F454479

General Info

Members Datasets Scaffolds Average Seq Length
493 247 986 187

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0089337|Ga0495649_0089337_905_1507
Length 200
Sequence MALTTLDAKTALVVIDLQQGIVAMPTAHPTAEVVARAAELAHAFRRHGLPVVLVNVAGGAPGRAEQARPTGNFPAGFADLVPELNRQESDHLVTKRTWGAFTNTDLEAYLREQGVTQIVLAGVATSVGVESTARFAHELGLNIAFAVDAMTDLHLDAHTNSLTRIFPRLGETGTTQEVLDMLEQTRACACAAGQTPSRHS

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
55 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
213 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
214 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
215 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
216 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
217 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
218 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
219 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
220 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
221 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
222 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
223 2738543013 Variovorax sp. BT01 Isolate Unclassified
224 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
225 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
226 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
227 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
228 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
229 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
230 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
231 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
232 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
233 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
234 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
235 2904564687 Burkholderia sp. 571 Isolate Unclassified
236 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
237 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
238 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
239 2928536128 Burkholderia sola 565 Isolate Unclassified
240 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
241 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
242 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
243 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
244 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
245 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
246 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
247 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.9
Metatranscriptomes 0
Isolates 7.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 2.03
Rhizoplane 1.83
Rhizosphere 78.09
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0089337 3300046694 Bacteria 1643
2 JGI24739J22299_10002328 3300001989 Bacteria 7317
3 JGI24735J21928_10002298 3300002067 Bacteria 6673
4 JGI24735J21928_10011305 3300002067 Bacteria 2834
5 JGI24738J21930_10002540 3300002075 Bacteria 4738
6 JGI25156J39149_1000187 3300002705 Bacteria 44719
7 JGI25156J39149_1000487 3300002705 Bacteria 23843
8 JGI25165J46597_1000073 3300003214 Bacteria 192140
9 JGI25165J46597_1001477 3300003214 Bacteria 12128
10 rootH2_10022345 3300003320 Bacteria 6244
11 rootH2_10172420 3300003320 Bacteria 2261
12 rootH1_10160845 3300003323 Bacteria 3226
13 rootH1_10191040 3300003323 Bacteria 1538
14 Ga0055533_1000186 3300003756 Bacteria 51872
15 Ga0055532_1000007 3300003758 Bacteria 429810
16 Ga0055532_1000808 3300003758 Bacteria 10749
17 Ga0055525_1001606 3300003759 Bacteria 3571
18 Ga0055527_1000007 3300003760 Bacteria 429810
19 Ga0055527_1000167 3300003760 Bacteria 45193
20 Ga0055535_1000005 3300003761 Bacteria 429810
21 Ga0055535_1000382 3300003761 Bacteria 41904
22 Ga0055542_1000008 3300003762 Bacteria 429810
23 Ga0055542_1000408 3300003762 Bacteria 41982
24 Ga0055529_1000005 3300003763 Bacteria 429810
25 Ga0055529_1000436 3300003763 Bacteria 41951
26 Ga0055528_1003644 3300003790 Bacteria 7648
27 Ga0058692_1011349 3300003856 Bacteria 2158
28 Ga0070658_10004761 3300005327 Bacteria 11041
29 Ga0070658_10115475 3300005327 Bacteria 2227
30 Ga0070658_10179957 3300005327 Bacteria 1779
31 Ga0070658_10282352 3300005327 Bacteria 1413
32 Ga0070680_100004732 3300005336 Bacteria 10246
33 Ga0070680_100010337 3300005336 Bacteria 7194
34 Ga0070680_100315237 3300005336 Bacteria 1327
35 Ga0070680_100365479 3300005336 Bacteria 1227
36 Ga0070660_100200726 3300005339 Bacteria 1618
37 Ga0070660_100240078 3300005339 Bacteria 1476
38 Ga0070691_10278648 3300005341 Bacteria 906
39 Ga0070661_100432359 3300005344 Bacteria 1045
40 Ga0070659_100138546 3300005366 Bacteria 1980
