F454445

General Info

Members Datasets Scaffolds Average Seq Length
493 227 986 168

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10184159|Ga0307517_101841591
Length 167
Sequence MSSRSDPEKPVLVVTTGGTIDKVYFDALSSYQVGDSQIARLLALARVTHPFQVVELMRKDSLELDDGDRDRIYAAVAGAETPYIVVTHGTDTMTTTARRLAFPDKTVVLVGSLSPARFSESDAAFNLGMAFAAAQIAAAGVYITMNGTVFDADRVVKDRDRGAFISS

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
223 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
224 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
225 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
226 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
227 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.79
Nodule 0
Rhizoplane 2.64
Rhizosphere 67.14
Stem 0
Stem Tuber 0
Unclassified 5.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10184159 3300028786 Bacteria 1341
2 SwRhRL2b_contig_3113019 2162886007 Bacteria 39820
3 JGI24752J21851_1000372 3300001976 Bacteria 6242
4 JGI25150J39212_1000262 3300002774 Bacteria 28028
5 JGI25153J46596_10000093 3300003215 Bacteria 103442
6 rootH2_10234014 3300003320 Bacteria 2205
7 rootH2_10236659 3300003320 Bacteria 1125
8 Ga0055526_1001437 3300003771 Bacteria 16952
9 Ga0055530_10005741 3300003791 Bacteria 5770
10 Ga0055530_10014187 3300003791 Bacteria 2669
11 Ga0055540_1001103 3300003792 Bacteria 17034
12 Ga0065704_10000192 3300005289 Bacteria 216848
13 Ga0065704_10098235 3300005289 Bacteria 2361
14 Ga0065704_10102855 3300005289 Bacteria 2191
15 Ga0065707_10082002 3300005295 Bacteria 25413
16 Ga0065707_10082223 3300005295 Bacteria 18788
17 Ga0065707_10430649 3300005295 Bacteria 820
18 Ga0070683_100234550 3300005329 Bacteria 1744
19 Ga0070683_100502089 3300005329 Unclassified 1159
20 Ga0070670_100000027 3300005331 Bacteria 186072
21 Ga0070670_100510542 3300005331 Bacteria 1070
22 Ga0070666_10018802 3300005335 Bacteria 4450
23 Ga0070666_10370770 3300005335 Bacteria 1027
24 Ga0070680_100013453 3300005336 Bacteria 6374
25 Ga0070660_100505017 3300005339 Bacteria 1006
26 Ga0070669_100000398 3300005353 Bacteria 33332
27 Ga0070669_100257173 3300005353 Bacteria 1392
28 Ga0070671_100000248 3300005355 Bacteria 36385
29 Ga0070671_100000347 3300005355 Bacteria 31780
30 Ga0070671_100042746 3300005355 Unclassified 3767
31 Ga0070667_100000481 3300005367 Bacteria 40807
32 Ga0070667_100000638 3300005367 Bacteria 34017
33 Ga0070667_100004174 3300005367 Bacteria 12201
34 Ga0070667_100008754 3300005367 Bacteria 8388
35 Ga0070667_100495806 3300005367 Bacteria 1119
36 Ga0070663_100992383 3300005455 Bacteria 730
37 Ga0070684_100162241 3300005535 Bacteria 2028
38 Ga0070684_100773278 3300005535 Bacteria 897
39 Ga0068853_100470281 3300005539 Bacteria 1184
40 Ga0070672_101392712 3300005543 Bacteria 627
41 Ga0070665_100000896 3300005548 Bacteria 38200
42 Ga0070665_100001096 3300005548 Bacteria 33479
43 Ga0070665_100006455 3300005548 Bacteria 11934
44 Ga0070665_100008392 3300005548 Bacteria 10449
45 Ga0070665_100021887 3300005548 Bacteria 6430
46 Ga0070665_100048315 3300005548 Bacteria 4273
47 Ga0070665_100056289 3300005548 Bacteria 3943
48 Ga0070665_100090275 3300005548 Bacteria 3069
49 Ga0070665_100325615 3300005548 Bacteria 1541
50 Ga0068855_100000864 3300005563 Bacteria 37644
51 Ga0068855_100448707 3300005563 Bacteria 1408
52 Ga0070664_100459340 3300005564 Bacteria 1170
53 Ga0068859_100014419 3300005617 Bacteria 7931
54 Ga0068859_100035574 3300005617 Bacteria 4997
55 Ga0068859_100629623 3300005617 Bacteria 1165
56 Ga0068864_100000083 3300005618 Bacteria 100972
57 Ga0068861_100009847 3300005719 Bacteria 6611
58 Ga0068861_100981774 3300005719 Bacteria 805
59 Ga0068851_10204373 3300005834 Bacteria 1104
60 Ga0068863_100000025 3300005841 Bacteria 186072
61 Ga0068863_100002525 3300005841 Bacteria 18156
62 Ga0068863_100002872 3300005841 Bacteria 17057
63 Ga0068863_100003218 3300005841 Bacteria 16174
64 Ga0068863_100005026 3300005841 Bacteria 13038
65 Ga0068863_100005830 3300005841 Bacteria 12070
66 Ga0068858_100001526 3300005842 Bacteria 23774
67 Ga0068858_100009745 3300005842 Bacteria 9150
68 Ga0068858_100086339 3300005842 Bacteria 2919
69 Ga0068858_100116853 3300005842 Bacteria 2493
70 Ga0068858_100190279 3300005842 Unclassified 1939
71 Ga0068860_100001916 3300005843 Bacteria 22090
72 Ga0068860_100002810 3300005843 Bacteria 18107
73 Ga0068860_100009042 3300005843 Bacteria 9917
74 Ga0068860_100014439 3300005843 Bacteria 7737
75 Ga0068860_100025299 3300005843 Bacteria 5729
76 Ga0068860_100627888 3300005843 Bacteria 1081
77 Ga0068862_100000027 3300005844 Bacteria 186072
78 Ga0068862_100000742 3300005844 Bacteria 32711
79 Ga0068862_100012030 3300005844 Bacteria 7150
