F454447

General Info

Members Datasets Scaffolds Average Seq Length
493 228 986 201

Family's Representative Sequence

Representative Sequence 3300030731|Ga0316177_1035720|Ga0316177_10357204
Length 201
Sequence MKFFGIVFSFLLISATVCAQKSQRIFNGKDLSGWTIYGTEKWFVENGELVCESGPDKAYGYLGTEKPYKNFVLDLDFKQEANGNSGVFIRSSIDGVDITGWQVEVAPVNHHTGGIYESGPNGRQWLIKPKPADEAVLKQGEWNHLRIKAEGNQVTSWLNGKQMVHLDDEKVGLGEGFIALQIHSGGGIKVRWKDIKIEELK

Samples

Sample ID Description Type Environment
1 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
131 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
132 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
133 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
164 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
185 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
186 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
192 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
193 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
194 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
197 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
198 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
199 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
200 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
214 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
218 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
219 2738541278 Niastella sp. CF465 Isolate Unclassified
220 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
221 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
222 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
223 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
224 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
225 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
226 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
227 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
228 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 0.61
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 18.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316177_1035720 3300030731 Bacteria 7719
2 JGI24751J29686_10001970 3300002459 Bacteria 4191
3 rootH1_10059693 3300003316 Unclassified 4253
4 rootH2_10004559 3300003320 Bacteria 142332
5 rootH2_10137598 3300003320 Bacteria 1609
6 Ga0065165_1000131 3300005262 Bacteria 128880
7 Ga0065712_10005047 3300005290 Bacteria 3056
8 Ga0065712_10076506 3300005290 Bacteria 3642
9 Ga0065712_10087423 3300005290 Bacteria 2574
10 Ga0070676_10006110 3300005328 Bacteria 6430
11 Ga0070690_100049983 3300005330 Bacteria 2667
12 Ga0070670_100013520 3300005331 Bacteria 6993
13 Ga0070670_100167052 3300005331 Bacteria 1908
14 Ga0070670_100187851 3300005331 Unclassified 1794
15 Ga0070670_100283199 3300005331 Bacteria 1447
16 Ga0070677_10042935 3300005333 Bacteria 1793
17 Ga0070677_10164956 3300005333 Bacteria 1042
18 Ga0068869_100081945 3300005334 Bacteria 2410
19 Ga0068869_100083641 3300005334 Unclassified 2387
20 Ga0068869_100146512 3300005334 Bacteria 1828
21 Ga0068869_100421527 3300005334 Bacteria 1101
22 Ga0070666_10015874 3300005335 Bacteria 4811
23 Ga0070666_10524384 3300005335 Bacteria 860
24 Ga0068868_100009004 3300005338 Bacteria 7165
25 Ga0068868_100033023 3300005338 Bacteria 3986
26 Ga0070689_100110207 3300005340 Bacteria 2188
27 Ga0070689_100137126 3300005340 Bacteria 1965
28 Ga0070689_100688930 3300005340 Bacteria 891
29 Ga0070687_100384823 3300005343 Bacteria 915
30 Ga0070668_100009723 3300005347 Bacteria 7130
31 Ga0070668_100064972 3300005347 Bacteria 2830
32 Ga0070668_100204695 3300005347 Bacteria 1621
33 Ga0070668_100403747 3300005347 Bacteria 1167
34 Ga0070669_100028809 3300005353 Unclassified 4000
35 Ga0070669_100126632 3300005353 Bacteria 1955
36 Ga0070669_100584979 3300005353 Unclassified 934
37 Ga0070669_100743558 3300005353 Bacteria 831
38 Ga0070669_100887394 3300005353 Bacteria 761
39 Ga0070675_100045511 3300005354 Unclassified 3591
40 Ga0070675_100074023 3300005354 Bacteria 2828
41 Ga0070675_100105464 3300005354 Bacteria 2378
42 Ga0070675_100241006 3300005354 Bacteria 1580
43 Ga0070675_100263894 3300005354 Bacteria 1510
44 Ga0070671_100074972 3300005355 Bacteria 2826
45 Ga0070671_100241438 3300005355 Unclassified 1534
46 Ga0070671_100738339 3300005355 Bacteria 855
47 Ga0070674_100030209 3300005356 Bacteria 3578
48 Ga0070674_100123141 3300005356 Bacteria 1922
49 Ga0070673_100021950 3300005364 Unclassified 4639
50 Ga0070673_100121543 3300005364 Bacteria 2179
51 Ga0070673_100343619 3300005364 Bacteria 1323
52 Ga0070673_100470219 3300005364 Bacteria 1133
53 Ga0070688_100038599 3300005365 Bacteria 2918
54 Ga0070688_100049703 3300005365 Bacteria 2610
55 Ga0070667_100011174 3300005367 Bacteria 7428
56 Ga0070667_100055367 3300005367 Bacteria 3350
57 Ga0070667_100691808 3300005367 Bacteria 943