41 Ga0070667_100563111 3300005367 Bacteria 1048
42 Ga0070714_100037050 3300005435 Bacteria 4096
43 Ga0070713_100439070 3300005436 Bacteria 1224
44 Ga0070663_100291012 3300005455 Bacteria 1304
45 Ga0070663_100575780 3300005455 Bacteria 944
46 Ga0070681_10369128 3300005458 Unclassified 1345
47 Ga0070681_10386386 3300005458 Bacteria 1310
48 Ga0070685_10050955 3300005466 Bacteria 2393
49 Ga0070706_100286892 3300005467 Bacteria 1536
50 Ga0070698_100058091 3300005471 Bacteria 3912
51 Ga0070698_100272723 3300005471 Bacteria 1623
52 Ga0070679_100026517 3300005530 Bacteria 5694
53 Ga0070679_100220147 3300005530 Bacteria 1859
54 Ga0068853_100416278 3300005539 Bacteria 1260
55 Ga0068853_100729753 3300005539 Bacteria 946
56 Ga0068853_101214906 3300005539 Bacteria 728
57 Ga0070693_100538655 3300005547 Bacteria 834
58 Ga0070665_100307677 3300005548 Bacteria 1588
59 Ga0068855_100000274 3300005563 Bacteria 63516
60 Ga0068855_100013108 3300005563 Bacteria 9997
61 Ga0068855_100286190 3300005563 Bacteria 1828
62 Ga0070664_100681937 3300005564 Bacteria 956
63 Ga0068856_100087950 3300005614 Bacteria 3089
64 Ga0068856_100770237 3300005614 Bacteria 982
65 Ga0068852_100020868 3300005616 Bacteria 5214
66 Ga0070717_10244671 3300006028 Bacteria 1583
67 Ga0105251_10114099 3300009011 Bacteria 1229
68 Ga0105240_10000169 3300009093 Bacteria 133189
69 Ga0105240_10001012 3300009093 Bacteria 50117
70 Ga0105240_10028760 3300009093 Bacteria 7251
71 Ga0105240_10051446 3300009093 Bacteria 5182
72 Ga0105240_10076759 3300009093 Bacteria 4118
73 Ga0105240_10139027 3300009093 Bacteria 2906
74 Ga0105240_10263152 3300009093 Bacteria 1989
75 Ga0105240_10460186 3300009093 Bacteria 1422
76 Ga0105240_10822191 3300009093 Bacteria 1005
77 Ga0105242_11084592 3300009176 Bacteria 814
78 Ga0105237_10391473 3300009545 Bacteria 1394
79 Ga0105238_10015660 3300009551 Bacteria 7676
80 Ga0105238_10204148 3300009551 Bacteria 1952
81 Ga0105238_10252517 3300009551 Bacteria 1742
82 Ga0105238_10907994 3300009551 Bacteria 899
83 Ga0105238_11032764 3300009551 Bacteria 843
84 Ga0157373_10133641 3300013100 Bacteria 1744
85 Ga0157370_10042594 3300013104 Bacteria 4373
86 Ga0157370_10399454 3300013104 Bacteria 1265
87 Ga0157369_10180574 3300013105 Bacteria 2221
88 Ga0157374_10768499 3300013296 Bacteria 979
89 Ga0157378_10669941 3300013297 Bacteria 1055
90 Ga0157372_10032939 3300013307 Bacteria 5688
91 Ga0157372_10067105 3300013307 Bacteria 4031
92 Ga0157372_10091191 3300013307 Bacteria 3466
93 Ga0157372_10656632 3300013307 Bacteria 1221
94 Ga0182007_10002715 3300015262 Bacteria 8660
95 Ga0213872_10007416 3300021361 Bacteria 5396
96 Ga0209435_108595 3300025206 Bacteria 1122
97 Ga0209566_103846 3300025225 Bacteria 2173
98 Ga0209674_100020 3300025226 Bacteria 672397
99 Ga0209672_100013 3300025228 Bacteria 740693
100 Ga0209672_100067 3300025228 Bacteria 180819
101 Ga0209147_100012 3300025229 Bacteria 681990
102 Ga0209147_100013 3300025229 Bacteria 660057
103 Ga0209563_100797 3300025230 Bacteria 9479
104 Ga0207427_100621 3300025231 Bacteria 17464
105 Ga0209258_100016 3300025242 Bacteria 668622
106 Ga0209258_100107 3300025242 Bacteria 206572
107 Ga0209148_1000020 3300025254 Bacteria 740693
108 Ga0209148_1000022 3300025254 Bacteria 681990
109 Ga0209759_1000010 3300025256 Bacteria 430463
110 Ga0209759_1000022 3300025256 Bacteria 329136
111 Ga0209759_1000130 3300025256 Bacteria 130638
112 Ga0209233_1000055 3300025261 Bacteria 439422
113 Ga0209233_1000142 3300025261 Bacteria 192193
114 Ga0209565_1012972 3300025263 Bacteria 1967
115 Ga0209455_1000017 3300025272 Bacteria 740693
116 Ga0209455_1000024 3300025272 Bacteria 676133
117 Ga0209673_1000021 3300025273 Bacteria 422978
118 Ga0209130_1002618 3300025284 Bacteria 8678
119 Ga0209675_1009224 3300025291 Bacteria 3504
120 Ga0209675_1025733 3300025291 Bacteria 1478
121 Ga0209676_1005948 3300025292 Bacteria 6174
122 Ga0209564_1032426 3300025295 Bacteria 1575
123 Ga0209564_1061943 3300025295 Bacteria 831
124 Ga0207647_10066153 3300025904 Bacteria 2193
125 Ga0207705_10002042 3300025909 Bacteria 15720
126 Ga0207705_10007771 3300025909 Bacteria 7875
127 Ga0207705_10346053 3300025909 Bacteria 1145
128 Ga0207707_10018999 3300025912 Bacteria 5994
129 Ga0207707_10020985 3300025912 Bacteria 5705
130 Ga0207695_10000003 3300025913 Bacteria 1368691
131 Ga0207695_10000663 3300025913 Bacteria 67900
132 Ga0207695_10027402 3300025913 Bacteria 6345
133 Ga0207695_10031943 3300025913 Bacteria 5767
134 Ga0207695_10036413 3300025913 Bacteria 5320
135 Ga0207695_10107563 3300025913 Bacteria 2774
136 Ga0207695_10206664 3300025913 Bacteria 1876
137 Ga0207695_10588835 3300025913 Bacteria 993
138 Ga0207695_10652534 3300025913 Bacteria 933
