F454468

General Info

Members Datasets Scaffolds Average Seq Length
493 241 986 228

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000049|Ga0495650_0000049_71924_72760
Length 268
Sequence MSGDRGTLPEPQVRAMFDRIARVYDLMNSVMTAGLHHRWRARAADLAQVGPGDRVLDVATGTGDLAIELAGRVSPGGEVVGTDFSEEMLARARTKAAALTDPASGRASASFARRKAPGMRFEWGNALELPYADGEFAAATVGFGARNFSDLDRGLSEMARVVKPGGRVVILEITTPQKPPLSTFFRLWFDRVVPLIGKVAGDPDAYDYLPNSVKRFPEPAGLAAALERAGLEQIRWVLTAGGIIALHVGVKPAGPIVTSSNGTRPHDA

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
165 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 7.51
Rhizosphere 90.26
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0000049 3300046471 Bacteria 325092
2 JGI25406J46586_10002929 3300003203 Bacteria 8052
3 JGI25407J50210_10001951 3300003373 Bacteria 4789
4 Ga0070683_100008907 3300005329 Bacteria 8551
5 Ga0070683_100126489 3300005329 Bacteria 2416
6 Ga0070683_100195296 3300005329 Bacteria 1921
7 Ga0070683_100223696 3300005329 Bacteria 1788
8 Ga0070690_100099586 3300005330 Bacteria 1925
9 Ga0068869_100094188 3300005334 Bacteria 2257
10 Ga0070680_100003591 3300005336 Bacteria 11582
11 Ga0070682_100063725 3300005337 Bacteria 2338
12 Ga0070682_100072564 3300005337 Bacteria 2206
13 Ga0070682_100418619 3300005337 Bacteria 1018
14 Ga0070660_100027862 3300005339 Bacteria 4221
15 Ga0070687_100050604 3300005343 Bacteria 2146
16 Ga0070661_100006067 3300005344 Bacteria 8316
17 Ga0070692_10093501 3300005345 Bacteria 1637
18 Ga0070692_10100041 3300005345 Bacteria 1588
19 Ga0070668_100009147 3300005347 Bacteria 7352
20 Ga0070669_100378828 3300005353 Bacteria 1154
21 Ga0070669_100400882 3300005353 Bacteria 1122
22 Ga0070675_100375848 3300005354 Bacteria 1264
23 Ga0070674_100232062 3300005356 Bacteria 1441
24 Ga0070688_100323871 3300005365 Bacteria 1121
25 Ga0070659_100000002 3300005366 Bacteria 369239
26 Ga0070659_100017143 3300005366 Bacteria 5445
27 Ga0070659_100089891 3300005366 Bacteria 2460
28 Ga0070659_100527492 3300005366 Bacteria 1009
29 Ga0070667_100619784 3300005367 Bacteria 998
30 Ga0070709_10052801 3300005434 Bacteria 2557
31 Ga0070714_100000457 3300005435 Bacteria 29655
32 Ga0070714_100008754 3300005435 Bacteria 7913
33 Ga0070714_100123887 3300005435 Bacteria 2302
34 Ga0070713_100349293 3300005436 Unclassified 1372
35 Ga0070710_10000007 3300005437 Bacteria 215320
36 Ga0070705_100014228 3300005440 Bacteria 4089
37 Ga0070700_100040531 3300005441 Bacteria 2851
38 Ga0070694_100243432 3300005444 Bacteria 1357
39 Ga0070662_100064443 3300005457 Bacteria 2683
40 Ga0070681_10007190 3300005458 Bacteria 10848
41 Ga0068867_100144991 3300005459 Bacteria 1860
42 Ga0070679_100003327 3300005530 Bacteria 14715
43 Ga0070679_100111875 3300005530 Bacteria 2717
44 Ga0070684_100067912 3300005535 Bacteria 3132
45 Ga0070684_100072550 3300005535 Bacteria 3031
46 Ga0070684_100111496 3300005535 Bacteria 2453
47 Ga0070684_100121936 3300005535 Bacteria 2345
48 Ga0068853_100380423 3300005539 Bacteria 1318
49 Ga0070696_100074294 3300005546 Bacteria 2397
50 Ga0070696_100305068 3300005546 Bacteria 1221
51 Ga0070693_100042695 3300005547 Bacteria 2556
52 Ga0070665_100521307 3300005548 Bacteria 1200
53 Ga0070704_100316388 3300005549 Bacteria 1306
54 Ga0068855_100109716 3300005563 Bacteria 3168
55 Ga0070664_100074144 3300005564 Bacteria 2921
56 Ga0070664_100532297 3300005564 Bacteria 1085
57 Ga0068854_100326934 3300005578 Bacteria 1248
58 Ga0068856_100016566 3300005614 Bacteria 7134
59 Ga0068856_100081736 3300005614 Bacteria 3206
60 Ga0068852_100005023 3300005616 Bacteria 9404
61 Ga0068852_100168458 3300005616 Bacteria 2051
62 Ga0068852_100254224 3300005616 Bacteria 1684
63 Ga0068859_100496123 3300005617 Bacteria 1316
64 Ga0068859_100561494 3300005617 Bacteria 1235
65 Ga0068864_100088648 3300005618 Bacteria 2725
66 Ga0068864_100150841 3300005618 Bacteria 2105
67 Ga0068861_100123292 3300005719 Bacteria 2093
68 Ga0068861_100172964 3300005719 Bacteria 1791
69 Ga0068861_100663487 3300005719 Bacteria 965
70 Ga0068870_10074052 3300005840 Bacteria 1865
71 Ga0068858_100156760 3300005842 Bacteria 2142
72 Ga0068862_100137880 3300005844 Bacteria 2163
73 Ga0068862_100602593 3300005844 Bacteria 1055
74 Ga0081455_10009917 3300005937 Bacteria 9744
75 Ga0081455_10078445 3300005937 Bacteria 2714
76 Ga0081538_10000027 3300005981 Bacteria 125924
77 Ga0081538_10000169 3300005981 Bacteria 69684
78 Ga0081538_10001407 3300005981 Bacteria 24723
79 Ga0081538_10004074 3300005981 Bacteria 13596
80 Ga0081538_10004165 3300005981 Bacteria 13421
81 Ga0081538_10008139 3300005981 Bacteria 8944
82 Ga0081538_10013039 3300005981 Bacteria 6614
83 Ga0081538_10060888 3300005981 Bacteria 2166
84 Ga0081538_10092789 3300005981 Bacteria 1553
85 Ga0081540_1000551 3300005983 Bacteria 36299
86 Ga0081540_1083157 3300005983 Unclassified 1433
87 Ga0081539_10004142 3300005985 Bacteria 16489
88 Ga0081539_10094299 3300005985 Bacteria 1540
89 Ga0070717_10000005 3300006028 Bacteria 357819
90 Ga0070717_10586281 3300006028 Bacteria 1011
91 Ga0075432_10011471 3300006058 Bacteria 3011
92 Ga0075432_10014407 3300006058 Bacteria 2694
93 Ga0070712_100084858 3300006175 Bacteria 2304