58 Ga0070714_100462900 3300005435 Bacteria 1206
59 Ga0070700_100145348 3300005441 Bacteria 1616
60 Ga0070694_100397679 3300005444 Bacteria 1078
61 Ga0070678_100174269 3300005456 Bacteria 1755
62 Ga0070678_100571230 3300005456 Unclassified 1006
63 Ga0070662_100011878 3300005457 Bacteria 5759
64 Ga0070662_100056769 3300005457 Bacteria 2843
65 Ga0070662_100134698 3300005457 Unclassified 1909
66 Ga0068867_100139423 3300005459 Bacteria 1894
67 Ga0068867_100225428 3300005459 Bacteria 1512
68 Ga0068867_100415201 3300005459 Bacteria 1139
69 Ga0068867_100958080 3300005459 Unclassified 773
70 Ga0068867_101089998 3300005459 Bacteria 729
71 Ga0070685_10024298 3300005466 Bacteria 3326
72 Ga0070698_100000936 3300005471 Bacteria 31949
73 Ga0070698_100003346 3300005471 Bacteria 17650
74 Ga0070698_100014293 3300005471 Bacteria 8393
75 Ga0070699_100076523 3300005518 Bacteria 2913
76 Ga0070699_101039162 3300005518 Bacteria 751
77 Ga0070672_100147810 3300005543 Bacteria 1942
78 Ga0070672_100195138 3300005543 Bacteria 1691
79 Ga0070672_100509860 3300005543 Unclassified 1041
80 Ga0070672_100950395 3300005543 Unclassified 760
81 Ga0070665_100103681 3300005548 Bacteria 2847
82 Ga0070704_100110823 3300005549 Bacteria 2088
83 Ga0070704_100366766 3300005549 Bacteria 1220
84 Ga0068855_100005467 3300005563 Bacteria 15499
85 Ga0070664_100058510 3300005564 Unclassified 3278
86 Ga0070664_100162688 3300005564 Unclassified 1975
87 Ga0070664_100690568 3300005564 Bacteria 950
88 Ga0068857_100049074 3300005577 Bacteria 3745
89 Ga0068857_100130769 3300005577 Bacteria 2264
90 Ga0068857_100167682 3300005577 Unclassified 1995
91 Ga0068857_100996914 3300005577 Unclassified 806
92 Ga0068854_100062197 3300005578 Bacteria 2706
93 Ga0068854_100165370 3300005578 Bacteria 1717
94 Ga0068854_100335309 3300005578 Bacteria 1233
95 Ga0068856_100425702 3300005614 Bacteria 1347
96 Ga0068852_100251547 3300005616 Bacteria 1693
97 Ga0068859_100058490 3300005617 Bacteria 3883
98 Ga0068859_100115351 3300005617 Unclassified 2751
99 Ga0068859_100134348 3300005617 Bacteria 2546
100 Ga0068859_100180003 3300005617 Bacteria 2196
101 Ga0068864_100014604 3300005618 Bacteria 6524
102 Ga0068864_100055423 3300005618 Bacteria 3423
103 Ga0068864_100480145 3300005618 Bacteria 1193
104 Ga0068864_101017384 3300005618 Bacteria 822
105 Ga0068866_10031547 3300005718 Unclassified 2554
106 Ga0068866_10203644 3300005718 Unclassified 1184
107 Ga0068861_100041391 3300005719 Bacteria 3451
108 Ga0068861_100390170 3300005719 Bacteria 1233
109 Ga0068861_100707625 3300005719 Unclassified 937
110 Ga0068851_10217811 3300005834 Bacteria 1071
111 Ga0068851_10302404 3300005834 Bacteria 920
112 Ga0068851_10518251 3300005834 Bacteria 717
113 Ga0068870_10041730 3300005840 Bacteria 2386
114 Ga0068870_10046656 3300005840 Bacteria 2273
115 Ga0068870_10124074 3300005840 Unclassified 1491
116 Ga0068870_10489173 3300005840 Bacteria 818
117 Ga0068863_100031816 3300005841 Bacteria 5033
118 Ga0068863_100053646 3300005841 Bacteria 3821
119 Ga0068863_100107909 3300005841 Bacteria 2650
120 Ga0068858_100047763 3300005842 Bacteria 3967
121 Ga0068858_100433464 3300005842 Bacteria 1265
122 Ga0068860_100002698 3300005843 Bacteria 18476
123 Ga0068860_100007550 3300005843 Bacteria 10878
124 Ga0068860_100020882 3300005843 Bacteria 6344
125 Ga0068860_100346578 3300005843 Bacteria 1461
126 Ga0068862_100017563 3300005844 Bacteria 5958
127 Ga0068862_100039409 3300005844 Bacteria 4012
128 Ga0068862_100151762 3300005844 Bacteria 2062
129 Ga0075366_10064218 3300006195 Bacteria 2183
130 Ga0097621_100087732 3300006237 Bacteria 2598
131 Ga0097621_100869736 3300006237 Bacteria 838
132 Ga0068871_100042277 3300006358 Bacteria 3658
133 Ga0068871_100155240 3300006358 Bacteria 1954
134 Ga0068871_100164548 3300006358 Unclassified 1898
135 Ga0068871_100216918 3300006358 Bacteria 1656
136 Ga0068871_100256158 3300006358 Unclassified 1525
137 Ga0075428_100004467 3300006844 Bacteria 15439
138 Ga0075428_100015432 3300006844 Bacteria 8467
139 Ga0075428_100104814 3300006844 Bacteria 3084
140 Ga0075428_100142451 3300006844 Bacteria 2606
141 Ga0075430_100022971 3300006846 Bacteria 5304
142 Ga0075430_100157126 3300006846 Bacteria 1893
143 Ga0075429_100004646 3300006880 Bacteria 11808
144 Ga0075429_100781209 3300006880 Bacteria 836
145 Ga0068865_100019152 3300006881 Bacteria 4427
146 Ga0068865_100163274 3300006881 Unclassified 1701
147 Ga0068865_100241311 3300006881 Bacteria 1422
148 Ga0097620_100058494 3300006931 Bacteria 3883
149 Ga0097620_100115352 3300006931 Unclassified 2751
150 Ga0097620_100134346 3300006931 Bacteria 2546
151 Ga0097620_100180001 3300006931 Bacteria 2196
152 Ga0111539_10089892 3300009094 Bacteria 3609
153 Ga0111539_10267442 3300009094 Bacteria 1990
154 Ga0111539_10377562 3300009094 Bacteria 1650
155 Ga0111539_11157915 3300009094 Bacteria 898
156 Ga0111539_11292891 3300009094 Unclassified 847