80 Ga0068862_100020605 3300005844 Bacteria 5508
81 Ga0068862_100321545 3300005844 Bacteria 1428
82 Ga0081539_10152223 3300005985 Bacteria 1111
83 Ga0075364_10303631 3300006051 Bacteria 1087
84 Ga0070712_100420746 3300006175 Unclassified 1107
85 Ga0075369_10145918 3300006186 Bacteria 1080
86 Ga0097621_100454073 3300006237 Bacteria 1155
87 Ga0075370_10018935 3300006353 Bacteria 3739
88 Ga0068871_100273202 3300006358 Bacteria 1477
89 Ga0068871_100512604 3300006358 Bacteria 1082
90 Ga0075430_100093060 3300006846 Bacteria 2520
91 Ga0075430_100095607 3300006846 Bacteria 2483
92 Ga0075430_100122663 3300006846 Bacteria 2167
93 Ga0075431_100000252 3300006847 Bacteria 40784
94 Ga0075431_100435183 3300006847 Bacteria 1309
95 Ga0075429_100529122 3300006880 Bacteria 1033
96 Ga0097620_100014419 3300006931 Bacteria 7931
97 Ga0097620_100035575 3300006931 Bacteria 4997
98 Ga0097620_100629665 3300006931 Bacteria 1165
99 Ga0099794_10012023 3300007265 Bacteria 3723
100 Ga0099795_10007517 3300007788 Bacteria 3047
101 Ga0105251_10000554 3300009011 Bacteria 35071
102 Ga0105250_10453880 3300009092 Unclassified 576
103 Ga0105240_10002346 3300009093 Bacteria 30550
104 Ga0105240_10031399 3300009093 Bacteria 6889
105 Ga0105240_10097870 3300009093 Bacteria 3574
106 Ga0105240_10176002 3300009093 Bacteria 2529
107 Ga0105240_10183870 3300009093 Bacteria 2464
108 Ga0105240_10224601 3300009093 Bacteria 2186
109 Ga0105240_10317691 3300009093 Bacteria 1776
110 Ga0105240_10491663 3300009093 Bacteria 1366
111 Ga0105240_12071557 3300009093 Bacteria 591
112 Ga0111539_10008631 3300009094 Bacteria 12942
113 Ga0111539_10201076 3300009094 Bacteria 2323
114 Ga0105247_10000498 3300009101 Bacteria 32456
115 Ga0105247_10006556 3300009101 Bacteria 7197
116 Ga0105247_10008816 3300009101 Bacteria 6148
117 Ga0114129_10050160 3300009147 Bacteria 5863
118 Ga0114129_10496842 3300009147 Bacteria 1594
119 Ga0105248_10000026 3300009177 Bacteria 257155
120 Ga0105248_10011174 3300009177 Bacteria 9902
121 Ga0105248_10260790 3300009177 Unclassified 1951
122 Ga0105248_12153010 3300009177 Bacteria 634
123 Ga0105237_10042538 3300009545 Bacteria 4580
124 Ga0105237_10158927 3300009545 Bacteria 2258
125 Ga0105237_10161823 3300009545 Bacteria 2237
126 Ga0105237_10192919 3300009545 Bacteria 2037
127 Ga0105237_10265445 3300009545 Bacteria 1720
128 Ga0105237_10302944 3300009545 Bacteria 1601
129 Ga0105238_10099137 3300009551 Unclassified 2897
130 Ga0105238_10426187 3300009551 Unclassified 1322
131 Ga0105238_10892862 3300009551 Bacteria 907
132 Ga0105249_10000123 3300009553 Bacteria 104747
133 Ga0105249_10000161 3300009553 Bacteria 80491
134 Ga0105249_10129586 3300009553 Bacteria 2406
135 Ga0105249_10239794 3300009553 Bacteria 1792
136 Ga0105249_10252024 3300009553 Bacteria 1751
137 Ga0099796_10003854 3300010159 Bacteria 3546
138 Ga0105239_10163924 3300010375 Bacteria 2485
139 Ga0105239_10192213 3300010375 Bacteria 2284
140 Ga0105239_10313492 3300010375 Bacteria 1768
141 Ga0105246_10012636 3300011119 Bacteria 5274
142 Ga0157374_10564174 3300013296 Bacteria 1147
143 Ga0157378_10007322 3300013297 Bacteria 9637
144 Ga0163162_10095269 3300013306 Unclassified 3063
145 Ga0163162_10255486 3300013306 Bacteria 1884
146 Ga0157372_10705573 3300013307 Bacteria 1174
147 Ga0157375_10345910 3300013308 Bacteria 1652
148 Ga0163163_10012544 3300014325 Bacteria 7728
149 Ga0163163_10124540 3300014325 Bacteria 2614
150 Ga0163163_10156368 3300014325 Bacteria 2324
151 Ga0163163_10339381 3300014325 Bacteria 1557
152 Ga0163163_10986687 3300014325 Bacteria 906
153 Ga0157380_10000630 3300014326 Bacteria 21676
154 Ga0157380_10023265 3300014326 Bacteria 4672
155 Ga0182008_10185468 3300014497 Bacteria 1054
156 Ga0157379_10048235 3300014968 Bacteria 3801
157 Ga0157379_10054672 3300014968 Bacteria 3567
158 Ga0157379_10751074 3300014968 Bacteria 918
159 Ga0157379_11206770 3300014968 Bacteria 728
160 Ga0157376_11428911 3300014969 Bacteria 724
161 Ga0157376_11936824 3300014969 Bacteria 627
162 Ga0207425_1000072 3300025245 Bacteria 115017
163 Ga0209129_1000734 3300025258 Bacteria 21070
164 Ga0209565_1000132 3300025263 Bacteria 104716
165 Ga0209565_1013103 3300025263 Bacteria 1951
166 Ga0209673_1010920 3300025273 Bacteria 3788
167 Ga0209676_1002301 3300025292 Bacteria 13913
168 Ga0209676_1021604 3300025292 Bacteria 2156
169 Ga0209025_1003336 3300025294 Bacteria 15403
170 Ga0209564_1001899 3300025295 Bacteria 18729
171 Ga0209564_1017232 3300025295 Bacteria 2827
172 Ga0209758_1000009 3300025297 Bacteria 1123483
173 Ga0209758_1023237 3300025297 Bacteria 2811
174 Ga0209050_1000005 3300025298 Bacteria 1557793
175 Ga0209050_1001236 3300025298 Bacteria 29567
176 Ga0209050_1022173 3300025298 Bacteria 2283