94 Ga0070712_100271877 3300006175 Bacteria 1362
95 Ga0075428_100044938 3300006844 Bacteria 4854
96 Ga0075428_100063973 3300006844 Bacteria 4028
97 Ga0075428_100422375 3300006844 Bacteria 1428
98 Ga0075430_100024546 3300006846 Bacteria 5128
99 Ga0075430_100473998 3300006846 Bacteria 1033
100 Ga0075431_100191972 3300006847 Bacteria 2092
101 Ga0075434_100187528 3300006871 Bacteria 2089
102 Ga0075429_100009692 3300006880 Bacteria 8351
103 Ga0075429_100668834 3300006880 Bacteria 910
104 Ga0097620_100496097 3300006931 Bacteria 1316
105 Ga0097620_100561516 3300006931 Bacteria 1235
106 Ga0075435_100706321 3300007076 Bacteria 876
107 Ga0105240_10139224 3300009093 Bacteria 2903
108 Ga0111539_10019441 3300009094 Bacteria 8383
109 Ga0111539_10454150 3300009094 Bacteria 1492
110 Ga0111539_11502906 3300009094 Bacteria 781
111 Ga0105245_10045611 3300009098 Bacteria 3915
112 Ga0105245_10261860 3300009098 Bacteria 1683
113 Ga0105245_10348117 3300009098 Bacteria 1467
114 Ga0105245_10543344 3300009098 Bacteria 1183
115 Ga0114129_10204505 3300009147 Bacteria 2672
116 Ga0114129_10338585 3300009147 Bacteria 1996
117 Ga0105242_10478890 3300009176 Bacteria 1179
118 Ga0105242_10595077 3300009176 Bacteria 1067
119 Ga0105248_10119630 3300009177 Bacteria 2971
120 Ga0105237_10128383 3300009545 Bacteria 2529
121 Ga0105238_10239403 3300009551 Bacteria 1792
122 Ga0105238_10336109 3300009551 Bacteria 1498
123 Ga0105238_10417620 3300009551 Bacteria 1336
124 Ga0105249_10103988 3300009553 Bacteria 2675
125 Ga0105249_10365782 3300009553 Bacteria 1465
126 Ga0157370_10011051 3300013104 Bacteria 9468
127 Ga0157369_10028494 3300013105 Bacteria 6182
128 Ga0157369_10655894 3300013105 Bacteria 1082
129 Ga0157369_10791660 3300013105 Bacteria 974
130 Ga0163162_10298778 3300013306 Bacteria 1742
131 Ga0163162_10598293 3300013306 Bacteria 1229
132 Ga0163162_10652399 3300013306 Bacteria 1176
133 Ga0157372_10040278 3300013307 Bacteria 5159
134 Ga0157372_10391095 3300013307 Bacteria 1620
135 Ga0157372_10402706 3300013307 Bacteria 1594
136 Ga0157375_10144491 3300013308 Bacteria 2509
137 Ga0163163_10049436 3300014325 Bacteria 4139
138 Ga0163163_10366049 3300014325 Bacteria 1499
139 Ga0163163_10615166 3300014325 Bacteria 1150
140 Ga0157380_10129374 3300014326 Bacteria 2152
141 Ga0157380_10241829 3300014326 Bacteria 1628
142 Ga0157380_10586105 3300014326 Bacteria 1100
143 Ga0157377_10131293 3300014745 Bacteria 1530
144 Ga0157379_10001599 3300014968 Bacteria 18677
145 Ga0157376_10016164 3300014969 Bacteria 5659
146 Ga0157376_10218298 3300014969 Bacteria 1764
147 Ga0206356_11155475 3300020070 Bacteria 2089
148 Ga0206353_10657759 3300020082 Bacteria 2969
149 Ga0206353_11928138 3300020082 Bacteria 1134
150 Ga0213875_10000650 3300021388 Bacteria 27651
151 Ga0213875_10066210 3300021388 Bacteria 1688
152 Ga0213875_10078697 3300021388 Bacteria 1538
153 Ga0207692_10000001 3300025898 Bacteria 558345
154 Ga0207692_10011971 3300025898 Bacteria 3713
155 Ga0207642_10009299 3300025899 Bacteria 3414
156 Ga0207642_10120156 3300025899 Bacteria 1354
157 Ga0207642_10207174 3300025899 Bacteria 1087
158 Ga0207688_10032166 3300025901 Bacteria 2898
159 Ga0207688_10248225 3300025901 Bacteria 1077
160 Ga0207647_10154316 3300025904 Bacteria 1341
161 Ga0207685_10016675 3300025905 Bacteria 2356
162 Ga0207645_10112622 3300025907 Bacteria 1762
163 Ga0207643_10036833 3300025908 Bacteria 2744
164 Ga0207643_10339298 3300025908 Bacteria 941
165 Ga0207707_10016827 3300025912 Bacteria 6370
166 Ga0207707_10100649 3300025912 Bacteria 2526
167 Ga0207707_10107439 3300025912 Bacteria 2440
168 Ga0207707_10321068 3300025912 Bacteria 1337
169 Ga0207695_10076324 3300025913 Bacteria 3407
170 Ga0207671_10221178 3300025914 Bacteria 1483
171 Ga0207693_10189725 3300025915 Bacteria 1617
172 Ga0207663_10154895 3300025916 Bacteria 1611
173 Ga0207662_10072760 3300025918 Bacteria 2084
174 Ga0207657_10020984 3300025919 Bacteria 6161
175 Ga0207657_10214029 3300025919 Bacteria 1546
176 Ga0207657_10294223 3300025919 Bacteria 1287
177 Ga0207649_10007634 3300025920 Bacteria 5881
178 Ga0207649_10144134 3300025920 Bacteria 1633
179 Ga0207652_10004034 3300025921 Bacteria 11985
180 Ga0207652_10079126 3300025921 Bacteria 2871
181 Ga0207652_10589078 3300025921 Bacteria 998
182 Ga0207694_10050477 3300025924 Bacteria 3222
183 Ga0207694_10072624 3300025924 Bacteria 2690
184 Ga0207687_10025183 3300025927 Bacteria 3981
185 Ga0207687_10080271 3300025927 Bacteria 2354
186 Ga0207687_10268901 3300025927 Bacteria 1362
187 Ga0207664_10000008 3300025929 Bacteria 309301
188 Ga0207664_10000817 3300025929 Bacteria 21110
189 Ga0207690_10000024 3300025932 Bacteria 194416
190 Ga0207706_10009615 3300025933 Bacteria 8873
191 Ga0207706_10132963 3300025933 Bacteria 2188
192 Ga0207706_10142092 3300025933 Bacteria 2112
193 Ga0207709_10177742 3300025935 Bacteria 1500
194 Ga0207670_10024053 3300025936 Bacteria 3802
195 Ga0207669_10232895 3300025937 Bacteria 1360
196 Ga0207669_10876966 3300025937 Bacteria 748
197 Ga0207704_10154158 3300025938 Bacteria 1626
198 Ga0207689_10022780 3300025942 Bacteria 5262