157 Ga0105247_10445341 3300009101 Unclassified 932
158 Ga0114129_10143067 3300009147 Bacteria 3277
159 Ga0114129_10495392 3300009147 Unclassified 1597
160 Ga0105241_10015860 3300009174 Bacteria 5519
161 Ga0105241_10294534 3300009174 Unclassified 1390
162 Ga0105242_10009711 3300009176 Bacteria 7373
163 Ga0105242_10010772 3300009176 Bacteria 7019
164 Ga0105242_10016512 3300009176 Bacteria 5739
165 Ga0105242_10245503 3300009176 Bacteria 1611
166 Ga0105248_10648310 3300009177 Unclassified 1191
167 Ga0105249_10001693 3300009553 Bacteria 19305
168 Ga0105249_10009116 3300009553 Bacteria 8679
169 Ga0105249_10065955 3300009553 Bacteria 3332
170 Ga0105249_10087604 3300009553 Bacteria 2906
171 Ga0105249_10130285 3300009553 Bacteria 2400
172 Ga0105249_10267677 3300009553 Bacteria 1701
173 Ga0105249_10394035 3300009553 Bacteria 1414
174 Ga0105249_10411103 3300009553 Bacteria 1385
175 Ga0105249_10857969 3300009553 Bacteria 974
176 Ga0105239_10009758 3300010375 Bacteria 10793
177 Ga0105239_11008133 3300010375 Unclassified 957
178 Ga0105246_10022468 3300011119 Bacteria 4069
179 Ga0105246_10402146 3300011119 Unclassified 1137
180 Ga0157371_10000418 3300013102 Bacteria 52571
181 Ga0157371_10230105 3300013102 Bacteria 1332
182 Ga0157371_10664977 3300013102 Bacteria 778
183 Ga0157370_10031223 3300013104 Bacteria 5213
184 Ga0157370_10279993 3300013104 Bacteria 1541
185 Ga0157370_10316278 3300013104 Bacteria 1440
186 Ga0157370_10512171 3300013104 Bacteria 1102
187 Ga0157369_10268728 3300013105 Unclassified 1777
188 Ga0157374_10065650 3300013296 Bacteria 3409
189 Ga0157374_10210426 3300013296 Bacteria 1907
190 Ga0157374_10245048 3300013296 Bacteria 1763
191 Ga0157378_10012920 3300013297 Bacteria 7307
192 Ga0157378_10015360 3300013297 Bacteria 6706
193 Ga0157378_12084224 3300013297 Bacteria 618
194 Ga0163162_10000306 3300013306 Bacteria 45352
195 Ga0163162_10043510 3300013306 Unclassified 4497
196 Ga0163162_10046007 3300013306 Bacteria 4374
197 Ga0163162_10145438 3300013306 Unclassified 2486
198 Ga0163162_10159287 3300013306 Unclassified 2379
199 Ga0163162_10202637 3300013306 Bacteria 2113
200 Ga0163162_10202753 3300013306 Unclassified 2113
201 Ga0163162_10788087 3300013306 Bacteria 1068
202 Ga0163162_11175886 3300013306 Bacteria 870
203 Ga0157372_10205352 3300013307 Unclassified 2283
204 Ga0157375_10074844 3300013308 Bacteria 3409
205 Ga0157375_10092676 3300013308 Bacteria 3085
206 Ga0157375_10411199 3300013308 Bacteria 1519
207 Ga0157375_10545720 3300013308 Bacteria 1321
208 Ga0157375_10886715 3300013308 Bacteria 1037
209 Ga0163163_10234326 3300014325 Unclassified 1885
210 Ga0163163_10407812 3300014325 Unclassified 1417
211 Ga0163163_10599013 3300014325 Bacteria 1165
212 Ga0157380_10000502 3300014326 Bacteria 23918
213 Ga0157380_10003817 3300014326 Bacteria 10373
214 Ga0157380_10165508 3300014326 Bacteria 1926
215 Ga0157380_10368701 3300014326 Bacteria 1350
216 Ga0157380_10463675 3300014326 Bacteria 1220
217 Ga0157377_10003971 3300014745 Bacteria 6747
218 Ga0157377_10062119 3300014745 Bacteria 2137
219 Ga0157377_10268738 3300014745 Bacteria 1113
220 Ga0157376_10019851 3300014969 Bacteria 5188
221 Ga0157376_10109864 3300014969 Bacteria 2425
222 Ga0157376_11282475 3300014969 Bacteria 762
223 Ga0182007_10023907 3300015262 Bacteria 2144
224 Ga0182007_10039406 3300015262 Bacteria 1581
225 Ga0163161_10024742 3300017792 Bacteria 4244
226 Ga0163161_10048521 3300017792 Bacteria 3066
227 Ga0163161_10163971 3300017792 Unclassified 1696
228 Ga0213876_10173431 3300021384 Bacteria 1147
229 Ga0209676_1000332 3300025292 Bacteria 90798
230 Ga0207682_10080582 3300025893 Bacteria 1394
231 Ga0207642_10008779 3300025899 Unclassified 3488
232 Ga0207642_10019944 3300025899 Unclassified 2607
233 Ga0207688_10011474 3300025901 Bacteria 4823
234 Ga0207680_10495365 3300025903 Bacteria 870
235 Ga0207645_10000487 3300025907 Bacteria 32876
236 Ga0207645_10007389 3300025907 Bacteria 7770
237 Ga0207645_10119454 3300025907 Bacteria 1710
238 Ga0207643_10008261 3300025908 Bacteria 5588
239 Ga0207643_10178488 3300025908 Bacteria 1284
240 Ga0207643_10407947 3300025908 Bacteria 860
241 Ga0207654_10195566 3300025911 Bacteria 1328
242 Ga0207671_10276853 3300025914 Unclassified 1323
243 Ga0207662_10098218 3300025918 Bacteria 1811
244 Ga0207681_10018827 3300025923 Bacteria 4355
245 Ga0207681_10030329 3300025923 Bacteria 3525
246 Ga0207681_10047771 3300025923 Bacteria 2886
247 Ga0207681_10055571 3300025923 Bacteria 2697
248 Ga0207681_10400029 3300025923 Bacteria 1109
249 Ga0207650_10054453 3300025925 Bacteria 2967
250 Ga0207650_10079901 3300025925 Bacteria 2478
251 Ga0207650_10101492 3300025925 Unclassified 2215
252 Ga0207659_10058452 3300025926 Bacteria 2768
253 Ga0207659_10117548 3300025926 Bacteria 2032
254 Ga0207659_10513619 3300025926 Bacteria 1015
255 Ga0207659_10562799 3300025926 Bacteria 970