177 Ga0209050_1064966 3300025298 Bacteria 843
178 Ga0207426_1053154 3300025302 Bacteria 1197
179 Ga0209051_1000507 3300025303 Bacteria 49396
180 Ga0209257_1003743 3300025304 Bacteria 12596
181 Ga0209257_1003760 3300025304 Bacteria 12537
182 Ga0207713_1000615 3300025735 Bacteria 35051
183 Ga0207710_10000147 3300025900 Bacteria 80231
184 Ga0207710_10004596 3300025900 Bacteria 6002
185 Ga0207710_10027626 3300025900 Unclassified 2459
186 Ga0207680_10027523 3300025903 Unclassified 3167
187 Ga0207647_10038083 3300025904 Bacteria 3043
188 Ga0207695_10013476 3300025913 Bacteria 9748
189 Ga0207695_10014260 3300025913 Bacteria 9427
190 Ga0207695_10021679 3300025913 Bacteria 7323
191 Ga0207695_10124806 3300025913 Bacteria 2538
192 Ga0207695_10138467 3300025913 Bacteria 2385
193 Ga0207695_10179163 3300025913 Unclassified 2041
194 Ga0207695_10256336 3300025913 Bacteria 1648
195 Ga0207695_10904256 3300025913 Unclassified 762
196 Ga0207671_10049367 3300025914 Bacteria 3115
197 Ga0207671_10067425 3300025914 Unclassified 2665
198 Ga0207671_10121735 3300025914 Bacteria 1995
199 Ga0207671_10549286 3300025914 Bacteria 921
200 Ga0207660_10063810 3300025917 Bacteria 2657
201 Ga0207652_10119313 3300025921 Bacteria 2346
202 Ga0207681_10061596 3300025923 Bacteria 2580
203 Ga0207694_10448149 3300025924 Bacteria 1077
204 Ga0207694_10469346 3300025924 Bacteria 1052
205 Ga0207694_10489968 3300025924 Bacteria 1029
206 Ga0207650_10000056 3300025925 Bacteria 157972
207 Ga0207650_10043744 3300025925 Bacteria 3289
208 Ga0207700_10132368 3300025928 Bacteria 2038
209 Ga0207644_10000366 3300025931 Bacteria 29522
210 Ga0207644_10005160 3300025931 Bacteria 8530
211 Ga0207644_10024583 3300025931 Bacteria 4137
212 Ga0207644_10088705 3300025931 Bacteria 2301
213 Ga0207691_10767118 3300025940 Bacteria 811
214 Ga0207711_10000004 3300025941 Bacteria 870636
215 Ga0207711_10197111 3300025941 Bacteria 1837
216 Ga0207661_10073642 3300025944 Bacteria 2798
217 Ga0207661_10565260 3300025944 Bacteria 1042
218 Ga0207667_10008319 3300025949 Bacteria 12339
219 Ga0207712_10000059 3300025961 Bacteria 137849
220 Ga0207712_10008880 3300025961 Bacteria 6355
221 Ga0207712_10739346 3300025961 Bacteria 861
222 Ga0207658_10000251 3300025986 Bacteria 56192
223 Ga0207658_10000520 3300025986 Bacteria 35135
224 Ga0207658_10011171 3300025986 Bacteria 6116
225 Ga0207658_10033146 3300025986 Unclassified 3682
226 Ga0207658_10317153 3300025986 Bacteria 1348
227 Ga0207658_10516547 3300025986 Bacteria 1065
228 Ga0207703_10002044 3300026035 Bacteria 17813
229 Ga0207703_10003560 3300026035 Bacteria 13019
230 Ga0207703_10470954 3300026035 Bacteria 1176
231 Ga0207639_10031464 3300026041 Unclassified 3900
232 Ga0207639_10257499 3300026041 Bacteria 1525
233 Ga0207678_10033205 3300026067 Bacteria 4497
234 Ga0207702_10029583 3300026078 Bacteria 4559
235 Ga0207702_10998322 3300026078 Bacteria 830
236 Ga0207641_10000018 3300026088 Bacteria 298209
237 Ga0207641_10000117 3300026088 Bacteria 117830
238 Ga0207641_10003204 3300026088 Bacteria 14644
239 Ga0207641_10007380 3300026088 Bacteria 9150
240 Ga0207641_10013373 3300026088 Bacteria 6729
241 Ga0207641_10018142 3300026088 Bacteria 5766
242 Ga0207676_10000027 3300026095 Bacteria 245868
243 Ga0207428_10002282 3300027907 Bacteria 19247
244 Ga0207428_10004991 3300027907 Bacteria 12481
245 Ga0268266_10000159 3300028379 Bacteria 126969
246 Ga0268266_10003742 3300028379 Bacteria 14960
247 Ga0268266_10003965 3300028379 Bacteria 14360
248 Ga0268266_10013709 3300028379 Bacteria 6981
249 Ga0268266_10069357 3300028379 Bacteria 3054
250 Ga0268266_10130297 3300028379 Bacteria 2249
251 Ga0268265_10000042 3300028380 Bacteria 186086
252 Ga0268265_10000281 3300028380 Bacteria 57698
253 Ga0268264_10000183 3300028381 Bacteria 133803
254 Ga0268264_10000899 3300028381 Bacteria 31348
255 Ga0268264_10006973 3300028381 Bacteria 9485
256 Ga0268264_10463617 3300028381 Bacteria 1230
257 Ga0265334_10024393 3300028573 Bacteria 2452
258 Ga0307515_10042298 3300028794 Bacteria 7134
259 Ga0307511_10000028 3300030521 Bacteria 109328
260 Ga0265340_10030838 3300031247 Bacteria 2685
261 Ga0265331_10162312 3300031250 Bacteria 1012
262 Ga0307513_10735377 3300031456 Bacteria 692
263 Ga0307509_10000025 3300031507 Bacteria 235550
264 Ga0307509_10000581 3300031507 Bacteria 62548
265 Ga0307408_100040800 3300031548 Bacteria 3288
266 Ga0307408_100136637 3300031548 Bacteria 1919
267 Ga0307516_10621355 3300031730 Bacteria 735
268 Ga0307405_10114334 3300031731 Bacteria 1834
269 Ga0307405_10517011 3300031731 Bacteria 960
270 Ga0307413_10047059 3300031824 Bacteria 2569
271 Ga0307413_10487609 3300031824 Bacteria 987
272 Ga0307413_10636527 3300031824 Bacteria 878