199 Ga0207661_10003963 3300025944 Bacteria 10341
200 Ga0207661_10009524 3300025944 Bacteria 6973
201 Ga0207661_10091820 3300025944 Bacteria 2530
202 Ga0207679_10068540 3300025945 Bacteria 2666
203 Ga0207679_10143948 3300025945 Bacteria 1931
204 Ga0207651_10169840 3300025960 Bacteria 1719
205 Ga0207651_10867416 3300025960 Bacteria 803
206 Ga0207712_10019552 3300025961 Bacteria 4426
207 Ga0207712_10070417 3300025961 Bacteria 2512
208 Ga0207668_10267586 3300025972 Bacteria 1396
209 Ga0207640_10047658 3300025981 Bacteria 2766
210 Ga0207640_10198945 3300025981 Bacteria 1517
211 Ga0207640_10244746 3300025981 Bacteria 1388
212 Ga0207640_10483384 3300025981 Bacteria 1028
213 Ga0207658_10173249 3300025986 Bacteria 1780
214 Ga0207677_10144065 3300026023 Bacteria 1829
215 Ga0207677_10297915 3300026023 Bacteria 1331
216 Ga0207678_10156942 3300026067 Bacteria 1943
217 Ga0207678_10200475 3300026067 Bacteria 1706
218 Ga0207678_10265269 3300026067 Bacteria 1472
219 Ga0207708_10008385 3300026075 Bacteria 7649
220 Ga0207708_10034455 3300026075 Bacteria 3851
221 Ga0207708_10046712 3300026075 Bacteria 3297
222 Ga0207708_10216904 3300026075 Bacteria 1531
223 Ga0207702_10013346 3300026078 Bacteria 6833
224 Ga0207702_10030434 3300026078 Bacteria 4499
225 Ga0207702_11081834 3300026078 Bacteria 796
226 Ga0207641_10130926 3300026088 Bacteria 2253
227 Ga0207648_10208241 3300026089 Bacteria 1735
228 Ga0207648_10210937 3300026089 Bacteria 1724
229 Ga0207648_10755220 3300026089 Bacteria 903
230 Ga0207676_10244913 3300026095 Bacteria 1610
231 Ga0207674_10253232 3300026116 Bacteria 1708
232 Ga0207674_10400995 3300026116 Bacteria 1325
233 Ga0207674_10578102 3300026116 Bacteria 1085
234 Ga0207674_10778767 3300026116 Bacteria 923
235 Ga0207675_100000239 3300026118 Bacteria 52108
236 Ga0207675_100040262 3300026118 Bacteria 4363
237 Ga0207675_100199650 3300026118 Bacteria 1921
238 Ga0207675_100505889 3300026118 Bacteria 1203
239 Ga0207675_100939658 3300026118 Bacteria 882
240 Ga0207683_10227755 3300026121 Bacteria 1699
241 Ga0207698_10169217 3300026142 Bacteria 1922
242 Ga0207698_10968409 3300026142 Bacteria 860
243 Ga0207428_10052877 3300027907 Bacteria 3241
244 Ga0207428_10106266 3300027907 Bacteria 2164
245 Ga0207428_10455100 3300027907 Bacteria 933
246 Ga0268266_10046362 3300028379 Bacteria 3722
247 Ga0268266_10173027 3300028379 Bacteria 1961
248 Ga0268266_10433756 3300028379 Bacteria 1247
249 Ga0268265_10133186 3300028380 Bacteria 2069
250 Ga0268265_10257768 3300028380 Bacteria 1549
251 Ga0265326_10000004 3300028558 Bacteria 283947
252 Ga0265319_1000406 3300028563 Bacteria 31126
253 Ga0265334_10000019 3300028573 Bacteria 143921
254 Ga0265338_10016741 3300028800 Bacteria 7944
255 Ga0265324_10000730 3300029957 Bacteria 21931
256 Ga0265320_10068282 3300031240 Bacteria 1680
257 Ga0265327_10002548 3300031251 Bacteria 18951
258 Ga0265327_10033249 3300031251 Bacteria 2877
259 Ga0307405_10017589 3300031731 Bacteria 3927
260 Ga0307405_10050843 3300031731 Bacteria 2569
261 Ga0307405_10079086 3300031731 Bacteria 2142
262 Ga0307405_10260598 3300031731 Bacteria 1295
263 Ga0307405_10603660 3300031731 Bacteria 896
264 Ga0307413_10221306 3300031824 Bacteria 1383
265 Ga0307413_10246484 3300031824 Bacteria 1322
266 Ga0307410_10002178 3300031852 Bacteria 9316
267 Ga0307410_10050454 3300031852 Bacteria 2798
268 Ga0307406_10004963 3300031901 Bacteria 7248
269 Ga0307406_10008830 3300031901 Bacteria 5633
270 Ga0307406_10050652 3300031901 Bacteria 2634
271 Ga0307406_10074772 3300031901 Bacteria 2232
272 Ga0307406_10179978 3300031901 Bacteria 1538
273 Ga0307406_10309025 3300031901 Bacteria 1218
274 Ga0307406_10359566 3300031901 Bacteria 1141
275 Ga0307407_10103790 3300031903 Bacteria 1770
276 Ga0307407_10163732 3300031903 Bacteria 1458
277 Ga0307412_10322920 3300031911 Bacteria 1229
278 Ga0307412_10595050 3300031911 Bacteria 936
279 Ga0307409_100006101 3300031995 Bacteria 7043
280 Ga0307409_100009373 3300031995 Bacteria 6010
281 Ga0307409_100077881 3300031995 Bacteria 2665
282 Ga0307409_100162324 3300031995 Bacteria 1956
283 Ga0307409_100342565 3300031995 Bacteria 1407
284 Ga0307409_100349015 3300031995 Bacteria 1395
285 Ga0307409_100455669 3300031995 Bacteria 1235
286 Ga0307409_100628687 3300031995 Bacteria 1065
287 Ga0307416_100007630 3300032002 Bacteria 6902
288 Ga0307416_100047424 3300032002 Bacteria 3400
289 Ga0307416_100080867 3300032002 Bacteria 2745
290 Ga0307416_100648114 3300032002 Bacteria 1141
291 Ga0307414_10011517 3300032004 Bacteria 5191
292 Ga0307414_10118461 3300032004 Bacteria 2031
293 Ga0307414_10166997 3300032004 Bacteria 1755
294 Ga0307411_10057982 3300032005 Bacteria 2561
295 Ga0307411_10290837 3300032005 Bacteria 1305
296 Ga0307411_10346820 3300032005 Bacteria 1209
297 Ga0307415_100002806 3300032126 Bacteria 8719
298 Ga0307415_100058664 3300032126 Bacteria 2650
299 Ga0307415_100084772 3300032126 Bacteria 2274
300 Ga0307415_100122373 3300032126 Bacteria 1954
301 Ga0373940_0097570 3300035088 Bacteria 888
302 Ga0373943_0203833 3300035170 Bacteria 1096
303 Ga0373942_0102453 3300035207 Bacteria 876
304 Ga0373935_0575374 3300035692 Bacteria 822