256 Ga0207659_10726709 3300025926 Unclassified 851
257 Ga0207644_10454329 3300025931 Bacteria 1053
258 Ga0207706_10009705 3300025933 Bacteria 8834
259 Ga0207706_10037886 3300025933 Bacteria 4279
260 Ga0207686_10053180 3300025934 Unclassified 2530
261 Ga0207686_10102387 3300025934 Bacteria 1914
262 Ga0207686_10314242 3300025934 Bacteria 1168
263 Ga0207686_10757557 3300025934 Bacteria 775
264 Ga0207670_10097054 3300025936 Bacteria 2097
265 Ga0207670_10219871 3300025936 Bacteria 1453
266 Ga0207669_10243016 3300025937 Bacteria 1336
267 Ga0207704_10026651 3300025938 Unclassified 3174
268 Ga0207704_10108682 3300025938 Unclassified 1869
269 Ga0207704_10223905 3300025938 Bacteria 1394
270 Ga0207691_10034558 3300025940 Bacteria 4700
271 Ga0207691_10051734 3300025940 Bacteria 3754
272 Ga0207691_10077813 3300025940 Bacteria 2987
273 Ga0207691_11020503 3300025940 Bacteria 690
274 Ga0207711_10507563 3300025941 Unclassified 1124
275 Ga0207689_10004250 3300025942 Bacteria 13023
276 Ga0207689_10046819 3300025942 Bacteria 3573
277 Ga0207689_10088855 3300025942 Bacteria 2538
278 Ga0207689_10112309 3300025942 Bacteria 2240
279 Ga0207689_10173103 3300025942 Unclassified 1780
280 Ga0207689_10770958 3300025942 Unclassified 812
281 Ga0207679_10117716 3300025945 Unclassified 2109
282 Ga0207679_10271881 3300025945 Unclassified 1450
283 Ga0207679_10435692 3300025945 Bacteria 1160
284 Ga0207667_10003830 3300025949 Bacteria 18496
285 Ga0207651_10033507 3300025960 Bacteria 3314
286 Ga0207651_10225138 3300025960 Bacteria 1519
287 Ga0207651_10228855 3300025960 Bacteria 1508
288 Ga0207651_10620138 3300025960 Bacteria 947
289 Ga0207712_10001641 3300025961 Bacteria 15072
290 Ga0207712_10015848 3300025961 Bacteria 4870
291 Ga0207712_10040599 3300025961 Bacteria 3195
292 Ga0207712_10099709 3300025961 Bacteria 2157
293 Ga0207712_10101469 3300025961 Bacteria 2140
294 Ga0207712_10624227 3300025961 Bacteria 934
295 Ga0207668_10026335 3300025972 Unclassified 3775
296 Ga0207668_10074048 3300025972 Bacteria 2443
297 Ga0207640_10071946 3300025981 Bacteria 2331
298 Ga0207640_10776978 3300025981 Bacteria 828
299 Ga0207658_10042012 3300025986 Unclassified 3314
300 Ga0207658_10080438 3300025986 Bacteria 2496
301 Ga0207658_10471649 3300025986 Bacteria 1114
302 Ga0207658_10609948 3300025986 Bacteria 981
303 Ga0207658_10892878 3300025986 Unclassified 809
304 Ga0207703_10239034 3300026035 Unclassified 1632
305 Ga0207703_10399010 3300026035 Unclassified 1276
306 Ga0207639_10055701 3300026041 Unclassified 3027
307 Ga0207708_10083116 3300026075 Unclassified 2461
308 Ga0207702_10549709 3300026078 Bacteria 1129
309 Ga0207641_10000730 3300026088 Bacteria 35276
310 Ga0207641_10023068 3300026088 Bacteria 5127
311 Ga0207641_10051494 3300026088 Bacteria 3487
312 Ga0207641_10403080 3300026088 Bacteria 1314
313 Ga0207641_11442085 3300026088 Bacteria 690
314 Ga0207648_10002702 3300026089 Bacteria 18874
315 Ga0207648_10010266 3300026089 Bacteria 8891
316 Ga0207648_10126973 3300026089 Bacteria 2244
317 Ga0207648_10236127 3300026089 Bacteria 1627
318 Ga0207648_10325209 3300026089 Bacteria 1382
319 Ga0207648_10363530 3300026089 Bacteria 1306
320 Ga0207676_10080959 3300026095 Unclassified 2637
321 Ga0207674_10023613 3300026116 Bacteria 6583
322 Ga0207674_10198775 3300026116 Unclassified 1954
323 Ga0207674_10470419 3300026116 Bacteria 1215
324 Ga0207675_100009244 3300026118 Bacteria 9244
325 Ga0207675_100032433 3300026118 Bacteria 4866
326 Ga0207675_100249191 3300026118 Bacteria 1718
327 Ga0207675_100482660 3300026118 Unclassified 1232
328 Ga0207675_100602575 3300026118 Unclassified 1102
329 Ga0207683_10002626 3300026121 Bacteria 15705
330 Ga0207683_10073095 3300026121 Bacteria 3033
331 Ga0207683_10132289 3300026121 Bacteria 2244
332 Ga0207683_10230089 3300026121 Bacteria 1690
333 Ga0207683_10295342 3300026121 Unclassified 1482
334 Ga0207683_10870495 3300026121 Unclassified 836
335 Ga0207698_10109131 3300026142 Bacteria 2315
336 Ga0207698_10235422 3300026142 Bacteria 1665
337 Ga0207698_10819928 3300026142 Bacteria 934
338 Ga0207428_10090060 3300027907 Bacteria 2383
339 Ga0268266_10113262 3300028379 Bacteria 2405
340 Ga0268265_10143612 3300028380 Bacteria 2002
341 Ga0268265_10207802 3300028380 Bacteria 1703
342 Ga0268265_10237563 3300028380 Bacteria 1606
343 Ga0268265_10443534 3300028380 Bacteria 1210
344 Ga0268265_10937761 3300028380 Bacteria 852
345 Ga0268264_10002276 3300028381 Bacteria 17012
346 Ga0268264_10010665 3300028381 Bacteria 7592
347 Ga0268264_10125773 3300028381 Bacteria 2265
348 Ga0268264_10401157 3300028381 Bacteria 1318
349 Ga0307515_10000469 3300028794 Bacteria 96345
350 Ga0307515_10052864 3300028794 Bacteria 6011
351 Ga0307512_10200357 3300030522 Bacteria 1082
352 Ga0316176_1136190 3300030732 Bacteria 18590
353 Ga0316183_1141180 3300030742 Bacteria 31751
354 Ga0316181_1017039 3300030744 Bacteria 26728
