ga0501039_0000034 | |||
| 875 | Ga0501039_0031530 | |||
| 876 | Ga0501043_0085465 | |||
| 877 | Ga0501043_0085924 | |||
| 878 | Ga0501046_0000885 | |||
| 879 | Ga0501046_0033848 | |||
| 880 | Ga0501046_0037484 | |||
| 881 | Ga0501047_0000018 | |||
| 882 | Ga0501047_0000078 | |||
| 883 | Ga0501047_0017163 | |||
| 884 | Ga0501047_0017264 | |||
| 885 | Ga0501047_0020157 | |||
| 886 | Ga0501047_0024445 | |||
| 887 | Ga0501048_0002434 | |||
| 888 | Ga0501048_0002532 | |||
| 889 | Ga0501067_0000011 | |||
| 890 | Ga0501067_0007634 | |||
| 891 | Ga0501069_0013897 | |||
| 892 | Ga0501070_0001279 | |||
| 893 | Ga0501070_0005279 | |||
| 894 | Ga0501070_0036130 | |||
| 895 | Ga0501070_0047016 | |||
| 896 | Ga0501071_0003808 | |||
| 897 | Ga0501072_0000111 | |||
| 898 | Ga0501072_0047325 | |||
| 899 | Ga0501073_0000075 | |||
| 900 | Ga0501073_0000153 | |||
| 901 | Ga0501073_0000882 | |||
| 902 | Ga0501073_0015760 | |||
| 903 | Ga0501073_0020191 | |||
| 904 | Ga0501074_0007135 | |||
| 905 | Ga0501074_0007942 | |||
| 906 | Ga0501074_0011220 | |||
| 907 | Ga0501075_0017689 | |||
| 908 | Ga0501075_0033347 | |||
| 909 | Ga0501076_0001663 | |||
| 910 | Ga0501076_0104069 | |||
| 911 | Ga0501079_0002652 | |||
| 912 | Ga0501079_0004458 | |||
| 913 | Ga0501079_0010091 | |||
| 914 | Ga0501080_0001290 | |||
| 915 | Ga0501080_0003892 | |||
| 916 | Ga0501083_0000377 | |||
| 917 | Ga0501083_0001575 | |||
| 918 | Ga0501083_0010446 | |||
| 919 | Ga0501044_0004457 | |||
| 920 | Ga0501044_0006974 | |||
| 921 | Ga0501044_0007457 | |||
| 922 | Ga0501044_0049892 | |||
| 923 | Ga0501044_0070758 | |||
| 924 | Ga0501045_0038421 | |||
| 925 | nmdc:mga0k408_54259_c1 | |||
| 926 | nmdc:mga08y16_168161_c1 | |||
| 927 | nmdc:mga08y16_2492_c1 | |||
| 928 | nmdc:mga08y16_42132_c1 | |||
| 929 | nmdc:mga0rr50_4022_c1 | |||
| 930 | nmdc:mga0a205_107226_c1 | |||
| 931 | Ga0495601_0003939 | |||
| 932 | Ga0500643_006290 | |||
| 933 | Ga0500651_0000097 | |||
| 934 | Ga0500556_0000001 | |||
| 935 | Ga0500556_0000839 | |||
| 936 | Ga0500571_005809 | |||
| 937 | Ga0500642_0000467 | |||
| 938 | Ga0500655_000923 | |||
| 939 | Ga0500658_0001247 | |||
| 940 | Ga0500658_0001369 | |||
| 941 | Ga0500559_0000263 | |||
| 942 | Ga0500559_0000338 | |||
| 943 | Ga0500559_0031652 | |||
| 944 | Ga0500568_0000006 | |||
| 945 | Ga0500568_0000026 | |||
| 946 | Ga0500568_0000529 | |||
| 947 | Ga0500568_0028048 | |||
| 948 | Ga0500573_0003293 | |||
| 949 | Ga0500573_0003818 | |||
| 950 | Ga0500573_0022848 | |||
| 951 | Ga0500573_0058005 | |||
| 952 | Ga0500577_0010337 | |||
| 953 | Ga0500616_0000021 | |||
| 954 | Ga0500616_0000111 | |||
| 955 | Ga0500616_0001006 | |||
| 956 | Ga0500616_0010674 | |||
| 957 | Ga0500645_009103 | |||
| 958 | Ga0501084_0000015 | |||
| 959 | Ga0501084_0004929 | |||
| 960 | Ga0501082_0000686 | |||
| 961 | Ga0501082_0094553 | |||
| 962 | Ga0530510_0076261 | |||
| 963 | 2644083085 | |||
| 964 | 2644199172 | |||
| 965 | 2644337487 | |||
| 966 | 2644446324 | |||
| 967 | 2644468054 | |||
| 968 | 2644666100 | |||
| 969 | 2676488100 | |||
| 970 | 2687580559 | |||
| 971 | 2729906007 | |||
| 972 | 2844855606 | |||
| 973 | 2870623669 | |||
| 974 | 2884697310 | |||
| 975 | 2884995783 | |||
| 976 | 2895430915 | |||
| 977 | 2895452818 | |||
| 978 | 2899360366 | |||
| 979 | 2899372699 | |||
| 980 | 2928084203 | |||
| 981 | 2932433059 | |||
| 982 | 2935891446 | |||
| 983 | 2966924959 | |||
| 984 | 8056037404 | |||
| 985 | 8056064577 | |||
| 986 | 8057348839 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e18-assembly1.cif.gz_B | crystal structure of project ph0182 from pyrococcus horikoshii ot3 | 0.92 | 266 | 524 |
| 4izw-assembly1.cif.gz_A-2 | the e41l mutant of the amidase from nesterenkonia sp. an1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine | 0.9122 | 5 | 241 |
| 4izt-assembly1.cif.gz_A-2 | the e41q mutant of the amidase from nesterenkonia sp. an1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine | 0.9108 | 5 | 241 |
| 3fiu-assembly2.cif.gz_D | structure of nmn synthetase from francisella tularensis | 0.9108 | 266 | 524 |
| 4izs-assembly1.cif.gz_A | the c145a mutant of the amidase from nesterenkonia sp. an1 in complex with butyramide | 0.9107 | 5 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5khaB01 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9462 | 2 | 265 | 3.60.110.10 |
| 5khaB01 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9391 | 2 | 265 | 3.60.110.10 |
| 3n05B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9367 | 266 | 461 | 3.40.50.620 |
| 3n05B03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9307 | 479 | 553 | 1.10.10.1510 |
| 4f4hA01 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9265 | 5 | 265 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534NNB0-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9967 | 269 | 402 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A3D2JLK1-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9962 | 300 | 406 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A4Q3J553-F1-model_v4 | NAD+ synthase | 0.9899 | 1 | 232 |
GO:0003952
GO:0004359 GO:0005737 GO:0009435 |
| AF-A0A7V8D8R0-F1-model_v4 | NAD+ synthase | 0.9888 | 5 | 167 |
GO:0003952
GO:0004359 GO:0005737 GO:0009435 |
| AF-A0A350AGR7-F1-model_v4 | NAD+ synthase (EC 6.3.5.1) | 0.9887 | 1 | 154 |
GO:0003952
GO:0004359 GO:0005737 GO:0009435 |