305 Ga0395899_0601033 3300037312 Bacteria 701
306 Ga0395900_0026894 3300037418 Bacteria 5888
307 Ga0395900_0268928 3300037418 Bacteria 1700
308 Ga0395900_0388097 3300037418 Bacteria 1363
309 Ga0395898_0002534 3300037466 Bacteria 21425
310 Ga0395898_0171265 3300037466 Bacteria 2076
311 Ga0395898_0244623 3300037466 Bacteria 1711
312 Ga0395898_0482163 3300037466 Bacteria 1180
313 Ga0395905_0226718 3300037471 Bacteria 1748
314 Ga0436364_0218948 3300037853 Bacteria 12129
315 Ga0436364_0621345 3300037853 Bacteria 7403
316 Ga0436364_0661397 3300037853 Bacteria 27636
317 Ga0395901_0043084 3300038443 Bacteria 4682
318 Ga0395901_0122393 3300038443 Bacteria 2734
319 Ga0395901_0248252 3300038443 Bacteria 1855
320 Ga0395901_0264700 3300038443 Bacteria 1789
321 Ga0395901_0357435 3300038443 Bacteria 1507
322 Ga0395901_0842205 3300038443 Bacteria 903
323 Ga0395901_1027827 3300038443 Bacteria 798
324 Ga0436365_0980589 3300039437 Bacteria 1813
325 Ga0436362_1063066 3300039453 Bacteria 2280
326 Ga0451853_1431424 3300041512 Bacteria 1232
327 Ga0439463_045793 3300042016 Bacteria 1114
328 Ga0439464_0017246 3300042439 Bacteria 1957
329 Ga0439460_0022516 3300042461 Bacteria 1729
330 Ga0439440_0040854 3300042993 Bacteria 1130
331 Ga0466972_0252003 3300044658 Bacteria 825
332 Ga0466966_0217363 3300044684 Bacteria 1154
333 Ga0466961_0017871 3300044693 Bacteria 4558
334 Ga0466964_0049681 3300044706 Bacteria 1718
335 Ga0466964_0137513 3300044706 Bacteria 1119
336 Ga0466960_0005260 3300044901 Bacteria 5112
337 Ga0466960_0014374 3300044901 Bacteria 3387
338 Ga0466960_0064617 3300044901 Bacteria 1805
339 Ga0466959_0007399 3300045049 Bacteria 7703
340 Ga0466959_0052463 3300045049 Bacteria 2986
341 Ga0466959_0095441 3300045049 Bacteria 2133
342 Ga0466959_0145509 3300045049 Bacteria 1673
343 Ga0466958_0019350 3300045836 Bacteria 3964
344 Ga0466958_0031816 3300045836 Bacteria 3136
345 Ga0466967_0046359 3300045976 Bacteria 3784
346 Ga0466967_0134127 3300045976 Bacteria 2302
347 Ga0466967_0189402 3300045976 Bacteria 1944
348 Ga0466967_0295472 3300045976 Bacteria 1557
349 Ga0466967_0299773 3300045976 Bacteria 1546
350 Ga0466967_0433307 3300045976 Bacteria 1283
351 Ga0495629_0514209 3300046459 Bacteria 806
352 Ga0495582_0224251 3300046473 Bacteria 1076
353 Ga0495605_0081055 3300046474 Bacteria 1518
354 Ga0495584_0097804 3300046491 Bacteria 1483
355 Ga0495584_0114657 3300046491 Bacteria 1364
356 Ga0495596_0066948 3300046500 Bacteria 1396
357 Ga0495616_0145650 3300046513 Bacteria 1075
358 Ga0495663_0103207 3300046525 Bacteria 941
359 Ga0495656_0113318 3300046615 Bacteria 1272
360 Ga0495668_0339129 3300046616 Bacteria 825
361 Ga0495646_0170277 3300046680 Bacteria 1200
362 Ga0495671_0128686 3300046692 Bacteria 1235
363 Ga0495671_0174110 3300046692 Bacteria 1046
364 Ga0495680_0419453 3300047322 Bacteria 921
365 Ga0496100_0151349 3300048903 Bacteria 1655
366 Ga0496102_0163881 3300048905 Bacteria 2091
367 Ga0496102_0562923 3300048905 Bacteria 1062
368 Ga0496104_0016537 3300048907 Bacteria 6703
369 Ga0496104_0450898 3300048907 Bacteria 1198
370 Ga0496105_0112851 3300048908 Bacteria 2243
371 Ga0496105_0260355 3300048908 Bacteria 1403
372 Ga0496106_0217055 3300048909 Bacteria 1524
373 Ga0496106_0408973 3300048909 Bacteria 1091
374 Ga0496107_0736975 3300048910 Bacteria 724
375 Ga0496108_0151712 3300048911 Bacteria 2000
376 Ga0496108_0207407 3300048911 Bacteria 1701
377 Ga0496108_0222676 3300048911 Bacteria 1639
378 Ga0496108_0294221 3300048911 Bacteria 1414
379 Ga0496108_1050295 3300048911 Bacteria 694
380 Ga0496109_0010926 3300048912 Bacteria 7778
381 Ga0496109_0150833 3300048912 Bacteria 2176
382 Ga0496109_0321185 3300048912 Bacteria 1461
383 Ga0496109_0580516 3300048912 Bacteria 1056
384 Ga0496110_0190127 3300048913 Bacteria 1864
385 Ga0496110_0863079 3300048913 Bacteria 810
386 Ga0496111_0149135 3300048914 Bacteria 1734
387 Ga0496111_0149351 3300048914 Bacteria 1733
388 Ga0496111_0320321 3300048914 Bacteria 1148
389 Ga0496112_0003642 3300048915 Bacteria 12833
390 Ga0496112_0010040 3300048915 Bacteria 8571
391 Ga0496112_0158806 3300048915 Bacteria 2227
392 Ga0496112_0443429 3300048915 Bacteria 1236
393 Ga0496112_0556592 3300048915 Bacteria 1080
394 Ga0496112_0627553 3300048915 Bacteria 1005
395 Ga0496112_1137168 3300048915 Bacteria 698
396 Ga0496113_0011846 3300048916 Bacteria 5843
397 Ga0496113_0160753 3300048916 Bacteria 1776
398 Ga0496113_0325400 3300048916 Bacteria 1232
399 Ga0496113_0437152 3300048916 Bacteria 1051
400 Ga0496114_0279991 3300048917 Bacteria 1470
401 Ga0496114_0811562 3300048917 Bacteria 815
402 Ga0496119_0108656 3300048922 Bacteria 1544
403 Ga0496121_0030447 3300048924 Bacteria 4956
404 Ga0501031_0061164 3300049568 Bacteria 2454
405 Ga0501031_0275101 3300049568 Unclassified 1093
406 Ga0501032_0010389 3300049569 Bacteria 6714
407 Ga0501033_0096978 3300049570 Bacteria 2154
408 Ga0501034_0063278 3300049571 Bacteria 3713
409 Ga0501034_1107565 3300049571 Bacteria 673
410 Ga0501036_0186315 3300049572 Bacteria 1746
411 Ga0501036_0205804 3300049572 Bacteria 1654
412 Ga0501036_0293075 3300049572 Unclassified 1361