273 Ga0307413_10973678 3300031824 Bacteria 725
274 Ga0307413_11669703 3300031824 Unclassified 567
275 Ga0307410_10045208 3300031852 Bacteria 2930
276 Ga0307410_10187568 3300031852 Bacteria 1570
277 Ga0307410_10252097 3300031852 Bacteria 1373
278 Ga0307410_10804058 3300031852 Bacteria 800
279 Ga0307406_10139285 3300031901 Bacteria 1715
280 Ga0307406_11059148 3300031901 Bacteria 698
281 Ga0307407_10024073 3300031903 Bacteria 3186
282 Ga0307407_10063829 3300031903 Bacteria 2162
283 Ga0307407_10922397 3300031903 Bacteria 671
284 Ga0307412_10521045 3300031911 Bacteria 993
285 Ga0307412_10637138 3300031911 Bacteria 907
286 Ga0307412_11200666 3300031911 Bacteria 679
287 Ga0307409_100148866 3300031995 Bacteria 2029
288 Ga0307409_100192094 3300031995 Bacteria 1818
289 Ga0307409_100227844 3300031995 Bacteria 1687
290 Ga0307409_100750970 3300031995 Bacteria 979
291 Ga0307409_100924345 3300031995 Unclassified 887
292 Ga0307409_100944784 3300031995 Bacteria 878
293 Ga0307416_100251525 3300032002 Bacteria 1720
294 Ga0307414_10003057 3300032004 Bacteria 8877
295 Ga0307414_10082697 3300032004 Bacteria 2355
296 Ga0307411_10026343 3300032005 Bacteria 3500
297 Ga0307411_10243169 3300032005 Unclassified 1410
298 Ga0307411_10416686 3300032005 Bacteria 1114
299 Ga0307411_10549224 3300032005 Bacteria 985
300 Ga0307415_100346244 3300032126 Bacteria 1249
301 Ga0307507_10344193 3300033179 Unclassified 881
302 Ga0307510_10000002 3300033180 Bacteria 801565
303 Ga0307510_10036411 3300033180 Bacteria 5475
304 Ga0307510_10138554 3300033180 Bacteria 2084
305 Ga0373936_0027513 3300035113 Bacteria 2230
306 Ga0373936_0029937 3300035113 Bacteria 2146
307 Ga0373927_0563081 3300035695 Bacteria 753
308 Ga0395898_0002405 3300037466 Bacteria 22206
309 Ga0436364_0876164 3300037853 Bacteria 1047
310 Ga0436365_0243813 3300039437 Unclassified 634
311 Ga0439448_0073186 3300042005 Bacteria 1143
312 Ga0439457_083103 3300042014 Bacteria 737
313 Ga0439464_0127146 3300042439 Bacteria 788
314 Ga0439440_0067146 3300042993 Bacteria 927
315 Ga0466969_0075889 3300044656 Bacteria 1610
316 Ga0466966_0841423 3300044684 Unclassified 553
317 Ga0466959_0117517 3300045049 Bacteria 1893
318 Ga0495627_000124 3300046453 Bacteria 93651
319 Ga0495638_0030893 3300046460 Bacteria 3444
320 Ga0495650_0000822 3300046471 Bacteria 37641
321 Ga0495596_0000054 3300046500 Bacteria 83068
322 Ga0495596_0004170 3300046500 Bacteria 7101
323 Ga0495607_0017649 3300046501 Bacteria 4574
324 Ga0495607_0355277 3300046501 Bacteria 675
325 Ga0495606_0180422 3300046507 Bacteria 1218
326 Ga0495610_0000022 3300046512 Bacteria 317107
327 Ga0495610_0000436 3300046512 Bacteria 42966
328 Ga0495610_0003492 3300046512 Bacteria 12223
329 Ga0495620_0032347 3300046515 Bacteria 2384
330 Ga0495632_0000533 3300046519 Bacteria 35890
331 Ga0495632_0062224 3300046519 Bacteria 1810
332 Ga0495632_0096853 3300046519 Bacteria 1393
333 Ga0495643_0000042 3300046522 Bacteria 229665
334 Ga0495643_0060903 3300046522 Bacteria 2002
335 Ga0495648_0061248 3300046524 Bacteria 2236
336 Ga0495654_0004203 3300046530 Bacteria 8614
337 Ga0495654_0021480 3300046530 Bacteria 3358
338 Ga0495609_0004316 3300046538 Bacteria 7815
339 Ga0495609_0098583 3300046538 Bacteria 1267
340 Ga0495633_0042387 3300046558 Bacteria 2162
341 Ga0495668_0053651 3300046616 Bacteria 2228
342 Ga0495611_0224411 3300046648 Bacteria 874
343 Ga0495625_0001187 3300046660 Bacteria 33373
344 Ga0495625_0052793 3300046660 Bacteria 2909
345 Ga0495625_0052958 3300046660 Bacteria 2905
346 Ga0495625_0316987 3300046660 Bacteria 994
347 Ga0495625_0400904 3300046660 Bacteria 857
348 Ga0495670_0196709 3300046691 Bacteria 1067
349 Ga0495683_0120563 3300047323 Bacteria 1245
350 Ga0495687_027325 3300047443 Unclassified 2672
351 Ga0495681_0000010 3300047470 Bacteria 203548
352 Ga0495686_0015271 3300047472 Bacteria 5251
353 Ga0495626_0000436 3300048091 Bacteria 42597
354 Ga0496102_0000529 3300048905 Bacteria 41357
355 Ga0496102_0001077 3300048905 Bacteria 25235
356 Ga0496102_0170154 3300048905 Bacteria 2051
357 Ga0496102_0182536 3300048905 Bacteria 1977
358 Ga0496102_0535873 3300048905 Bacteria 1093
359 Ga0496103_0000358 3300048906 Bacteria 41329
360 Ga0496103_0000687 3300048906 Bacteria 25235
361 Ga0496103_0026083 3300048906 Bacteria 3536
362 Ga0496105_0151623 3300048908 Bacteria 1905
363 Ga0496106_0296629 3300048909 Bacteria 1296
364 Ga0496109_0683540 3300048912 Bacteria 963
365 Ga0496112_0112731 3300048915 Bacteria 2690
366 Ga0496115_0084120 3300048918 Bacteria 2594
367 Ga0496116_0000017 3300048919 Bacteria 554463
368 Ga0496116_0000750 3300048919 Bacteria 41221
369 Ga0496116_0003018 3300048919 Bacteria 17047
370 Ga0496116_0020341 3300048919 Bacteria 5043