355 Ga0316182_1216377 3300030745 Unclassified 1587
356 Ga0307513_10088351 3300031456 Bacteria 3168
357 Ga0307513_10198793 3300031456 Unclassified 1848
358 Ga0307513_10394059 3300031456 Bacteria 1121
359 Ga0307509_10738882 3300031507 Bacteria 650
360 Ga0316576_10443172 3300031727 Unclassified 960
361 Ga0307405_10094196 3300031731 Bacteria 1991
362 Ga0307405_10193166 3300031731 Unclassified 1472
363 Ga0307413_10599859 3300031824 Bacteria 901
364 Ga0307413_10732248 3300031824 Bacteria 825
365 Ga0307406_10921130 3300031901 Unclassified 745
366 Ga0307412_10018016 3300031911 Unclassified 4239
367 Ga0307412_10161666 3300031911 Unclassified 1665
368 Ga0307412_10163950 3300031911 Bacteria 1655
369 Ga0307412_10204327 3300031911 Bacteria 1502
370 Ga0307416_100216461 3300032002 Bacteria 1833
371 Ga0307414_10000235 3300032004 Bacteria 35379
372 Ga0307414_10012260 3300032004 Bacteria 5062
373 Ga0307414_10015588 3300032004 Bacteria 4590
374 Ga0307414_10019006 3300032004 Bacteria 4248
375 Ga0307414_10228121 3300032004 Bacteria 1534
376 Ga0307414_10274986 3300032004 Bacteria 1412
377 Ga0307414_10375282 3300032004 Bacteria 1228
378 Ga0307414_10400306 3300032004 Bacteria 1192
379 Ga0307414_10567551 3300032004 Bacteria 1013
380 Ga0307414_10697951 3300032004 Bacteria 918
381 Ga0307414_10806055 3300032004 Bacteria 856
382 Ga0307411_10148209 3300032005 Bacteria 1740
383 Ga0307415_100080937 3300032126 Unclassified 2319
384 Ga0373952_0126379 3300035092 Bacteria 698
385 Ga0316574_0042233 3300035398 Bacteria 2813
386 Ga0373925_0839478 3300037068 Bacteria 757
387 Ga0395905_0519905 3300037471 Unclassified 1091
388 Ga0439436_0011406 3300041404 Bacteria 2699
389 Ga0439439_0007467 3300041406 Bacteria 2559
390 Ga0451802_0145012 3300041460 Bacteria 1634
391 Ga0451833_0388626 3300041491 Bacteria 1144
392 Ga0451837_0928200 3300041494 Bacteria 1249
393 Ga0451841_0438562 3300041498 Unclassified 990
394 Ga0451851_0497521 3300041507 Unclassified 1007
395 Ga0451853_2297526 3300041512 Bacteria 1344
396 Ga0451853_3199655 3300041512 Bacteria 1209
397 Ga0439431_0000842 3300041997 Bacteria 6620
398 Ga0439442_007186 3300042002 Bacteria 2240
399 Ga0439449_0003965 3300042007 Bacteria 5725
400 Ga0439457_007191 3300042014 Bacteria 2684
401 Ga0439462_0017750 3300042015 Bacteria 1844
402 Ga0450923_027111 3300042125 Unclassified 1150
403 Ga0450898_021630 3300042134 Bacteria 1134
404 Ga0450899_009111 3300042135 Bacteria 1091
405 Ga0451577_0008277 3300042876 Bacteria 10128
406 Ga0451577_0009201 3300042876 Bacteria 9528
407 Ga0451577_0217388 3300042876 Bacteria 1727
408 Ga0466969_0079520 3300044656 Bacteria 1567
409 Ga0466972_0002404 3300044658 Bacteria 9228
410 Ga0453683_0001234 3300044673 Bacteria 22905
411 Ga0453684_0001120 3300044712 Bacteria 83961
412 Ga0453684_0002756 3300044712 Bacteria 41615
413 Ga0453684_0050678 3300044712 Bacteria 5457
414 Ga0453684_1110198 3300044712 Bacteria 835
415 Ga0453684_1336444 3300044712 Bacteria 746
416 Ga0453684_1495297 3300044712 Bacteria 697
417 Ga0451576_0129396 3300045051 Bacteria 2631
418 Ga0451576_0147451 3300045051 Unclassified 2454
419 Ga0451576_0446811 3300045051 Bacteria 1357
420 Ga0495643_0045179 3300046522 Unclassified 2392
421 Ga0495668_0019141 3300046616 Bacteria 3950
422 Ga0495611_0000042 3300046648 Bacteria 94996
423 Ga0495687_000227 3300047443 Bacteria 79368
424 Ga0496100_0119859 3300048903 Bacteria 1839
425 Ga0496114_0040216 3300048917 Bacteria 3870
426 Ga0501292_044685 3300049515 Unclassified 773
427 Ga0501033_0375491 3300049570 Bacteria 994
428 Ga0501034_0008020 3300049571 Bacteria 11209
429 Ga0501034_0101863 3300049571 Bacteria 2865
430 Ga0501034_0200248 3300049571 Bacteria 1955
431 Ga0501037_0017669 3300049573 Bacteria 5250
432 Ga0501038_0012471 3300049574 Bacteria 7766
433 Ga0501039_0098591 3300049575 Bacteria 2280
434 Ga0501047_0014354 3300049581 Bacteria 7531
435 Ga0501201_000138 3300049651 Bacteria 6100
436 Ga0501202_002041 3300049652 Bacteria 3338
437 Ga0501207_000634 3300049654 Bacteria 4077
438 Ga0501217_008337 3300049661 Bacteria 2237
439 Ga0501223_001562 3300049663 Bacteria 5275
440 Ga0501223_017404 3300049663 Bacteria 1419
441 Ga0501233_042501 3300049668 Unclassified 1073
442 Ga0501235_007538 3300049669 Bacteria 2369
443 Ga0501240_021657 3300049673 Bacteria 973
444 Ga0501243_001425 3300049675 Bacteria 3425
445 Ga0501246_021882 3300049676 Unclassified 667
446 Ga0501251_001896 3300049681 Bacteria 1981
447 Ga0501257_000854 3300049686 Bacteria 6116
448 Ga0501259_003795 3300049688 Bacteria 2401
449 Ga0501259_005544 3300049688 Bacteria 2001
450 Ga0501221_001693 3300049704 Bacteria 3668
451 Ga0501221_027270 3300049704 Unclassified 1167
452 Ga0501225_0001386 3300049705 Bacteria 7570
453 Ga0501225_0005483 3300049705 Bacteria 3722
454 Ga0501225_0116676 3300049705 Unclassified 790
455 Ga0501234_006603 3300049707 Bacteria 1814