413 Ga0501036_0598961 3300049572 Unclassified 914
414 Ga0501037_0047950 3300049573 Bacteria 3130
415 Ga0501037_0150252 3300049573 Bacteria 1665
416 Ga0501038_0007284 3300049574 Bacteria 10211
417 Ga0501038_0165374 3300049574 Bacteria 1795
418 Ga0501039_0061758 3300049575 Bacteria 2902
419 Ga0501039_0087124 3300049575 Bacteria 2432
420 Ga0501039_0269007 3300049575 Bacteria 1340
421 Ga0501040_0216453 3300049576 Unclassified 1362
422 Ga0501040_0337863 3300049576 Unclassified 1078
423 Ga0501041_0026073 3300049577 Bacteria 3514
424 Ga0501041_0063335 3300049577 Bacteria 2264
425 Ga0501042_0023236 3300049578 Bacteria 4337
426 Ga0501042_0113784 3300049578 Bacteria 1948
427 Ga0501042_0123879 3300049578 Bacteria 1861
428 Ga0501042_0133259 3300049578 Bacteria 1791
429 Ga0501042_0463777 3300049578 Bacteria 919
430 Ga0501043_0300102 3300049579 Bacteria 1227
431 Ga0501046_0027957 3300049580 Bacteria 4596
432 Ga0501046_0203960 3300049580 Bacteria 1470
433 Ga0501048_0087627 3300049582 Bacteria 2196
434 Ga0501048_0093135 3300049582 Bacteria 2125
435 Ga0501048_0549837 3300049582 Bacteria 828
436 Ga0501067_0004060 3300049583 Bacteria 8075
437 Ga0501068_0006798 3300049584 Bacteria 6325
438 Ga0501068_0313393 3300049584 Unclassified 1005
439 Ga0501069_0057879 3300049585 Bacteria 2162
440 Ga0501071_0072775 3300049587 Bacteria 2507
441 Ga0501071_0073973 3300049587 Bacteria 2486
442 Ga0501071_0089157 3300049587 Bacteria 2263
443 Ga0501071_0200616 3300049587 Bacteria 1498
444 Ga0501072_0008915 3300049588 Bacteria 7623
445 Ga0501072_0011185 3300049588 Bacteria 6850
446 Ga0501072_0056751 3300049588 Bacteria 3085
447 Ga0501072_0099658 3300049588 Bacteria 2309
448 Ga0501072_0171299 3300049588 Bacteria 1732
449 Ga0501072_0208303 3300049588 Bacteria 1558
450 Ga0501072_0557373 3300049588 Bacteria 905
451 Ga0501073_0004618 3300049589 Bacteria 10347
452 Ga0501074_0060546 3300049590 Bacteria 2728
453 Ga0501075_0058435 3300049591 Bacteria 2905
454 Ga0501075_0304456 3300049591 Bacteria 1214
455 Ga0501076_0003024 3300049592 Bacteria 11684
456 Ga0501076_0044285 3300049592 Bacteria 3509
457 Ga0501076_0797344 3300049592 Bacteria 779
458 Ga0501077_0071722 3300049593 Bacteria 2195
459 Ga0501079_0081047 3300049741 Bacteria 2509
460 Ga0501079_0091784 3300049741 Bacteria 2353
461 Ga0501079_0163736 3300049741 Bacteria 1734
462 Ga0501080_0012592 3300049742 Bacteria 7756
463 Ga0501081_0587216 3300049743 Bacteria 833
464 Ga0501083_0156051 3300049744 Bacteria 1494
465 Ga0501044_0329234 3300049823 Bacteria 1450
466 Ga0501045_0043781 3300049824 Bacteria 3260
467 Ga0501045_0116287 3300049824 Bacteria 1984
468 Ga0501045_0121565 3300049824 Bacteria 1939
469 nmdc:mga05p37_135893_c1 3300050507 Bacteria 3015
470 nmdc:mga09592_1226_c2 3300050508 Bacteria 19678
471 nmdc:mga09592_22322_c1 3300050508 Bacteria 5223
472 nmdc:mga09592_348594_c1 3300050508 Bacteria 1281
473 nmdc:mga0qj67_105493_c1 3300050509 Bacteria 2273
474 nmdc:mga0qj67_19172_c1 3300050509 Bacteria 5225
475 nmdc:mga06r32_416276_c1 3300050510 Bacteria 1325
476 nmdc:mga06r32_577746_c1 3300050510 Bacteria 1096
477 nmdc:mga08y16_55997_c1 3300050511 Bacteria 4121
478 nmdc:mga08y16_778122_c1 3300050511 Bacteria 951
479 nmdc:mga08y16_81658_c1 3300050511 Bacteria 3370
480 nmdc:mga0a205_298818_c1 3300050515 Bacteria 1483
481 Ga0495655_0034113 3300053083 Bacteria 1257
482 Ga0500616_0013344 3300053153 Bacteria 4774
483 Ga0501084_0026935 3300054114 Bacteria 4802
484 Ga0501084_0048779 3300054114 Bacteria 3544
485 Ga0501084_0088768 3300054114 Bacteria 2595
486 Ga0501084_0142773 3300054114 Bacteria 2016
487 Ga0501082_0027284 3300060353 Bacteria 4917
488 Ga0501082_0065863 3300060353 Bacteria 3120
489 Ga0501082_0113131 3300060353 Bacteria 2350
490 Ga0501082_0181004 3300060353 Bacteria 1833
491 Ga0501082_0355404 3300060353 Bacteria 1278
492 Ga0530510_0061531 3300061734 Bacteria 2718
493 Ga0530510_0068696 3300061734 Bacteria 2570
494 Ga0495650_0000049
495 JGI25406J46586_10002929
496 JGI25407J50210_10001951
497 Ga0070683_100008907
498 Ga0070683_100126489
499 Ga0070683_100195296
500 Ga0070683_100223696
501 Ga0070690_100099586
502 Ga0068869_100094188
503 Ga0070680_100003591
504 Ga0070682_100063725
505 Ga0070682_100072564
506 Ga0070682_100418619
507 Ga0070660_100027862
508 Ga0070687_100050604
509 Ga0070661_100006067
510 Ga0070692_10093501
511 Ga0070692_10100041
512 Ga0070668_100009147
513 Ga0070669_100378828
514 Ga0070669_100400882
515 Ga0070675_100375848
516 Ga0070674_100232062
517 Ga0070688_100323871
518 Ga0070659_100000002
519 Ga0070659_100017143
520 Ga0070659_100089891
521 Ga0070659_100527492
522 Ga0070667_100619784
523 Ga0070709_10052801
524 Ga0070714_100000457
525 Ga0070714_100008754
526 Ga0070714_100123887
527 Ga0070713_100349293
528 Ga0070710_10000007
529 Ga0070705_100014228
530 Ga0070700_100040531
531 Ga0070694_100243432
532 Ga0070662_100064443
533 Ga0070681_10007190
534 Ga0068867_100144991
535 Ga0070679_100003327
536 Ga0070679_100111875
537 Ga0070684_100067912
538 Ga0070684_100072550
539 Ga0070684_100111496
540 Ga0070684_100121936
541 Ga0068853_100380423
542 Ga0070696_100074294
543 Ga0070696_100305068