371 Ga0496116_0020691 3300048919 Bacteria 4988
372 Ga0496116_0153341 3300048919 Bacteria 1276
373 Ga0496117_0000054 3300048920 Bacteria 278013
374 Ga0496117_0001078 3300048920 Bacteria 41357
375 Ga0496117_0002210 3300048920 Bacteria 25235
376 Ga0496117_0002463 3300048920 Bacteria 23295
377 Ga0496117_0070846 3300048920 Bacteria 2339
378 Ga0496117_0140496 3300048920 Bacteria 1447
379 Ga0496117_0362562 3300048920 Bacteria 744
380 Ga0496118_0000195 3300048921 Bacteria 107276
381 Ga0496118_0000262 3300048921 Bacteria 92154
382 Ga0496118_0001124 3300048921 Bacteria 41357
383 Ga0496118_0002409 3300048921 Bacteria 25235
384 Ga0496118_0010987 3300048921 Bacteria 8896
385 Ga0496118_0042209 3300048921 Bacteria 3601
386 Ga0496118_0125979 3300048921 Bacteria 1658
387 Ga0496118_0134621 3300048921 Bacteria 1579
388 Ga0496118_0160320 3300048921 Bacteria 1392
389 Ga0496118_0260560 3300048921 Unclassified 979
390 Ga0496118_0512736 3300048921 Bacteria 593
391 Ga0496119_0002547 3300048922 Bacteria 19839
392 Ga0496119_0004480 3300048922 Bacteria 13889
393 Ga0496119_0016308 3300048922 Bacteria 5662
394 Ga0496119_0086806 3300048922 Bacteria 1787
395 Ga0496119_0090543 3300048922 Bacteria 1739
396 Ga0496119_0132838 3300048922 Bacteria 1354
397 Ga0496119_0358051 3300048922 Bacteria 705
398 Ga0496120_0000558 3300048923 Bacteria 56867
399 Ga0496120_0016551 3300048923 Bacteria 4818
400 Ga0496120_0331414 3300048923 Bacteria 688
401 Ga0496121_0000022 3300048924 Bacteria 472849
402 Ga0496121_0002831 3300048924 Bacteria 25625
403 Ga0496121_0003373 3300048924 Bacteria 22895
404 Ga0496121_0013117 3300048924 Bacteria 8943
405 Ga0496121_0015551 3300048924 Bacteria 7956
406 Ga0496121_0099223 3300048924 Bacteria 2251
407 Ga0496121_0747300 3300048924 Bacteria 582
408 Ga0496122_0026373 3300048925 Bacteria 5011
409 Ga0496123_0001455 3300048926 Bacteria 32951
410 Ga0496124_0001157 3300048927 Bacteria 41357
411 Ga0496124_0002299 3300048927 Bacteria 25235
412 Ga0496124_0007454 3300048927 Bacteria 11622
413 Ga0496124_0022383 3300048927 Bacteria 5794
414 Ga0496124_0022420 3300048927 Bacteria 5788
415 Ga0496124_0029380 3300048927 Bacteria 4899
416 Ga0496124_0206536 3300048927 Bacteria 1489
417 Ga0496125_0000289 3300048928 Bacteria 99535
418 Ga0496125_0003926 3300048928 Bacteria 17541
419 Ga0496125_0044522 3300048928 Bacteria 3752
420 Ga0496125_0058826 3300048928 Bacteria 3101
421 Ga0496125_0252224 3300048928 Bacteria 1112
422 Ga0496125_0348932 3300048928 Bacteria 885
423 Ga0496125_0425269 3300048928 Bacteria 768
424 Ga0496126_0007938 3300048929 Bacteria 11537
425 Ga0496126_0038029 3300048929 Bacteria 4480
426 Ga0496126_0043879 3300048929 Bacteria 4121
427 Ga0496126_0050188 3300048929 Bacteria 3804
428 Ga0496126_0105795 3300048929 Bacteria 2456
429 Ga0496126_0198598 3300048929 Bacteria 1695
430 Ga0496126_0320340 3300048929 Bacteria 1274
431 Ga0496126_0923759 3300048929 Bacteria 660
432 Ga0495682_0190505 3300049460 Unclassified 728
433 Ga0495682_0193952 3300049460 Bacteria 721
434 Ga0501037_0541795 3300049573 Unclassified 786
435 Ga0501038_0069936 3300049574 Bacteria 2981
436 Ga0501039_0999051 3300049575 Unclassified 650
437 Ga0501046_0125413 3300049580 Bacteria 1951
438 Ga0501046_1004023 3300049580 Bacteria 579
439 Ga0501047_0176820 3300049581 Bacteria 2002
440 Ga0501047_0207476 3300049581 Bacteria 1819
441 Ga0501047_0246750 3300049581 Bacteria 1635
442 Ga0501067_0215225 3300049583 Bacteria 1070
443 Ga0501044_0436618 3300049823 Bacteria 1218
444 nmdc:mga03683_41_c1 3300050489 Bacteria 60927
445 nmdc:mga03683_6020_c1 3300050489 Bacteria 4132
446 nmdc:mga00v17_160240_c1 3300050491 Bacteria 1448
447 nmdc:mga00v17_278110_c1 3300050491 Bacteria 1087
448 nmdc:mga0k408_6801_c1 3300050493 Bacteria 6098
449 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
450 nmdc:mga05p37_23502_c1 3300050507 Bacteria 7479
451 nmdc:mga09592_145_c1 3300050508 Bacteria 47800
452 nmdc:mga09592_487304_c1 3300050508 Bacteria 1062
453 nmdc:mga0qj67_284255_c1 3300050509 Bacteria 1341
454 nmdc:mga0qj67_56338_c1 3300050509 Bacteria 3115
455 nmdc:mga06r32_389424_c1 3300050510 Bacteria 1376
456 nmdc:mga06r32_40_c1 3300050510 Bacteria 79168
457 nmdc:mga08y16_148_c1 3300050511 Bacteria 60964
458 nmdc:mga08y16_3044_c1 3300050511 Bacteria 17317
459 Ga0500643_000121 3300053087 Bacteria 81461
460 Ga0500643_000203 3300053087 Bacteria 56433
461 Ga0500643_000250 3300053087 Bacteria 49518
462 Ga0500646_0253555 3300053090 Bacteria 620
463 Ga0500583_0122134 3300053092 Bacteria 1289
464 Ga0500556_0237020 3300053104 Bacteria 719
465 Ga0500592_000791 3300053116 Bacteria 5200
466 Ga0500594_0004104 3300053118 Bacteria 3208
467 Ga0500595_001296 3300053119 Bacteria 13597