139 Ga0207693_10066804 3300025915 Bacteria 2815
140 Ga0207693_10280070 3300025915 Bacteria 1307
141 Ga0207660_10337249 3300025917 Bacteria 1206
142 Ga0207660_10367869 3300025917 Bacteria 1154
143 Ga0207657_10000203 3300025919 Bacteria 61390
144 Ga0207657_10104030 3300025919 Bacteria 2352
145 Ga0207657_10284713 3300025919 Bacteria 1311
146 Ga0207649_10116686 3300025920 Bacteria 1793
147 Ga0207652_10020588 3300025921 Bacteria 5435
148 Ga0207652_10158037 3300025921 Bacteria 2031
149 Ga0207652_10406026 3300025921 Bacteria 1229
150 Ga0207694_10000016 3300025924 Bacteria 349087
151 Ga0207694_10040808 3300025924 Bacteria 3575
152 Ga0207694_10393178 3300025924 Bacteria 1152
153 Ga0207700_10420934 3300025928 Bacteria 1173
154 Ga0207664_10083980 3300025929 Bacteria 2596
155 Ga0207679_10584727 3300025945 Bacteria 1005
156 Ga0207667_10000021 3300025949 Bacteria 370524
157 Ga0207667_10009156 3300025949 Bacteria 11695
158 Ga0207667_10187713 3300025949 Bacteria 2121
159 Ga0207667_10322243 3300025949 Bacteria 1578
160 Ga0207640_10060508 3300025981 Bacteria 2504
161 Ga0207658_10479704 3300025986 Bacteria 1105
162 Ga0207639_10012260 3300026041 Bacteria 5969
163 Ga0207639_10645134 3300026041 Bacteria 979
164 Ga0207678_10081203 3300026067 Bacteria 2775
165 Ga0207702_10077179 3300026078 Bacteria 2881
166 Ga0207683_10217936 3300026121 Bacteria 1738
167 Ga0207698_10016379 3300026142 Bacteria 4993
168 Ga0209371_1010788 3300027312 Bacteria 2772
169 Ga0268256_1011625 3300030500 Bacteria 2772
170 Ga0265327_10000004 3300031251 Bacteria 803973
171 Ga0265316_10381622 3300031344 Unclassified 1017
172 Ga0307408_100007870 3300031548 Bacteria 7046
173 Ga0265314_10011038 3300031711 Bacteria 7491
174 Ga0307412_10000002 3300031911 Bacteria 743446
175 Ga0307412_10015704 3300031911 Bacteria 4495
176 Ga0307416_100527362 3300032002 Bacteria 1250
177 Ga0307411_10581778 3300032005 Bacteria 960
178 Ga0316582_0147828 3300036647 Bacteria 1587
179 Ga0395899_0000003 3300037312 Bacteria 1232684
180 Ga0395900_0377778 3300037418 Bacteria 1386
181 Ga0395898_0010682 3300037466 Bacteria 9593
182 Ga0395898_0200372 3300037466 Bacteria 1906
183 Ga0395905_0147865 3300037471 Bacteria 2210
184 Ga0395905_0197626 3300037471 Bacteria 1886
185 Ga0436364_0107084 3300037853 Bacteria 1678
186 Ga0395901_0203001 3300038443 Bacteria 2077
187 Ga0395901_0701188 3300038443 Bacteria 1010
188 Ga0436360_0251974 3300039438 Bacteria 1337
189 Ga0436360_1061924 3300039438 Bacteria 848
190 Ga0436361_0093789 3300039447 Bacteria 794
191 Ga0436361_0470093 3300039447 Bacteria 6049
192 Ga0436361_0516069 3300039447 Bacteria 1255
193 Ga0436361_0736168 3300039447 Unclassified 2216
194 Ga0436361_1154293 3300039447 Bacteria 36752
195 Ga0436361_1167108 3300039447 Bacteria 16649
196 Ga0466969_0014936 3300044656 Bacteria 4074
197 Ga0466969_0073739 3300044656 Bacteria 1638
198 Ga0466966_0017102 3300044684 Bacteria 4797
199 Ga0466961_0009720 3300044693 Bacteria 6121
200 Ga0466970_0029888 3300044765 Bacteria 2872
201 Ga0466959_0004197 3300045049 Bacteria 9604
202 Ga0466959_0016125 3300045049 Bacteria 5453
203 Ga0466959_0290059 3300045049 Bacteria 1122
204 Ga0466959_0579742 3300045049 Bacteria 755
205 Ga0495592_0016473 3300046454 Bacteria 5608
206 Ga0495592_0242117 3300046454 Bacteria 1196
207 Ga0495592_0405361 3300046454 Bacteria 863
208 Ga0495603_0038061 3300046455 Bacteria 2885
209 Ga0495603_0201630 3300046455 Bacteria 1150
210 Ga0495590_0045706 3300046457 Bacteria 1527
211 Ga0495590_0108703 3300046457 Bacteria 989
212 Ga0495591_005084 3300046458 Bacteria 6176
213 Ga0495629_0000030 3300046459 Bacteria 125026
214 Ga0495629_0003511 3300046459 Bacteria 11851
215 Ga0495629_0010518 3300046459 Bacteria 6731
216 Ga0495629_0012423 3300046459 Bacteria 6167
217 Ga0495629_0024476 3300046459 Bacteria 4300
218 Ga0495629_0057822 3300046459 Bacteria 2711
219 Ga0495641_0013246 3300046461 Bacteria 4545
220 Ga0495641_0095762 3300046461 Bacteria 1325
221 Ga0495651_0013807 3300046462 Bacteria 6247
222 Ga0495651_0109723 3300046462 Bacteria 2042
223 Ga0495653_0000659 3300046463 Bacteria 26397
224 Ga0495653_0004659 3300046463 Bacteria 11085
225 Ga0495653_0063007 3300046463 Bacteria 2800
226 Ga0495653_0281542 3300046463 Bacteria 1091
227 Ga0495653_0460409 3300046463 Bacteria 798
228 Ga0495650_0002852 3300046471 Bacteria 13218
229 Ga0495650_0003866 3300046471 Bacteria 10616
230 Ga0495650_0056608 3300046471 Bacteria 1590
231 Ga0495580_0000021 3300046472 Bacteria 90091
232 Ga0495580_0008117 3300046472 Bacteria 8372
233 Ga0495580_0013588 3300046472 Bacteria 6208
234 Ga0495580_0017410 3300046472 Bacteria 5376
235 Ga0495580_0027191 3300046472 Bacteria 4163