456 Ga0501279_003071 3300049775 Bacteria 2169
457 Ga0501035_0014403 3300049822 Bacteria 7299
458 Ga0501044_0029068 3300049823 Bacteria 5830
459 Ga0501044_0264556 3300049823 Bacteria 1657
460 nmdc:mga07m45_228987_c1 3300050496 Bacteria 1081
461 nmdc:mga05p37_16038_c1 3300050507 Bacteria 9016
462 nmdc:mga05p37_468521_c1 3300050507 Unclassified 1454
463 nmdc:mga05p37_564788_c1 3300050507 Unclassified 1292
464 nmdc:mga09592_231850_c1 3300050508 Bacteria 1600
465 nmdc:mga09592_61351_c1 3300050508 Bacteria 3180
466 nmdc:mga09592_7117_c1 3300050508 Bacteria 9094
467 nmdc:mga0qj67_246894_c1 3300050509 Bacteria 1448
468 nmdc:mga06r32_456939_c1 3300050510 Unclassified 1256
469 nmdc:mga08y16_245760_c1 3300050511 Unclassified 1849
470 nmdc:mga08y16_290611_c1 3300050511 Bacteria 1685
471 nmdc:mga08y16_71550_c1 3300050511 Bacteria 3614
472 nmdc:mga08y16_90988_c1 3300050511 Bacteria 3180
473 nmdc:mga08y16_959855_c1 3300050511 Bacteria 837
474 Ga0500644_0025600 3300053088 Bacteria 1818
475 Ga0500583_0000080 3300053092 Bacteria 55700
476 Ga0500556_0105042 3300053104 Bacteria 1091
477 Ga0500652_087676 3300053131 Bacteria 1299
478 Ga0500588_0227933 3300053146 Unclassified 696
479 Ga0500589_029891 3300053147 Bacteria 2536
480 Ga0500622_0015185 3300053156 Bacteria 4129
481 Ga0500645_070590 3300053730 Bacteria 1003
482 Ga0500661_018544 3300055283 Bacteria 1240
483 2522549455 2522125168 Bacteria 7376607
484 2738727689 2738541278 Bacteria 9755573
485 2819677575 2818991460 Bacteria 7595395
486 2840678145 2840677318 Bacteria 2664183
487 2842908032 2842903701 Bacteria 6986368
488 2883070652 2883068021 Bacteria 6192739
489 2884636248 2884634485 Bacteria 3928637
490 2884797494 2884791551 Bacteria 8511252
491 2896085963 2896085136 Bacteria 6129793
492 2896115508 2896109856 Bacteria 7140722
493 2910246610 2910245624 Bacteria 6935613
494 Ga0316177_1035720
495 JGI24751J29686_10001970
496 rootH1_10059693
497 rootH2_10004559
498 rootH2_10137598
499 Ga0065165_1000131
500 Ga0065712_10005047
501 Ga0065712_10076506
502 Ga0065712_10087423
503 Ga0070676_10006110
504 Ga0070690_100049983
505 Ga0070670_100013520
506 Ga0070670_100167052
507 Ga0070670_100187851
508 Ga0070670_100283199
509 Ga0070677_10042935
510 Ga0070677_10164956
511 Ga0068869_100081945
512 Ga0068869_100083641
513 Ga0068869_100146512
514 Ga0068869_100421527
515 Ga0070666_10015874
516 Ga0070666_10524384
517 Ga0068868_100009004
518 Ga0068868_100033023
519 Ga0070689_100110207
520 Ga0070689_100137126
521 Ga0070689_100688930
522 Ga0070687_100384823
523 Ga0070668_100009723
524 Ga0070668_100064972
525 Ga0070668_100204695
526 Ga0070668_100403747
527 Ga0070669_100028809
528 Ga0070669_100126632
529 Ga0070669_100584979
530 Ga0070669_100743558
531 Ga0070669_100887394
532 Ga0070675_100045511
533 Ga0070675_100074023
534 Ga0070675_100105464
535 Ga0070675_100241006
536 Ga0070675_100263894
537 Ga0070671_100074972
538 Ga0070671_100241438
539 Ga0070671_100738339
540 Ga0070674_100030209
541 Ga0070674_100123141
542 Ga0070673_100021950
543 Ga0070673_100121543
544 Ga0070673_100343619
545 Ga0070673_100470219
546 Ga0070688_100038599
547 Ga0070688_100049703
548 Ga0070667_100011174
549 Ga0070667_100055367
550 Ga0070667_100691808
551 Ga0070714_100462900
552 Ga0070700_100145348
553 Ga0070694_100397679
554 Ga0070678_100174269
555 Ga0070678_100571230
556 Ga0070662_100011878
557 Ga0070662_100056769
558 Ga0070662_100134698
559 Ga0068867_100139423
560 Ga0068867_100225428
561 Ga0068867_100415201
562 Ga0068867_100958080
563 Ga0068867_101089998
564 Ga0070685_10024298
565 Ga0070698_100000936
566 Ga0070698_100003346
567 Ga0070698_100014293
568 Ga0070699_100076523
569 Ga0070699_101039162
570 Ga0070672_100147810
571 Ga0070672_100195138
572 Ga0070672_100509860
573 Ga0070672_100950395
574 Ga0070665_100103681
575 Ga0070704_100110823
576 Ga0070704_100366766
577 Ga0068855_100005467
578 Ga0070664_100058510
579 Ga0070664_100162688
580 Ga0070664_100690568
581 Ga0068857_100049074
582 Ga0068857_100130769
583 Ga0068857_100167682
584 Ga0068857_100996914
585 Ga0068854_100062197
586 Ga0068854_100165370
587 Ga0068854_100335309
588 Ga0068856_100425702
589 Ga0068852_100251547
590 Ga0068859_100058490
591 Ga0068859_100115351
592 Ga0068859_100134348
593 Ga0068859_100180003
594 Ga0068864_100014604
595 Ga0068864_100055423
596 Ga0068864_100480145
597 Ga0068864_101017384
598 Ga0068866_10031547
599 Ga0068866_10203644
600 Ga0068861_100041391
601 Ga0068861_100390170
602 Ga0068861_100707625
603 Ga0068851_10217811
604 Ga0068851_10302404
605 Ga0068851_10518251
606 Ga0068870_10041730
607 Ga0068870_10046656
608 Ga0068870_10124074
609 Ga0068870_10489173
610 Ga0068863_100031816
611 Ga0068863_100053646
612 Ga0068863_100107909
613 Ga0068858_100047763
614 Ga0068858_100433464
615 Ga0068860_100002698
616 Ga0068860_100007550
617 Ga0068860_100020882
618 Ga0068860_100346578
619 Ga0068862_100017563