468 Ga0500607_000188 3300053121 Bacteria 55367
469 Ga0500618_000768 3300053125 Bacteria 18139
470 Ga0500618_078255 3300053125 Bacteria 742
471 Ga0500652_206735 3300053131 Bacteria 794
472 Ga0500559_0152841 3300053136 Bacteria 1084
473 Ga0500559_0246012 3300053136 Bacteria 843
474 Ga0500559_0252195 3300053136 Unclassified 832
475 Ga0500564_270193 3300053138 Bacteria 665
476 Ga0500568_0061295 3300053139 Bacteria 1455
477 Ga0500588_0010348 3300053146 Bacteria 2249
478 Ga0500588_0242877 3300053146 Unclassified 675
479 Ga0500590_000691 3300053148 Bacteria 12204
480 Ga0500604_0199910 3300053151 Bacteria 687
481 Ga0500616_0065178 3300053153 Bacteria 1874
482 Ga0500622_0002161 3300053156 Bacteria 14580
483 Ga0500622_0002233 3300053156 Bacteria 14245
484 Ga0500627_0000945 3300053158 Bacteria 7847
485 Ga0500627_0061329 3300053158 Bacteria 1654
486 Ga0500630_040713 3300053159 Bacteria 2269
487 Ga0500637_0009309 3300053178 Bacteria 4995
488 Ga0500637_0025440 3300053178 Bacteria 3253
489 Ga0500637_0116335 3300053178 Bacteria 1551
490 Ga0500637_0290523 3300053178 Bacteria 896
491 Ga0500611_010857 3300053727 Bacteria 1489
492 2511127252 2510917021 Bacteria 5705459
493 2819550964 2818991438 Bacteria 5793701
494 Ga0307517_10184159
495 SwRhRL2b_contig_3113019
496 JGI24752J21851_1000372
497 JGI25150J39212_1000262
498 JGI25153J46596_10000093
499 rootH2_10234014
500 rootH2_10236659
501 Ga0055526_1001437
502 Ga0055530_10005741
503 Ga0055530_10014187
504 Ga0055540_1001103
505 Ga0065704_10000192
506 Ga0065704_10098235
507 Ga0065704_10102855
508 Ga0065707_10082002
509 Ga0065707_10082223
510 Ga0065707_10430649
511 Ga0070683_100234550
512 Ga0070683_100502089
513 Ga0070670_100000027
514 Ga0070670_100510542
515 Ga0070666_10018802
516 Ga0070666_10370770
517 Ga0070680_100013453
518 Ga0070660_100505017
519 Ga0070669_100000398
520 Ga0070669_100257173
521 Ga0070671_100000248
522 Ga0070671_100000347
523 Ga0070671_100042746
524 Ga0070667_100000481
525 Ga0070667_100000638
526 Ga0070667_100004174
527 Ga0070667_100008754
528 Ga0070667_100495806
529 Ga0070663_100992383
530 Ga0070684_100162241
531 Ga0070684_100773278
532 Ga0068853_100470281
533 Ga0070672_101392712
534 Ga0070665_100000896
535 Ga0070665_100001096
536 Ga0070665_100006455
537 Ga0070665_100008392
538 Ga0070665_100021887
539 Ga0070665_100048315
540 Ga0070665_100056289
541 Ga0070665_100090275
542 Ga0070665_100325615
543 Ga0068855_100000864
544 Ga0068855_100448707
545 Ga0070664_100459340
546 Ga0068859_100014419
547 Ga0068859_100035574
548 Ga0068859_100629623
549 Ga0068864_100000083
550 Ga0068861_100009847
551 Ga0068861_100981774
552 Ga0068851_10204373
553 Ga0068863_100000025
554 Ga0068863_100002525
555 Ga0068863_100002872
556 Ga0068863_100003218
557 Ga0068863_100005026
558 Ga0068863_100005830
559 Ga0068858_100001526
560 Ga0068858_100009745
561 Ga0068858_100086339
562 Ga0068858_100116853
563 Ga0068858_100190279
564 Ga0068860_100001916
565 Ga0068860_100002810
566 Ga0068860_100009042
567 Ga0068860_100014439
568 Ga0068860_100025299
569 Ga0068860_100627888
570 Ga0068862_100000027
571 Ga0068862_100000742
572 Ga0068862_100012030
573 Ga0068862_100020605
574 Ga0068862_100321545
575 Ga0081539_10152223
576 Ga0075364_10303631
577 Ga0070712_100420746
578 Ga0075369_10145918
579 Ga0097621_100454073
580 Ga0075370_10018935
581 Ga0068871_100273202
582 Ga0068871_100512604
583 Ga0075430_100093060
584 Ga0075430_100095607
585 Ga0075430_100122663
586 Ga0075431_100000252
587 Ga0075431_100435183
588 Ga0075429_100529122
589 Ga0097620_100014419
590 Ga0097620_100035575
591 Ga0097620_100629665
592 Ga0099794_10012023
593 Ga0099795_10007517
594 Ga0105251_10000554
595 Ga0105250_10453880
596 Ga0105240_10002346
597 Ga0105240_10031399
598 Ga0105240_10097870
599 Ga0105240_10176002
600 Ga0105240_10183870
601 Ga0105240_10224601
602 Ga0105240_10317691
603 Ga0105240_10491663
604 Ga0105240_12071557
605 Ga0111539_10008631
606 Ga0111539_10201076
607 Ga0105247_10000498
608 Ga0105247_10006556
609 Ga0105247_10008816
610 Ga0114129_10050160
611 Ga0114129_10496842
612 Ga0105248_10000026
613 Ga0105248_10011174
614 Ga0105248_10260790
615 Ga0105248_12153010
616 Ga0105237_10042538
617 Ga0105237_10158927
618 Ga0105237_10161823
619 Ga0105237_10192919
620 Ga0105237_10265445
621 Ga0105237_10302944
622 Ga0105238_10099137
623 Ga0105238_10426187
624 Ga0105238_10892862
625 Ga0105249_10000123
626 Ga0105249_10000161
627 Ga0105249_10129586
628 Ga0105249_10239794
629 Ga0105249_10252024
630 Ga0099796_10003854
631 Ga0105239_10163924
632 Ga0105239_10192213
633 Ga0105239_10313492
634 Ga0105246_10012636
635 Ga0157374_10564174
636 Ga0157378_10007322
637 Ga0163162_10095269
638 Ga0163162_10255486
639 Ga0157372_10705573
640 Ga0157375_10345910