236 Ga0495580_0092932 3300046472 Bacteria 2099
237 Ga0495580_0132349 3300046472 Bacteria 1729
238 Ga0495582_0005872 3300046473 Bacteria 6841
239 Ga0495582_0035622 3300046473 Bacteria 2737
240 Ga0495582_0231774 3300046473 Bacteria 1057
241 Ga0495605_0153646 3300046474 Bacteria 1025
242 Ga0495662_0006229 3300046476 Bacteria 5963
243 Ga0495662_0029286 3300046476 Bacteria 2659
244 Ga0495662_0066313 3300046476 Bacteria 1746
245 Ga0495664_0010682 3300046477 Bacteria 5156
246 Ga0495664_0062282 3300046477 Bacteria 2221
247 Ga0495594_0030710 3300046499 Bacteria 2910
248 Ga0495596_0002840 3300046500 Bacteria 9052
249 Ga0495596_0019356 3300046500 Bacteria 2798
250 Ga0495596_0027746 3300046500 Bacteria 2275
251 Ga0495583_0001977 3300046506 Bacteria 18817
252 Ga0495583_0002644 3300046506 Bacteria 14939
253 Ga0495606_0019878 3300046507 Bacteria 4973
254 Ga0495606_0026995 3300046507 Bacteria 4079
255 Ga0495606_0168936 3300046507 Bacteria 1270
256 Ga0495606_0169789 3300046507 Bacteria 1266
257 Ga0495608_0006058 3300046511 Bacteria 8590
258 Ga0495608_0007464 3300046511 Bacteria 7718
259 Ga0495610_0001730 3300046512 Bacteria 19136
260 Ga0495618_0004437 3300046514 Bacteria 8633
261 Ga0495618_0007087 3300046514 Bacteria 6779
262 Ga0495628_0000533 3300046516 Bacteria 34811
263 Ga0495628_0003671 3300046516 Bacteria 13702
264 Ga0495628_0012409 3300046516 Bacteria 7187
265 Ga0495628_0124157 3300046516 Bacteria 1978
266 Ga0495630_0014159 3300046517 Bacteria 5805
267 Ga0495630_0033580 3300046517 Bacteria 3827
268 Ga0495630_0275040 3300046517 Bacteria 1286
269 Ga0495630_1106454 3300046517 Bacteria 600
270 Ga0495632_0191437 3300046519 Bacteria 934
271 Ga0495648_0003932 3300046524 Bacteria 12863
272 Ga0495648_0011603 3300046524 Bacteria 6622
273 Ga0495648_0084433 3300046524 Bacteria 1796
274 Ga0495648_0148262 3300046524 Bacteria 1226
275 Ga0495666_0002173 3300046526 Bacteria 9759
276 Ga0495666_0014602 3300046526 Bacteria 3911
277 Ga0495666_0043337 3300046526 Bacteria 2174
278 Ga0495642_0012816 3300046528 Bacteria 3236
279 Ga0495652_0008639 3300046529 Bacteria 9283
280 Ga0495652_0020419 3300046529 Bacteria 5888
281 Ga0495652_0037760 3300046529 Bacteria 4188
282 Ga0495652_0204738 3300046529 Bacteria 1495
283 Ga0495652_0418638 3300046529 Bacteria 944
284 Ga0495665_0001673 3300046531 Bacteria 11896
285 Ga0495665_0007565 3300046531 Bacteria 5883
286 Ga0495665_0041057 3300046531 Bacteria 2462
287 Ga0495665_0050299 3300046531 Bacteria 2209
288 Ga0495665_0083037 3300046531 Bacteria 1684
289 Ga0495640_0006128 3300046533 Bacteria 9532
290 Ga0495640_0018770 3300046533 Bacteria 5118
291 Ga0495640_0085882 3300046533 Bacteria 2084
292 Ga0495586_0002556 3300046535 Bacteria 9844
293 Ga0495586_0015029 3300046535 Bacteria 4115
294 Ga0495586_0029116 3300046535 Bacteria 2956
295 Ga0495586_0290278 3300046535 Bacteria 936
296 Ga0495587_0003067 3300046536 Bacteria 11159
297 Ga0495587_0004575 3300046536 Bacteria 9087
298 Ga0495587_0008021 3300046536 Bacteria 6817
299 Ga0495597_0009615 3300046542 Bacteria 4767
300 Ga0495597_0193371 3300046542 Bacteria 817
301 Ga0495645_0000313 3300046543 Bacteria 34983
302 Ga0495645_0077297 3300046543 Bacteria 2394
303 Ga0495645_0312561 3300046543 Bacteria 1023
304 Ga0495622_0000042 3300046557 Bacteria 115943
305 Ga0495667_0010619 3300046559 Bacteria 6230
306 Ga0495667_0019253 3300046559 Bacteria 4607
307 Ga0495634_0015399 3300046642 Bacteria 5496
308 Ga0495634_0054102 3300046642 Bacteria 2687
309 Ga0495611_0030450 3300046648 Bacteria 2373
310 Ga0495625_0224250 3300046660 Bacteria 1230
311 Ga0495635_0022235 3300046663 Bacteria 4416
312 Ga0495635_0046886 3300046663 Bacteria 2981
313 Ga0495635_0073903 3300046663 Bacteria 2335
314 Ga0495661_0004086 3300046665 Bacteria 10627
315 Ga0495661_0018461 3300046665 Bacteria 4586
316 Ga0495661_0116794 3300046665 Bacteria 1479
317 Ga0495657_0011210 3300046675 Bacteria 6715
318 Ga0495657_0013181 3300046675 Bacteria 6107
319 Ga0495599_0009084 3300046678 Bacteria 6058
320 Ga0495599_0020714 3300046678 Bacteria 4097
321 Ga0495599_0217885 3300046678 Bacteria 1169
322 Ga0495599_0255115 3300046678 Bacteria 1066
323 Ga0495599_0420098 3300046678 Bacteria 794
324 Ga0495599_0546209 3300046678 Bacteria 679
325 Ga0495623_0008327 3300046679 Bacteria 6743
326 Ga0495623_0008805 3300046679 Bacteria 6548
327 Ga0495623_0014865 3300046679 Bacteria 5033
328 Ga0495623_0025129 3300046679 Bacteria 3837
329 Ga0495646_0000488 3300046680 Bacteria 21136
330 Ga0495646_0041734 3300046680 Bacteria 2817
331 Ga0495613_0003590 3300046689 Bacteria 11625
332 Ga0495613_0025622 3300046689 Bacteria 4395
333 Ga0495624_0000074 3300046690 Bacteria 65208
334 Ga0495624_0000260 3300046690 Bacteria 41797