544 Ga0070693_100042695
545 Ga0070665_100521307
546 Ga0070704_100316388
547 Ga0068855_100109716
548 Ga0070664_100074144
549 Ga0070664_100532297
550 Ga0068854_100326934
551 Ga0068856_100016566
552 Ga0068856_100081736
553 Ga0068852_100005023
554 Ga0068852_100168458
555 Ga0068852_100254224
556 Ga0068859_100496123
557 Ga0068859_100561494
558 Ga0068864_100088648
559 Ga0068864_100150841
560 Ga0068861_100123292
561 Ga0068861_100172964
562 Ga0068861_100663487
563 Ga0068870_10074052
564 Ga0068858_100156760
565 Ga0068862_100137880
566 Ga0068862_100602593
567 Ga0081455_10009917
568 Ga0081455_10078445
569 Ga0081538_10000027
570 Ga0081538_10000169
571 Ga0081538_10001407
572 Ga0081538_10004074
573 Ga0081538_10004165
574 Ga0081538_10008139
575 Ga0081538_10013039
576 Ga0081538_10060888
577 Ga0081538_10092789
578 Ga0081540_1000551
579 Ga0081540_1083157
580 Ga0081539_10004142
581 Ga0081539_10094299
582 Ga0070717_10000005
583 Ga0070717_10586281
584 Ga0075432_10011471
585 Ga0075432_10014407
586 Ga0070712_100084858
587 Ga0070712_100271877
588 Ga0075428_100044938
589 Ga0075428_100063973
590 Ga0075428_100422375
591 Ga0075430_100024546
592 Ga0075430_100473998
593 Ga0075431_100191972
594 Ga0075434_100187528
595 Ga0075429_100009692
596 Ga0075429_100668834
597 Ga0097620_100496097
598 Ga0097620_100561516
599 Ga0075435_100706321
600 Ga0105240_10139224
601 Ga0111539_10019441
602 Ga0111539_10454150
603 Ga0111539_11502906
604 Ga0105245_10045611
605 Ga0105245_10261860
606 Ga0105245_10348117
607 Ga0105245_10543344
608 Ga0114129_10204505
609 Ga0114129_10338585
610 Ga0105242_10478890
611 Ga0105242_10595077
612 Ga0105248_10119630
613 Ga0105237_10128383
614 Ga0105238_10239403
615 Ga0105238_10336109
616 Ga0105238_10417620
617 Ga0105249_10103988
618 Ga0105249_10365782
619 Ga0157370_10011051
620 Ga0157369_10028494
621 Ga0157369_10655894
622 Ga0157369_10791660
623 Ga0163162_10298778
624 Ga0163162_10598293
625 Ga0163162_10652399
626 Ga0157372_10040278
627 Ga0157372_10391095
628 Ga0157372_10402706
629 Ga0157375_10144491
630 Ga0163163_10049436
631 Ga0163163_10366049
632 Ga0163163_10615166
633 Ga0157380_10129374
634 Ga0157380_10241829
635 Ga0157380_10586105
636 Ga0157377_10131293
637 Ga0157379_10001599
638 Ga0157376_10016164
639 Ga0157376_10218298
640 Ga0206356_11155475
641 Ga0206353_10657759
642 Ga0206353_11928138
643 Ga0213875_10000650
644 Ga0213875_10066210
645 Ga0213875_10078697
646 Ga0207692_10000001
647 Ga0207692_10011971
648 Ga0207642_10009299
649 Ga0207642_10120156
650 Ga0207642_10207174
651 Ga0207688_10032166
652 Ga0207688_10248225
653 Ga0207647_10154316
654 Ga0207685_10016675
655 Ga0207645_10112622
656 Ga0207643_10036833
657 Ga0207643_10339298
658 Ga0207707_10016827
659 Ga0207707_10100649
660 Ga0207707_10107439
661 Ga0207707_10321068
662 Ga0207695_10076324
663 Ga0207671_10221178
664 Ga0207693_10189725
665 Ga0207663_10154895
666 Ga0207662_10072760
667 Ga0207657_10020984
668 Ga0207657_10214029
669 Ga0207657_10294223
670 Ga0207649_10007634
671 Ga0207649_10144134
672 Ga0207652_10004034
673 Ga0207652_10079126
674 Ga0207652_10589078
675 Ga0207694_10050477
676 Ga0207694_10072624
677 Ga0207687_10025183
678 Ga0207687_10080271
679 Ga0207687_10268901
680 Ga0207664_10000008
681 Ga0207664_10000817
682 Ga0207690_10000024
683 Ga0207706_10009615
684 Ga0207706_10132963
685 Ga0207706_10142092
686 Ga0207709_10177742
687 Ga0207670_10024053
688 Ga0207669_10232895
689 Ga0207669_10876966
690 Ga0207704_10154158
691 Ga0207689_10022780
692 Ga0207661_10003963
693 Ga0207661_10009524
694 Ga0207661_10091820
695 Ga0207679_10068540
696 Ga0207679_10143948
697 Ga0207651_10169840
698 Ga0207651_10867416
699 Ga0207712_10019552
700 Ga0207712_10070417
701 Ga0207668_10267586
702 Ga0207640_10047658
703 Ga0207640_10198945
704 Ga0207640_10244746
705 Ga0207640_10483384
706 Ga0207658_10173249
707 Ga0207677_10144065
708 Ga0207677_10297915
709 Ga0207678_10156942
710 Ga0207678_10200475
711 Ga0207678_10265269
712 Ga0207708_10008385
713 Ga0207708_10034455
714 Ga0207708_10046712
715 Ga0207708_10216904
716 Ga0207702_10013346
717 Ga0207702_10030434
718 Ga0207702_11081834
719 Ga0207641_10130926
720 Ga0207648_10208241
721 Ga0207648_10210937
722 Ga0207648_10755220
723 Ga0207676_10244913
724 Ga0207674_10253232
725 Ga0207674_10400995
726 Ga0207674_10578102
727 Ga0207674_10778767
728 Ga0207675_100000239
729 Ga0207675_100040262
730 Ga0207675_100199650
731 Ga0207675_100505889
732 Ga0207675_100939658
733 Ga0207683_10227755
734 Ga0207698_10169217
735 Ga0207698_10968409
736 Ga0207428_10052877
737 Ga0207428_10106266
738 Ga0207428_10455100
739 Ga0268266_10046362
740 Ga0268266_10173027
741 Ga0268266_10433756
742 Ga0268265_10133186
743 Ga0268265_10257768
744 Ga0265326_10000004
745 Ga0265319_1000406
746 Ga0265334_10000019
747 Ga0265338_10016741
748 Ga0265324_10000730
749 Ga0265320_10068282
750 Ga0265327_10002548
751 Ga0265327_10033249
752 Ga0307405_10017589
753 Ga0307405_10050843
754 Ga0307405_10079086
755 Ga0307405_10260598
756 Ga0307405_10603660
757 Ga0307413_10221306
758 Ga0307413_10246484
759 Ga0307410_10002178
760 Ga0307410_10050454
761 Ga0307406_10004963
762 Ga0307406_10008830