641 Ga0163163_10012544
642 Ga0163163_10124540
643 Ga0163163_10156368
644 Ga0163163_10339381
645 Ga0163163_10986687
646 Ga0157380_10000630
647 Ga0157380_10023265
648 Ga0182008_10185468
649 Ga0157379_10048235
650 Ga0157379_10054672
651 Ga0157379_10751074
652 Ga0157379_11206770
653 Ga0157376_11428911
654 Ga0157376_11936824
655 Ga0207425_1000072
656 Ga0209129_1000734
657 Ga0209565_1000132
658 Ga0209565_1013103
659 Ga0209673_1010920
660 Ga0209676_1002301
661 Ga0209676_1021604
662 Ga0209025_1003336
663 Ga0209564_1001899
664 Ga0209564_1017232
665 Ga0209758_1000009
666 Ga0209758_1023237
667 Ga0209050_1000005
668 Ga0209050_1001236
669 Ga0209050_1022173
670 Ga0209050_1064966
671 Ga0207426_1053154
672 Ga0209051_1000507
673 Ga0209257_1003743
674 Ga0209257_1003760
675 Ga0207713_1000615
676 Ga0207710_10000147
677 Ga0207710_10004596
678 Ga0207710_10027626
679 Ga0207680_10027523
680 Ga0207647_10038083
681 Ga0207695_10013476
682 Ga0207695_10014260
683 Ga0207695_10021679
684 Ga0207695_10124806
685 Ga0207695_10138467
686 Ga0207695_10179163
687 Ga0207695_10256336
688 Ga0207695_10904256
689 Ga0207671_10049367
690 Ga0207671_10067425
691 Ga0207671_10121735
692 Ga0207671_10549286
693 Ga0207660_10063810
694 Ga0207652_10119313
695 Ga0207681_10061596
696 Ga0207694_10448149
697 Ga0207694_10469346
698 Ga0207694_10489968
699 Ga0207650_10000056
700 Ga0207650_10043744
701 Ga0207700_10132368
702 Ga0207644_10000366
703 Ga0207644_10005160
704 Ga0207644_10024583
705 Ga0207644_10088705
706 Ga0207691_10767118
707 Ga0207711_10000004
708 Ga0207711_10197111
709 Ga0207661_10073642
710 Ga0207661_10565260
711 Ga0207667_10008319
712 Ga0207712_10000059
713 Ga0207712_10008880
714 Ga0207712_10739346
715 Ga0207658_10000251
716 Ga0207658_10000520
717 Ga0207658_10011171
718 Ga0207658_10033146
719 Ga0207658_10317153
720 Ga0207658_10516547
721 Ga0207703_10002044
722 Ga0207703_10003560
723 Ga0207703_10470954
724 Ga0207639_10031464
725 Ga0207639_10257499
726 Ga0207678_10033205
727 Ga0207702_10029583
728 Ga0207702_10998322
729 Ga0207641_10000018
730 Ga0207641_10000117
731 Ga0207641_10003204
732 Ga0207641_10007380
733 Ga0207641_10013373
734 Ga0207641_10018142
735 Ga0207676_10000027
736 Ga0207428_10002282
737 Ga0207428_10004991
738 Ga0268266_10000159
739 Ga0268266_10003742
740 Ga0268266_10003965
741 Ga0268266_10013709
742 Ga0268266_10069357
743 Ga0268266_10130297
744 Ga0268265_10000042
745 Ga0268265_10000281
746 Ga0268264_10000183
747 Ga0268264_10000899
748 Ga0268264_10006973
749 Ga0268264_10463617
750 Ga0265334_10024393
751 Ga0307515_10042298
752 Ga0307511_10000028
753 Ga0265340_10030838
754 Ga0265331_10162312
755 Ga0307513_10735377
756 Ga0307509_10000025
757 Ga0307509_10000581
758 Ga0307408_100040800
759 Ga0307408_100136637
760 Ga0307516_10621355
761 Ga0307405_10114334
762 Ga0307405_10517011
763 Ga0307413_10047059
764 Ga0307413_10487609
765 Ga0307413_10636527
766 Ga0307413_10973678
767 Ga0307413_11669703
768 Ga0307410_10045208
769 Ga0307410_10187568
770 Ga0307410_10252097
771 Ga0307410_10804058
772 Ga0307406_10139285
773 Ga0307406_11059148
774 Ga0307407_10024073
775 Ga0307407_10063829
776 Ga0307407_10922397
777 Ga0307412_10521045
778 Ga0307412_10637138
779 Ga0307412_11200666
780 Ga0307409_100148866
781 Ga0307409_100192094
782 Ga0307409_100227844
783 Ga0307409_100750970
784 Ga0307409_100924345
785 Ga0307409_100944784
786 Ga0307416_100251525
787 Ga0307414_10003057
788 Ga0307414_10082697
789 Ga0307411_10026343
790 Ga0307411_10243169
791 Ga0307411_10416686
792 Ga0307411_10549224
793 Ga0307415_100346244
794 Ga0307507_10344193
795 Ga0307510_10000002
796 Ga0307510_10036411
797 Ga0307510_10138554
798 Ga0373936_0027513
799 Ga0373936_0029937
800 Ga0373927_0563081
801 Ga0395898_0002405
802 Ga0436364_0876164
803 Ga0436365_0243813
804 Ga0439448_0073186
805 Ga0439457_083103
806 Ga0439464_0127146
807 Ga0439440_0067146
808 Ga0466969_0075889
809 Ga0466966_0841423
810 Ga0466959_0117517
811 Ga0495627_000124
812 Ga0495638_0030893
813 Ga0495650_0000822
814 Ga0495596_0000054
815 Ga0495596_0004170
816 Ga0495607_0017649
817 Ga0495607_0355277
818 Ga0495606_0180422
819 Ga0495610_0000022
820 Ga0495610_0000436
821 Ga0495610_0003492
822 Ga0495620_0032347
823 Ga0495632_0000533
824 Ga0495632_0062224
825 Ga0495632_0096853
826 Ga0495643_0000042
827 Ga0495643_0060903
828 Ga0495648_0061248
829 Ga0495654_0004203
830 Ga0495654_0021480
831 Ga0495609_0004316
832 Ga0495609_0098583
833 Ga0495633_0042387
834 Ga0495668_0053651
835 Ga0495611_0224411
836 Ga0495625_0001187
837 Ga0495625_0052793
838 Ga0495625_0052958
839 Ga0495625_0316987
840 Ga0495625_0400904
841 Ga0495670_0196709
842 Ga0495683_0120563
843 Ga0495687_027325
844 Ga0495681_0000010
845 Ga0495686_0015271
846 Ga0495626_0000436