335 Ga0495624_0001937 3300046690 Bacteria 15761
336 Ga0495624_0058814 3300046690 Bacteria 2413
337 Ga0495624_0088846 3300046690 Bacteria 1907
338 Ga0495671_0012521 3300046692 Bacteria 4629
339 Ga0495671_0272203 3300046692 Bacteria 816
340 Ga0495649_0006876 3300046694 Bacteria 7041
341 Ga0495649_0015738 3300046694 Bacteria 4300
342 Ga0495649_0246960 3300046694 Bacteria 917
343 Ga0495589_0002526 3300046794 Bacteria 10184
344 Ga0495589_0031427 3300046794 Bacteria 2673
345 Ga0495589_0053902 3300046794 Bacteria 1984
346 Ga0495589_0065452 3300046794 Bacteria 1782
347 Ga0495589_0078114 3300046794 Bacteria 1612
348 Ga0495600_0005862 3300046809 Bacteria 7431
349 Ga0495600_0012695 3300046809 Bacteria 5274
350 Ga0495600_0039942 3300046809 Bacteria 3055
351 Ga0495581_0002698 3300047315 Bacteria 10106
352 Ga0495581_0007215 3300047315 Bacteria 6429
353 Ga0495581_0024741 3300047315 Bacteria 3480
354 Ga0495581_0116022 3300047315 Bacteria 1557
355 Ga0495604_0001898 3300047317 Bacteria 16971
356 Ga0495604_0008721 3300047317 Bacteria 8014
357 Ga0495604_0016422 3300047317 Bacteria 5917
358 Ga0495604_0037899 3300047317 Bacteria 3794
359 Ga0495604_0180086 3300047317 Bacteria 1479
360 Ga0495604_0238568 3300047317 Bacteria 1244
361 Ga0495604_0356095 3300047317 Bacteria 971
362 Ga0495674_0019588 3300047319 Bacteria 6277
363 Ga0495674_0025085 3300047319 Bacteria 5471
364 Ga0495674_0084201 3300047319 Bacteria 2725
365 Ga0495674_0115090 3300047319 Bacteria 2276
366 Ga0495674_0121545 3300047319 Bacteria 2205
367 Ga0495672_0076209 3300047320 Bacteria 1884
368 Ga0495672_0110563 3300047320 Bacteria 1476
369 Ga0495676_0012255 3300047321 Bacteria 7726
370 Ga0495676_0134454 3300047321 Bacteria 1780
371 Ga0495676_0231507 3300047321 Bacteria 1269
372 Ga0495676_0265542 3300047321 Bacteria 1166
373 Ga0495676_0579165 3300047321 Bacteria 732
374 Ga0495680_0002172 3300047322 Bacteria 20290
375 Ga0495680_0029181 3300047322 Bacteria 4518
376 Ga0495680_0062900 3300047322 Bacteria 2851
377 Ga0495680_0135465 3300047322 Bacteria 1806
378 Ga0495683_0002808 3300047323 Bacteria 10327
379 Ga0495683_0044852 3300047323 Bacteria 2223
380 Ga0495683_0058270 3300047323 Bacteria 1918
381 Ga0495687_035018 3300047443 Bacteria 2262
382 Ga0495687_063485 3300047443 Bacteria 1511
383 Ga0495687_093766 3300047443 Bacteria 1143
384 Ga0495675_0004275 3300047444 Bacteria 8638
385 Ga0495675_0009313 3300047444 Bacteria 6109
386 Ga0495675_0011984 3300047444 Bacteria 5450
387 Ga0495675_0050466 3300047444 Bacteria 2644
388 Ga0495675_0079622 3300047444 Bacteria 2063
389 Ga0495679_000006 3300047446 Bacteria 449956
390 Ga0495679_000719 3300047446 Bacteria 21342
391 Ga0495679_010315 3300047446 Bacteria 3673
392 Ga0495673_0020522 3300047469 Bacteria 3287
393 Ga0495681_0025433 3300047470 Bacteria 3098
394 Ga0495684_0048782 3300047471 Bacteria 3237
395 Ga0495684_0161155 3300047471 Bacteria 1673
396 Ga0495686_0173655 3300047472 Bacteria 1252
397 Ga0495593_0003986 3300047673 Bacteria 8811
398 Ga0495593_0008882 3300047673 Bacteria 5831
399 Ga0495593_0011712 3300047673 Bacteria 5032
400 Ga0495593_0133482 3300047673 Bacteria 1259
401 Ga0495602_0024307 3300048088 Bacteria 5879
402 Ga0495602_0058566 3300048088 Bacteria 3370
403 Ga0495602_0088243 3300048088 Bacteria 2582
404 Ga0495602_0095230 3300048088 Bacteria 2458
405 Ga0495602_0170369 3300048088 Bacteria 1690
406 Ga0495602_0347881 3300048088 Bacteria 1070
407 Ga0495602_0612991 3300048088 Bacteria 747
408 Ga0495614_0000344 3300048089 Bacteria 18456
409 Ga0495614_0002139 3300048089 Bacteria 8747
410 Ga0495614_0075061 3300048089 Bacteria 1460
411 Ga0495626_0029197 3300048091 Bacteria 2670
412 Ga0496102_0003810 3300048905 Bacteria 12755
413 Ga0496102_1253806 3300048905 Bacteria 661
414 Ga0496103_0020933 3300048906 Bacteria 3932
415 Ga0496103_0254304 3300048906 Bacteria 1130
416 Ga0496106_0059972 3300048909 Bacteria 2884
417 Ga0496110_0300480 3300048913 Bacteria 1462
418 Ga0496112_0077359 3300048915 Bacteria 3290
419 Ga0496115_0409827 3300048918 Bacteria 1099
420 Ga0496117_0002712 3300048920 Bacteria 21807
421 Ga0496117_0034094 3300048920 Bacteria 3842
422 Ga0496117_0073660 3300048920 Bacteria 2277
423 Ga0496117_0254370 3300048920 Bacteria 956
424 Ga0496118_0001777 3300048921 Bacteria 31130
425 Ga0496118_0015397 3300048921 Bacteria 7079
426 Ga0496118_0047879 3300048921 Bacteria 3309
427 Ga0496120_0087351 3300048923 Bacteria 1674
428 Ga0496121_0000325 3300048924 Bacteria 100068
429 Ga0496121_0088649 3300048924 Bacteria 2425
430 Ga0496121_0378039 3300048924 Bacteria 935
431 Ga0496124_0000519 3300048927 Bacteria 65692
432 Ga0496126_0000102 3300048929 Bacteria 201540