763 Ga0307406_10050652
764 Ga0307406_10074772
765 Ga0307406_10179978
766 Ga0307406_10309025
767 Ga0307406_10359566
768 Ga0307407_10103790
769 Ga0307407_10163732
770 Ga0307412_10322920
771 Ga0307412_10595050
772 Ga0307409_100006101
773 Ga0307409_100009373
774 Ga0307409_100077881
775 Ga0307409_100162324
776 Ga0307409_100342565
777 Ga0307409_100349015
778 Ga0307409_100455669
779 Ga0307409_100628687
780 Ga0307416_100007630
781 Ga0307416_100047424
782 Ga0307416_100080867
783 Ga0307416_100648114
784 Ga0307414_10011517
785 Ga0307414_10118461
786 Ga0307414_10166997
787 Ga0307411_10057982
788 Ga0307411_10290837
789 Ga0307411_10346820
790 Ga0307415_100002806
791 Ga0307415_100058664
792 Ga0307415_100084772
793 Ga0307415_100122373
794 Ga0373940_0097570
795 Ga0373943_0203833
796 Ga0373942_0102453
797 Ga0373935_0575374
798 Ga0395899_0601033
799 Ga0395900_0026894
800 Ga0395900_0268928
801 Ga0395900_0388097
802 Ga0395898_0002534
803 Ga0395898_0171265
804 Ga0395898_0244623
805 Ga0395898_0482163
806 Ga0395905_0226718
807 Ga0436364_0218948
808 Ga0436364_0621345
809 Ga0436364_0661397
810 Ga0395901_0043084
811 Ga0395901_0122393
812 Ga0395901_0248252
813 Ga0395901_0264700
814 Ga0395901_0357435
815 Ga0395901_0842205
816 Ga0395901_1027827
817 Ga0436365_0980589
818 Ga0436362_1063066
819 Ga0451853_1431424
820 Ga0439463_045793
821 Ga0439464_0017246
822 Ga0439460_0022516
823 Ga0439440_0040854
824 Ga0466972_0252003
825 Ga0466966_0217363
826 Ga0466961_0017871
827 Ga0466964_0049681
828 Ga0466964_0137513
829 Ga0466960_0005260
830 Ga0466960_0014374
831 Ga0466960_0064617
832 Ga0466959_0007399
833 Ga0466959_0052463
834 Ga0466959_0095441
835 Ga0466959_0145509
836 Ga0466958_0019350
837 Ga0466958_0031816
838 Ga0466967_0046359
839 Ga0466967_0134127
840 Ga0466967_0189402
841 Ga0466967_0295472
842 Ga0466967_0299773
843 Ga0466967_0433307
844 Ga0495629_0514209
845 Ga0495582_0224251
846 Ga0495605_0081055
847 Ga0495584_0097804
848 Ga0495584_0114657
849 Ga0495596_0066948
850 Ga0495616_0145650
851 Ga0495663_0103207
852 Ga0495656_0113318
853 Ga0495668_0339129
854 Ga0495646_0170277
855 Ga0495671_0128686
856 Ga0495671_0174110
857 Ga0495680_0419453
858 Ga0496100_0151349
859 Ga0496102_0163881
860 Ga0496102_0562923
861 Ga0496104_0016537
862 Ga0496104_0450898
863 Ga0496105_0112851
864 Ga0496105_0260355
865 Ga0496106_0217055
866 Ga0496106_0408973
867 Ga0496107_0736975
868 Ga0496108_0151712
869 Ga0496108_0207407
870 Ga0496108_0222676
871 Ga0496108_0294221
872 Ga0496108_1050295
873 Ga0496109_0010926
874 Ga0496109_0150833
875 Ga0496109_0321185
876 Ga0496109_0580516
877 Ga0496110_0190127
878 Ga0496110_0863079
879 Ga0496111_0149135
880 Ga0496111_0149351
881 Ga0496111_0320321
882 Ga0496112_0003642
883 Ga0496112_0010040
884 Ga0496112_0158806
885 Ga0496112_0443429
886 Ga0496112_0556592
887 Ga0496112_0627553
888 Ga0496112_1137168
889 Ga0496113_0011846
890 Ga0496113_0160753
891 Ga0496113_0325400
892 Ga0496113_0437152
893 Ga0496114_0279991
894 Ga0496114_0811562
895 Ga0496119_0108656
896 Ga0496121_0030447
897 Ga0501031_0061164
898 Ga0501031_0275101
899 Ga0501032_0010389
900 Ga0501033_0096978
901 Ga0501034_0063278
902 Ga0501034_1107565
903 Ga0501036_0186315
904 Ga0501036_0205804
905 Ga0501036_0293075
906 Ga0501036_0598961
907 Ga0501037_0047950
908 Ga0501037_0150252
909 Ga0501038_0007284
910 Ga0501038_0165374
911 Ga0501039_0061758
912 Ga0501039_0087124
913 Ga0501039_0269007
914 Ga0501040_0216453
915 Ga0501040_0337863
916 Ga0501041_0026073
917 Ga0501041_0063335
918 Ga0501042_0023236
919 Ga0501042_0113784
920 Ga0501042_0123879
921 Ga0501042_0133259
922 Ga0501042_0463777
923 Ga0501043_0300102
924 Ga0501046_0027957
925 Ga0501046_0203960
926 Ga0501048_0087627
927 Ga0501048_0093135
928 Ga0501048_0549837
929 Ga0501067_0004060
930 Ga0501068_0006798
931 Ga0501068_0313393
932 Ga0501069_0057879
933 Ga0501071_0072775
934 Ga0501071_0073973
935 Ga0501071_0089157
936 Ga0501071_0200616
937 Ga0501072_0008915
938 Ga0501072_0011185
939 Ga0501072_0056751
940 Ga0501072_0099658
941 Ga0501072_0171299
942 Ga0501072_0208303
943 Ga0501072_0557373
944 Ga0501073_0004618
945 Ga0501074_0060546
946 Ga0501075_0058435
947 Ga0501075_0304456
948 Ga0501076_0003024
949 Ga0501076_0044285
950 Ga0501076_0797344
951 Ga0501077_0071722
952 Ga0501079_0081047
953 Ga0501079_0091784
954 Ga0501079_0163736
955 Ga0501080_0012592
956 Ga0501081_0587216
957 Ga0501083_0156051
958 Ga0501044_0329234
959 Ga0501045_0043781
960 Ga0501045_0116287
961 Ga0501045_0121565
962 nmdc:mga05p37_135893_c1
963 nmdc:mga09592_1226_c2
964 nmdc:mga09592_22322_c1
965 nmdc:mga09592_348594_c1
966 nmdc:mga0qj67_105493_c1
967 nmdc:mga0qj67_19172_c1
968 nmdc:mga06r32_416276_c1
969 nmdc:mga06r32_577746_c1
970 nmdc:mga08y16_55997_c1
971 nmdc:mga08y16_778122_c1
972 nmdc:mga08y16_81658_c1
973 nmdc:mga0a205_298818_c1
974 Ga0495655_0034113
975 Ga0500616_0013344
976 Ga0501084_0026935
977 Ga0501084_0048779
978 Ga0501084_0088768
979 Ga0501084_0142773
980 Ga0501082_0027284
981 Ga0501082_0065863
982 Ga0501082_0113131
983 Ga0501082_0181004
984 Ga0501082_0355404
985 Ga0530510_0061531
986 Ga0530510_0068696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