847 Ga0496102_0000529
848 Ga0496102_0001077
849 Ga0496102_0170154
850 Ga0496102_0182536
851 Ga0496102_0535873
852 Ga0496103_0000358
853 Ga0496103_0000687
854 Ga0496103_0026083
855 Ga0496105_0151623
856 Ga0496106_0296629
857 Ga0496109_0683540
858 Ga0496112_0112731
859 Ga0496115_0084120
860 Ga0496116_0000017
861 Ga0496116_0000750
862 Ga0496116_0003018
863 Ga0496116_0020341
864 Ga0496116_0020691
865 Ga0496116_0153341
866 Ga0496117_0000054
867 Ga0496117_0001078
868 Ga0496117_0002210
869 Ga0496117_0002463
870 Ga0496117_0070846
871 Ga0496117_0140496
872 Ga0496117_0362562
873 Ga0496118_0000195
874 Ga0496118_0000262
875 Ga0496118_0001124
876 Ga0496118_0002409
877 Ga0496118_0010987
878 Ga0496118_0042209
879 Ga0496118_0125979
880 Ga0496118_0134621
881 Ga0496118_0160320
882 Ga0496118_0260560
883 Ga0496118_0512736
884 Ga0496119_0002547
885 Ga0496119_0004480
886 Ga0496119_0016308
887 Ga0496119_0086806
888 Ga0496119_0090543
889 Ga0496119_0132838
890 Ga0496119_0358051
891 Ga0496120_0000558
892 Ga0496120_0016551
893 Ga0496120_0331414
894 Ga0496121_0000022
895 Ga0496121_0002831
896 Ga0496121_0003373
897 Ga0496121_0013117
898 Ga0496121_0015551
899 Ga0496121_0099223
900 Ga0496121_0747300
901 Ga0496122_0026373
902 Ga0496123_0001455
903 Ga0496124_0001157
904 Ga0496124_0002299
905 Ga0496124_0007454
906 Ga0496124_0022383
907 Ga0496124_0022420
908 Ga0496124_0029380
909 Ga0496124_0206536
910 Ga0496125_0000289
911 Ga0496125_0003926
912 Ga0496125_0044522
913 Ga0496125_0058826
914 Ga0496125_0252224
915 Ga0496125_0348932
916 Ga0496125_0425269
917 Ga0496126_0007938
918 Ga0496126_0038029
919 Ga0496126_0043879
920 Ga0496126_0050188
921 Ga0496126_0105795
922 Ga0496126_0198598
923 Ga0496126_0320340
924 Ga0496126_0923759
925 Ga0495682_0190505
926 Ga0495682_0193952
927 Ga0501037_0541795
928 Ga0501038_0069936
929 Ga0501039_0999051
930 Ga0501046_0125413
931 Ga0501046_1004023
932 Ga0501047_0176820
933 Ga0501047_0207476
934 Ga0501047_0246750
935 Ga0501067_0215225
936 Ga0501044_0436618
937 nmdc:mga03683_41_c1
938 nmdc:mga03683_6020_c1
939 nmdc:mga00v17_160240_c1
940 nmdc:mga00v17_278110_c1
941 nmdc:mga0k408_6801_c1
942 nmdc:mga07m45_16_c1
943 nmdc:mga05p37_23502_c1
944 nmdc:mga09592_145_c1
945 nmdc:mga09592_487304_c1
946 nmdc:mga0qj67_284255_c1
947 nmdc:mga0qj67_56338_c1
948 nmdc:mga06r32_389424_c1
949 nmdc:mga06r32_40_c1
950 nmdc:mga08y16_148_c1
951 nmdc:mga08y16_3044_c1
952 Ga0500643_000121
953 Ga0500643_000203
954 Ga0500643_000250
955 Ga0500646_0253555
956 Ga0500583_0122134
957 Ga0500556_0237020
958 Ga0500592_000791
959 Ga0500594_0004104
960 Ga0500595_001296
961 Ga0500607_000188
962 Ga0500618_000768
963 Ga0500618_078255
964 Ga0500652_206735
965 Ga0500559_0152841
966 Ga0500559_0246012
967 Ga0500559_0252195
968 Ga0500564_270193
969 Ga0500568_0061295
970 Ga0500588_0010348
971 Ga0500588_0242877
972 Ga0500590_000691
973 Ga0500604_0199910
974 Ga0500616_0065178
975 Ga0500622_0002161
976 Ga0500622_0002233
977 Ga0500627_0000945
978 Ga0500627_0061329
979 Ga0500630_040713
980 Ga0500637_0009309
981 Ga0500637_0025440
982 Ga0500637_0116335
983 Ga0500637_0290523
984 Ga0500611_010857
985 2511127252
986 2819550964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00710

Asparaginase

Asparaginase, N-terminal

10

166

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6paa-assembly1.cif.gz_B-2 e. coli l-asparaginase ii mutant (t12v) in complex with l-asp at ph 5.5 0.8606 7 156
7r5q-assembly2.cif.gz_D-3 escherichia coli type ii asparaginase n24s mutant in complex with glu 0.8568 7 156
5b74-assembly1.cif.gz_A crystal structure of conjoined pyrococcus furiosus l-asparaginase with peptide 0.8528 7 165
6pab-assembly2.cif.gz_D-3 e. coli l-asparaginase ii in complex with l-asp at ph 7.0 0.8527 7 156
6pa4-assembly1.cif.gz_B-2 e. coli l-asparaginase ii double mutant (t89v,k162t) in complex with l-asp at ph 7.0 0.8521 7 155
ID Description Score Start End Superfamily
af_Q2FYF4_1_206_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8537 7 156 3.40.50.1170
1wnfB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8508 7 165 3.40.50.1170
af_Q9VH61_12_241_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8329 7 156 3.40.50.1170
2himB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8294 7 165 3.40.50.1170
af_P9WPX5_1_188_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8141 7 166 3.40.50.1170
ID Description Score Start End GO Terms
AF-A0A3D2AR39-F1-model_v4 Asparaginase 0.9996 61 149 GO:0004067
AF-A0A3D2AR39-F1-model_v4 Asparaginase 0.9885 61 149 GO:0004067
AF-A0A286H7V7-F1-model_v4 Asparaginase 0.9864 91 166 GO:0004067
AF-A0A6I2JCW4-F1-model_v4 deleted 0.9829 43 131
AF-A0A356JBX2-F1-model_v4 deleted 0.9808 40 166

Map