433 Ga0496126_0070744 3300048929 Bacteria 3108
434 Ga0496126_0287499 3300048929 Bacteria 1360
435 Ga0496126_0515228 3300048929 Bacteria 954
436 Ga0495678_035319 3300049459 Bacteria 2050
437 Ga0495682_0012523 3300049460 Bacteria 3249
438 Ga0501031_0269178 3300049568 Bacteria 1106
439 Ga0501032_0067947 3300049569 Bacteria 2380
440 Ga0501033_0231590 3300049570 Bacteria 1312
441 Ga0501038_0098906 3300049574 Bacteria 2432
442 Ga0501047_0330801 3300049581 Bacteria 1362
443 Ga0501069_0111626 3300049585 Bacteria 1557
444 Ga0501070_0000002 3300049586 Bacteria 347524
445 Ga0501074_0543850 3300049590 Bacteria 822
446 Ga0501080_0058961 3300049742 Bacteria 3572
447 Ga0501035_0000660 3300049822 Bacteria 37978
448 Ga0501035_0119730 3300049822 Bacteria 2302
449 Ga0501035_0181400 3300049822 Bacteria 1814
450 Ga0501044_0009029 3300049823 Bacteria 10897
451 Ga0501044_0052434 3300049823 Bacteria 4203
452 Ga0501044_0161230 3300049823 Bacteria 2219
453 Ga0501044_0652249 3300049823 Bacteria 941
454 Ga0495655_0049663 3300053083 Bacteria 1105
455 Ga0500559_0004555 3300053136 Bacteria 6554
456 Ga0500616_0000239 3300053153 Bacteria 86415
457 Ga0500616_0054334 3300053153 Bacteria 2098
458 Ga0500661_007340 3300055283 Bacteria 2041
459 2509127106 2508501125 Bacteria 7208311
460 2512352197 2512047030 Bacteria 9031815
461 2513961141 2513237151 Bacteria 6309801
462 2515684444 2515154122 Bacteria 8609520
463 2527076636 2526164713 Bacteria 6780608
464 2738822051 2738541296 Bacteria 7285013
465 2738834533 2738541298 Bacteria 7286732
466 2738875737 2738541306 Bacteria 7284992
467 2739187689 2738543002 Bacteria 7284546
468 2739222335 2738543008 Bacteria 7282815
469 2739250176 2738543013 Bacteria 5618633
470 2746085539 2744054900 Bacteria 8399525
471 2746094916 2744054901 Bacteria 8397047
472 2753571416 2751185846 Bacteria 7242164
473 2842332286 2842324504 Bacteria 9364110
474 2842356543 2842348783 Bacteria 9002918
475 2842460877 2842454564 Bacteria 8730687
476 2863422134 2863421361 Bacteria 7300805
477 2885279274 2885270888 Bacteria 9831543
478 2900640491 2900634093 Bacteria 10263517
479 2902684843 2902682994 Bacteria 8951596
480 2904488893 2904483920 Bacteria 7545285
481 2904570624 2904564687 Bacteria 7609577
482 2904577801 2904571731 Bacteria 7608790
483 2909399207 2909399089 Bacteria 3922598
484 2919529503 2919527303 Bacteria 7718827
485 2928537956 2928536128 Bacteria 7657547
486 2945938498 2945934425 Bacteria 7444609
487 2990708500 2990703756 Bacteria 7715990
488 642423629 641736151 Bacteria 7477263
489 642616876 642555113 Bacteria 8214658
490 8004022169 8004021418 Bacteria 4313954
491 8018848472 8018845410 Bacteria 8933938
492 8055268758 8055266321 Bacteria 7999742
493 8055303527 8055301274 Bacteria 8587385
494 Ga0495649_0089337
495 JGI24739J22299_10002328
496 JGI24735J21928_10002298
497 JGI24735J21928_10011305
498 JGI24738J21930_10002540
499 JGI25156J39149_1000187
500 JGI25156J39149_1000487
501 JGI25165J46597_1000073
502 JGI25165J46597_1001477
503 rootH2_10022345
504 rootH2_10172420
505 rootH1_10160845
506 rootH1_10191040
507 Ga0055533_1000186
508 Ga0055532_1000007
509 Ga0055532_1000808
510 Ga0055525_1001606
511 Ga0055527_1000007
512 Ga0055527_1000167
513 Ga0055535_1000005
514 Ga0055535_1000382
515 Ga0055542_1000008
516 Ga0055542_1000408
517 Ga0055529_1000005
518 Ga0055529_1000436
519 Ga0055528_1003644
520 Ga0058692_1011349
521 Ga0070658_10004761
522 Ga0070658_10115475
523 Ga0070658_10179957
524 Ga0070658_10282352
525 Ga0070680_100004732
526 Ga0070680_100010337
527 Ga0070680_100315237
528 Ga0070680_100365479
529 Ga0070660_100200726
530 Ga0070660_100240078
531 Ga0070691_10278648
532 Ga0070661_100432359
533 Ga0070659_100138546
534 Ga0070667_100563111
535 Ga0070714_100037050
536 Ga0070713_100439070
537 Ga0070663_100291012
538 Ga0070663_100575780
539 Ga0070681_10369128
540 Ga0070681_10386386
541 Ga0070685_10050955
542 Ga0070706_100286892
543 Ga0070698_100058091
544 Ga0070698_100272723
545 Ga0070679_100026517
546 Ga0070679_100220147
547 Ga0068853_100416278
548 Ga0068853_100729753
549 Ga0068853_101214906
550 Ga0070693_100538655
551 Ga0070665_100307677
552 Ga0068855_100000274
553 Ga0068855_100013108
554 Ga0068855_100286190
555 Ga0070664_100681937
556 Ga0068856_100087950
557 Ga0068856_100770237
558 Ga0068852_100020868
559 Ga0070717_10244671
560 Ga0105251_10114099
561 Ga0105240_10000169
562 Ga0105240_10001012
563 Ga0105240_10028760
564 Ga0105240_10051446
565 Ga0105240_10076759
566 Ga0105240_10139027
567 Ga0105240_10263152
568 Ga0105240_10460186
569 Ga0105240_10822191
570 Ga0105242_11084592
571 Ga0105237_10391473
572 Ga0105238_10015660
573 Ga0105238_10204148
574 Ga0105238_10252517