620 Ga0068862_100039409
621 Ga0068862_100151762
622 Ga0075366_10064218
623 Ga0097621_100087732
624 Ga0097621_100869736
625 Ga0068871_100042277
626 Ga0068871_100155240
627 Ga0068871_100164548
628 Ga0068871_100216918
629 Ga0068871_100256158
630 Ga0075428_100004467
631 Ga0075428_100015432
632 Ga0075428_100104814
633 Ga0075428_100142451
634 Ga0075430_100022971
635 Ga0075430_100157126
636 Ga0075429_100004646
637 Ga0075429_100781209
638 Ga0068865_100019152
639 Ga0068865_100163274
640 Ga0068865_100241311
641 Ga0097620_100058494
642 Ga0097620_100115352
643 Ga0097620_100134346
644 Ga0097620_100180001
645 Ga0111539_10089892
646 Ga0111539_10267442
647 Ga0111539_10377562
648 Ga0111539_11157915
649 Ga0111539_11292891
650 Ga0105247_10445341
651 Ga0114129_10143067
652 Ga0114129_10495392
653 Ga0105241_10015860
654 Ga0105241_10294534
655 Ga0105242_10009711
656 Ga0105242_10010772
657 Ga0105242_10016512
658 Ga0105242_10245503
659 Ga0105248_10648310
660 Ga0105249_10001693
661 Ga0105249_10009116
662 Ga0105249_10065955
663 Ga0105249_10087604
664 Ga0105249_10130285
665 Ga0105249_10267677
666 Ga0105249_10394035
667 Ga0105249_10411103
668 Ga0105249_10857969
669 Ga0105239_10009758
670 Ga0105239_11008133
671 Ga0105246_10022468
672 Ga0105246_10402146
673 Ga0157371_10000418
674 Ga0157371_10230105
675 Ga0157371_10664977
676 Ga0157370_10031223
677 Ga0157370_10279993
678 Ga0157370_10316278
679 Ga0157370_10512171
680 Ga0157369_10268728
681 Ga0157374_10065650
682 Ga0157374_10210426
683 Ga0157374_10245048
684 Ga0157378_10012920
685 Ga0157378_10015360
686 Ga0157378_12084224
687 Ga0163162_10000306
688 Ga0163162_10043510
689 Ga0163162_10046007
690 Ga0163162_10145438
691 Ga0163162_10159287
692 Ga0163162_10202637
693 Ga0163162_10202753
694 Ga0163162_10788087
695 Ga0163162_11175886
696 Ga0157372_10205352
697 Ga0157375_10074844
698 Ga0157375_10092676
699 Ga0157375_10411199
700 Ga0157375_10545720
701 Ga0157375_10886715
702 Ga0163163_10234326
703 Ga0163163_10407812
704 Ga0163163_10599013
705 Ga0157380_10000502
706 Ga0157380_10003817
707 Ga0157380_10165508
708 Ga0157380_10368701
709 Ga0157380_10463675
710 Ga0157377_10003971
711 Ga0157377_10062119
712 Ga0157377_10268738
713 Ga0157376_10019851
714 Ga0157376_10109864
715 Ga0157376_11282475
716 Ga0182007_10023907
717 Ga0182007_10039406
718 Ga0163161_10024742
719 Ga0163161_10048521
720 Ga0163161_10163971
721 Ga0213876_10173431
722 Ga0209676_1000332
723 Ga0207682_10080582
724 Ga0207642_10008779
725 Ga0207642_10019944
726 Ga0207688_10011474
727 Ga0207680_10495365
728 Ga0207645_10000487
729 Ga0207645_10007389
730 Ga0207645_10119454
731 Ga0207643_10008261
732 Ga0207643_10178488
733 Ga0207643_10407947
734 Ga0207654_10195566
735 Ga0207671_10276853
736 Ga0207662_10098218
737 Ga0207681_10018827
738 Ga0207681_10030329
739 Ga0207681_10047771
740 Ga0207681_10055571
741 Ga0207681_10400029
742 Ga0207650_10054453
743 Ga0207650_10079901
744 Ga0207650_10101492
745 Ga0207659_10058452
746 Ga0207659_10117548
747 Ga0207659_10513619
748 Ga0207659_10562799
749 Ga0207659_10726709
750 Ga0207644_10454329
751 Ga0207706_10009705
752 Ga0207706_10037886
753 Ga0207686_10053180
754 Ga0207686_10102387
755 Ga0207686_10314242
756 Ga0207686_10757557
757 Ga0207670_10097054
758 Ga0207670_10219871
759 Ga0207669_10243016
760 Ga0207704_10026651
761 Ga0207704_10108682
762 Ga0207704_10223905
763 Ga0207691_10034558
764 Ga0207691_10051734
765 Ga0207691_10077813
766 Ga0207691_11020503
767 Ga0207711_10507563
768 Ga0207689_10004250
769 Ga0207689_10046819
770 Ga0207689_10088855
771 Ga0207689_10112309
772 Ga0207689_10173103
773 Ga0207689_10770958
774 Ga0207679_10117716
775 Ga0207679_10271881
776 Ga0207679_10435692
777 Ga0207667_10003830
778 Ga0207651_10033507
779 Ga0207651_10225138
780 Ga0207651_10228855
781 Ga0207651_10620138
782 Ga0207712_10001641
783 Ga0207712_10015848
784 Ga0207712_10040599
785 Ga0207712_10099709
786 Ga0207712_10101469
787 Ga0207712_10624227
788 Ga0207668_10026335
789 Ga0207668_10074048
790 Ga0207640_10071946
791 Ga0207640_10776978
792 Ga0207658_10042012
793 Ga0207658_10080438
794 Ga0207658_10471649
795 Ga0207658_10609948
796 Ga0207658_10892878
797 Ga0207703_10239034
798 Ga0207703_10399010
799 Ga0207639_10055701
800 Ga0207708_10083116
801 Ga0207702_10549709
802 Ga0207641_10000730
803 Ga0207641_10023068
804 Ga0207641_10051494
805 Ga0207641_10403080
806 Ga0207641_11442085
807 Ga0207648_10002702
808 Ga0207648_10010266
809 Ga0207648_10126973
810 Ga0207648_10236127
811 Ga0207648_10325209
812 Ga0207648_10363530
813 Ga0207676_10080959
814 Ga0207674_10023613
815 Ga0207674_10198775
816 Ga0207674_10470419
817 Ga0207675_100009244
818 Ga0207675_100032433
819 Ga0207675_100249191
820 Ga0207675_100482660
821 Ga0207675_100602575
822 Ga0207683_10002626
823 Ga0207683_10073095
824 Ga0207683_10132289
825 Ga0207683_10230089
826 Ga0207683_10295342
827 Ga0207683_10870495
828 Ga0207698_10109131