6

251

0.94

PF08241

Methyltransf_11

Methyltransferase domain

56

170

0.94

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

26

104

0.92

PF13847

Methyltransf_31

Methyltransferase domain

50

207

0.88

PF13649

Methyltransf_25

Methyltransferase domain

55

166

0.85

PF08242

Methyltransf_12

Methyltransferase domain

56

168

0.83

PF13489

Methyltransf_23

Methyltransferase domain

31

235

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9236 5 212
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.903 5 212
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8554 23 199
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8108 30 212
4dcm-assembly1.cif.gz_A crystal structure of methyltransferase rlmg modifying g1835 of 23s rrna in escherichia coli 0.7796 34 212
ID Description Score Start End Superfamily
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9379 30 212 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9171 5 212 3.40.50.150
af_A4IC78_24_256_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9132 5 212 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9124 9 212 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9077 5 212 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3B8XD34-F1-model_v4 Class I SAM-dependent methyltransferase 0.9396 35 130 GO:0008757
GO:0032259
AF-A0A1Z8X935-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9385 2 212 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A5C5YHI1-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9341 1 211 GO:0009234
GO:0032259
GO:0043770
AF-A0A7Y5Q4Q5-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9305 1 210 GO:0009234
GO:0032259
GO:0043770
AF-A0A1Z8X935-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9301 2 212 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770

Map