575 Ga0105238_10907994
576 Ga0105238_11032764
577 Ga0157373_10133641
578 Ga0157370_10042594
579 Ga0157370_10399454
580 Ga0157369_10180574
581 Ga0157374_10768499
582 Ga0157378_10669941
583 Ga0157372_10032939
584 Ga0157372_10067105
585 Ga0157372_10091191
586 Ga0157372_10656632
587 Ga0182007_10002715
588 Ga0213872_10007416
589 Ga0209435_108595
590 Ga0209566_103846
591 Ga0209674_100020
592 Ga0209672_100013
593 Ga0209672_100067
594 Ga0209147_100012
595 Ga0209147_100013
596 Ga0209563_100797
597 Ga0207427_100621
598 Ga0209258_100016
599 Ga0209258_100107
600 Ga0209148_1000020
601 Ga0209148_1000022
602 Ga0209759_1000010
603 Ga0209759_1000022
604 Ga0209759_1000130
605 Ga0209233_1000055
606 Ga0209233_1000142
607 Ga0209565_1012972
608 Ga0209455_1000017
609 Ga0209455_1000024
610 Ga0209673_1000021
611 Ga0209130_1002618
612 Ga0209675_1009224
613 Ga0209675_1025733
614 Ga0209676_1005948
615 Ga0209564_1032426
616 Ga0209564_1061943
617 Ga0207647_10066153
618 Ga0207705_10002042
619 Ga0207705_10007771
620 Ga0207705_10346053
621 Ga0207707_10018999
622 Ga0207707_10020985
623 Ga0207695_10000003
624 Ga0207695_10000663
625 Ga0207695_10027402
626 Ga0207695_10031943
627 Ga0207695_10036413
628 Ga0207695_10107563
629 Ga0207695_10206664
630 Ga0207695_10588835
631 Ga0207695_10652534
632 Ga0207693_10066804
633 Ga0207693_10280070
634 Ga0207660_10337249
635 Ga0207660_10367869
636 Ga0207657_10000203
637 Ga0207657_10104030
638 Ga0207657_10284713
639 Ga0207649_10116686
640 Ga0207652_10020588
641 Ga0207652_10158037
642 Ga0207652_10406026
643 Ga0207694_10000016
644 Ga0207694_10040808
645 Ga0207694_10393178
646 Ga0207700_10420934
647 Ga0207664_10083980
648 Ga0207679_10584727
649 Ga0207667_10000021
650 Ga0207667_10009156
651 Ga0207667_10187713
652 Ga0207667_10322243
653 Ga0207640_10060508
654 Ga0207658_10479704
655 Ga0207639_10012260
656 Ga0207639_10645134
657 Ga0207678_10081203
658 Ga0207702_10077179
659 Ga0207683_10217936
660 Ga0207698_10016379
661 Ga0209371_1010788
662 Ga0268256_1011625
663 Ga0265327_10000004
664 Ga0265316_10381622
665 Ga0307408_100007870
666 Ga0265314_10011038
667 Ga0307412_10000002
668 Ga0307412_10015704
669 Ga0307416_100527362
670 Ga0307411_10581778
671 Ga0316582_0147828
672 Ga0395899_0000003
673 Ga0395900_0377778
674 Ga0395898_0010682
675 Ga0395898_0200372
676 Ga0395905_0147865
677 Ga0395905_0197626
678 Ga0436364_0107084
679 Ga0395901_0203001
680 Ga0395901_0701188
681 Ga0436360_0251974
682 Ga0436360_1061924
683 Ga0436361_0093789
684 Ga0436361_0470093
685 Ga0436361_0516069
686 Ga0436361_0736168
687 Ga0436361_1154293
688 Ga0436361_1167108
689 Ga0466969_0014936
690 Ga0466969_0073739
691 Ga0466966_0017102
692 Ga0466961_0009720
693 Ga0466970_0029888
694 Ga0466959_0004197
695 Ga0466959_0016125
696 Ga0466959_0290059
697 Ga0466959_0579742
698 Ga0495592_0016473
699 Ga0495592_0242117
700 Ga0495592_0405361
701 Ga0495603_0038061
702 Ga0495603_0201630
703 Ga0495590_0045706
704 Ga0495590_0108703
705 Ga0495591_005084
706 Ga0495629_0000030
707 Ga0495629_0003511
708 Ga0495629_0010518
709 Ga0495629_0012423
710 Ga0495629_0024476
711 Ga0495629_0057822
712 Ga0495641_0013246
713 Ga0495641_0095762
714 Ga0495651_0013807
715 Ga0495651_0109723
716 Ga0495653_0000659
717 Ga0495653_0004659
718 Ga0495653_0063007
719 Ga0495653_0281542
720 Ga0495653_0460409
721 Ga0495650_0002852
722 Ga0495650_0003866
723 Ga0495650_0056608
724 Ga0495580_0000021
725 Ga0495580_0008117
726 Ga0495580_0013588
727 Ga0495580_0017410
728 Ga0495580_0027191
729 Ga0495580_0092932
730 Ga0495580_0132349
731 Ga0495582_0005872
732 Ga0495582_0035622
733 Ga0495582_0231774
734 Ga0495605_0153646
735 Ga0495662_0006229
736 Ga0495662_0029286
737 Ga0495662_0066313
738 Ga0495664_0010682
739 Ga0495664_0062282
740 Ga0495594_0030710
741 Ga0495596_0002840
742 Ga0495596_0019356
743 Ga0495596_0027746
744 Ga0495583_0001977
745 Ga0495583_0002644
746 Ga0495606_0019878
747 Ga0495606_0026995
748 Ga0495606_0168936
749 Ga0495606_0169789
750 Ga0495608_0006058
751 Ga0495608_0007464
752 Ga0495610_0001730
753 Ga0495618_0004437
754 Ga0495618_0007087
755 Ga0495628_0000533
756 Ga0495628_0003671
757 Ga0495628_0012409
758 Ga0495628_0124157
759 Ga0495630_0014159
760 Ga0495630_0033580
761 Ga0495630_0275040
762 Ga0495630_1106454
763 Ga0495632_0191437
764 Ga0495648_0003932
765 Ga0495648_0011603
766 Ga0495648_0084433
767 Ga0495648_0148262
768 Ga0495666_0002173
769 Ga0495666_0014602
770 Ga0495666_0043337
771 Ga0495642_0012816
772 Ga0495652_0008639
773 Ga0495652_0020419
774 Ga0495652_0037760
775 Ga0495652_0204738
776 Ga0495652_0418638
777 Ga0495665_0001673
778 Ga0495665_0007565
779 Ga0495665_0041057
780 Ga0495665_0050299
781 Ga0495665_0083037
782 Ga0495640_0006128
783 Ga0495640_0018770