829 Ga0207698_10235422
830 Ga0207698_10819928
831 Ga0207428_10090060
832 Ga0268266_10113262
833 Ga0268265_10143612
834 Ga0268265_10207802
835 Ga0268265_10237563
836 Ga0268265_10443534
837 Ga0268265_10937761
838 Ga0268264_10002276
839 Ga0268264_10010665
840 Ga0268264_10125773
841 Ga0268264_10401157
842 Ga0307515_10000469
843 Ga0307515_10052864
844 Ga0307512_10200357
845 Ga0316176_1136190
846 Ga0316183_1141180
847 Ga0316181_1017039
848 Ga0316182_1216377
849 Ga0307513_10088351
850 Ga0307513_10198793
851 Ga0307513_10394059
852 Ga0307509_10738882
853 Ga0316576_10443172
854 Ga0307405_10094196
855 Ga0307405_10193166
856 Ga0307413_10599859
857 Ga0307413_10732248
858 Ga0307406_10921130
859 Ga0307412_10018016
860 Ga0307412_10161666
861 Ga0307412_10163950
862 Ga0307412_10204327
863 Ga0307416_100216461
864 Ga0307414_10000235
865 Ga0307414_10012260
866 Ga0307414_10015588
867 Ga0307414_10019006
868 Ga0307414_10228121
869 Ga0307414_10274986
870 Ga0307414_10375282
871 Ga0307414_10400306
872 Ga0307414_10567551
873 Ga0307414_10697951
874 Ga0307414_10806055
875 Ga0307411_10148209
876 Ga0307415_100080937
877 Ga0373952_0126379
878 Ga0316574_0042233
879 Ga0373925_0839478
880 Ga0395905_0519905
881 Ga0439436_0011406
882 Ga0439439_0007467
883 Ga0451802_0145012
884 Ga0451833_0388626
885 Ga0451837_0928200
886 Ga0451841_0438562
887 Ga0451851_0497521
888 Ga0451853_2297526
889 Ga0451853_3199655
890 Ga0439431_0000842
891 Ga0439442_007186
892 Ga0439449_0003965
893 Ga0439457_007191
894 Ga0439462_0017750
895 Ga0450923_027111
896 Ga0450898_021630
897 Ga0450899_009111
898 Ga0451577_0008277
899 Ga0451577_0009201
900 Ga0451577_0217388
901 Ga0466969_0079520
902 Ga0466972_0002404
903 Ga0453683_0001234
904 Ga0453684_0001120
905 Ga0453684_0002756
906 Ga0453684_0050678
907 Ga0453684_1110198
908 Ga0453684_1336444
909 Ga0453684_1495297
910 Ga0451576_0129396
911 Ga0451576_0147451
912 Ga0451576_0446811
913 Ga0495643_0045179
914 Ga0495668_0019141
915 Ga0495611_0000042
916 Ga0495687_000227
917 Ga0496100_0119859
918 Ga0496114_0040216
919 Ga0501292_044685
920 Ga0501033_0375491
921 Ga0501034_0008020
922 Ga0501034_0101863
923 Ga0501034_0200248
924 Ga0501037_0017669
925 Ga0501038_0012471
926 Ga0501039_0098591
927 Ga0501047_0014354
928 Ga0501201_000138
929 Ga0501202_002041
930 Ga0501207_000634
931 Ga0501217_008337
932 Ga0501223_001562
933 Ga0501223_017404
934 Ga0501233_042501
935 Ga0501235_007538
936 Ga0501240_021657
937 Ga0501243_001425
938 Ga0501246_021882
939 Ga0501251_001896
940 Ga0501257_000854
941 Ga0501259_003795
942 Ga0501259_005544
943 Ga0501221_001693
944 Ga0501221_027270
945 Ga0501225_0001386
946 Ga0501225_0005483
947 Ga0501225_0116676
948 Ga0501234_006603
949 Ga0501279_003071
950 Ga0501035_0014403
951 Ga0501044_0029068
952 Ga0501044_0264556
953 nmdc:mga07m45_228987_c1
954 nmdc:mga05p37_16038_c1
955 nmdc:mga05p37_468521_c1
956 nmdc:mga05p37_564788_c1
957 nmdc:mga09592_231850_c1
958 nmdc:mga09592_61351_c1
959 nmdc:mga09592_7117_c1
960 nmdc:mga0qj67_246894_c1
961 nmdc:mga06r32_456939_c1
962 nmdc:mga08y16_245760_c1
963 nmdc:mga08y16_290611_c1
964 nmdc:mga08y16_71550_c1
965 nmdc:mga08y16_90988_c1
966 nmdc:mga08y16_959855_c1
967 Ga0500644_0025600
968 Ga0500583_0000080
969 Ga0500556_0105042
970 Ga0500652_087676
971 Ga0500588_0227933
972 Ga0500589_029891
973 Ga0500622_0015185
974 Ga0500645_070590
975 Ga0500661_018544
976 2522549455
977 2738727689
978 2819677575
979 2840678145
980 2842908032
981 2883070652
982 2884636248
983 2884797494
984 2896085963
985 2896115508
986 2910246610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

21

198

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.9293 18 193
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8514 29 194
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.8338 18 193
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8171 29 194
1oq1-assembly2.cif.gz_B crystal structure of protein of unknown function with galectin-like fold from bacillus subtilis 0.7771 28 194
ID Description Score Start End Superfamily
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.9216 18 193 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8514 29 194 2.60.120.560
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8267 18 193 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8171 29 194 2.60.120.560
af_Q4D4Q5_106_279_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7875 138 162 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A661YRL7-F1-model_v4 DUF1080 domain-containing protein 0.9954 20 196 GO:0016787
AF-A0A2D0N0H6-F1-model_v4 Secreted glycosyl hydrolase 0.9951 16 195 GO:0016787
AF-A0A3M1YC63-F1-model_v4 DUF1080 domain-containing protein 0.995 18 192 GO:0016787
AF-A0A1Q4F145-F1-model_v4 Secreted glycosyl hydrolase 0.9949 19 195 GO:0016787
AF-A0A5B9WUX5-F1-model_v4 DUF1080 domain-containing protein 0.9943 15 195 GO:0016787

Map