784 Ga0495640_0085882
785 Ga0495586_0002556
786 Ga0495586_0015029
787 Ga0495586_0029116
788 Ga0495586_0290278
789 Ga0495587_0003067
790 Ga0495587_0004575
791 Ga0495587_0008021
792 Ga0495597_0009615
793 Ga0495597_0193371
794 Ga0495645_0000313
795 Ga0495645_0077297
796 Ga0495645_0312561
797 Ga0495622_0000042
798 Ga0495667_0010619
799 Ga0495667_0019253
800 Ga0495634_0015399
801 Ga0495634_0054102
802 Ga0495611_0030450
803 Ga0495625_0224250
804 Ga0495635_0022235
805 Ga0495635_0046886
806 Ga0495635_0073903
807 Ga0495661_0004086
808 Ga0495661_0018461
809 Ga0495661_0116794
810 Ga0495657_0011210
811 Ga0495657_0013181
812 Ga0495599_0009084
813 Ga0495599_0020714
814 Ga0495599_0217885
815 Ga0495599_0255115
816 Ga0495599_0420098
817 Ga0495599_0546209
818 Ga0495623_0008327
819 Ga0495623_0008805
820 Ga0495623_0014865
821 Ga0495623_0025129
822 Ga0495646_0000488
823 Ga0495646_0041734
824 Ga0495613_0003590
825 Ga0495613_0025622
826 Ga0495624_0000074
827 Ga0495624_0000260
828 Ga0495624_0001937
829 Ga0495624_0058814
830 Ga0495624_0088846
831 Ga0495671_0012521
832 Ga0495671_0272203
833 Ga0495649_0006876
834 Ga0495649_0015738
835 Ga0495649_0246960
836 Ga0495589_0002526
837 Ga0495589_0031427
838 Ga0495589_0053902
839 Ga0495589_0065452
840 Ga0495589_0078114
841 Ga0495600_0005862
842 Ga0495600_0012695
843 Ga0495600_0039942
844 Ga0495581_0002698
845 Ga0495581_0007215
846 Ga0495581_0024741
847 Ga0495581_0116022
848 Ga0495604_0001898
849 Ga0495604_0008721
850 Ga0495604_0016422
851 Ga0495604_0037899
852 Ga0495604_0180086
853 Ga0495604_0238568
854 Ga0495604_0356095
855 Ga0495674_0019588
856 Ga0495674_0025085
857 Ga0495674_0084201
858 Ga0495674_0115090
859 Ga0495674_0121545
860 Ga0495672_0076209
861 Ga0495672_0110563
862 Ga0495676_0012255
863 Ga0495676_0134454
864 Ga0495676_0231507
865 Ga0495676_0265542
866 Ga0495676_0579165
867 Ga0495680_0002172
868 Ga0495680_0029181
869 Ga0495680_0062900
870 Ga0495680_0135465
871 Ga0495683_0002808
872 Ga0495683_0044852
873 Ga0495683_0058270
874 Ga0495687_035018
875 Ga0495687_063485
876 Ga0495687_093766
877 Ga0495675_0004275
878 Ga0495675_0009313
879 Ga0495675_0011984
880 Ga0495675_0050466
881 Ga0495675_0079622
882 Ga0495679_000006
883 Ga0495679_000719
884 Ga0495679_010315
885 Ga0495673_0020522
886 Ga0495681_0025433
887 Ga0495684_0048782
888 Ga0495684_0161155
889 Ga0495686_0173655
890 Ga0495593_0003986
891 Ga0495593_0008882
892 Ga0495593_0011712
893 Ga0495593_0133482
894 Ga0495602_0024307
895 Ga0495602_0058566
896 Ga0495602_0088243
897 Ga0495602_0095230
898 Ga0495602_0170369
899 Ga0495602_0347881
900 Ga0495602_0612991
901 Ga0495614_0000344
902 Ga0495614_0002139
903 Ga0495614_0075061
904 Ga0495626_0029197
905 Ga0496102_0003810
906 Ga0496102_1253806
907 Ga0496103_0020933
908 Ga0496103_0254304
909 Ga0496106_0059972
910 Ga0496110_0300480
911 Ga0496112_0077359
912 Ga0496115_0409827
913 Ga0496117_0002712
914 Ga0496117_0034094
915 Ga0496117_0073660
916 Ga0496117_0254370
917 Ga0496118_0001777
918 Ga0496118_0015397
919 Ga0496118_0047879
920 Ga0496120_0087351
921 Ga0496121_0000325
922 Ga0496121_0088649
923 Ga0496121_0378039
924 Ga0496124_0000519
925 Ga0496126_0000102
926 Ga0496126_0070744
927 Ga0496126_0287499
928 Ga0496126_0515228
929 Ga0495678_035319
930 Ga0495682_0012523
931 Ga0501031_0269178
932 Ga0501032_0067947
933 Ga0501033_0231590
934 Ga0501038_0098906
935 Ga0501047_0330801
936 Ga0501069_0111626
937 Ga0501070_0000002
938 Ga0501074_0543850
939 Ga0501080_0058961
940 Ga0501035_0000660
941 Ga0501035_0119730
942 Ga0501035_0181400
943 Ga0501044_0009029
944 Ga0501044_0052434
945 Ga0501044_0161230
946 Ga0501044_0652249
947 Ga0495655_0049663
948 Ga0500559_0004555
949 Ga0500616_0000239
950 Ga0500616_0054334
951 Ga0500661_007340
952 2509127106
953 2512352197
954 2513961141
955 2515684444
956 2527076636
957 2738822051
958 2738834533
959 2738875737
960 2739187689
961 2739222335
962 2739250176
963 2746085539
964 2746094916
965 2753571416
966 2842332286
967 2842356543
968 2842460877
969 2863422134
970 2885279274
971 2900640491
972 2902684843
973 2904488893
974 2904570624
975 2904577801
976 2909399207
977 2919529503
978 2928537956
979 2945938498
980 2990708500
981 642423629
982 642616876
983 8004022169
984 8018848472
985 8055268758
986 8055303527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

10

177

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j2r-assembly1.cif.gz_A crystal structure of escherichia coli gene product yecd at 1.3 a resolution 0.9201 3 181
3txy-assembly1.cif.gz_A-2 structure of an isochorismatase family protein (bth_ii2229) from burkholderia thailandensis 0.9063 5 183
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.8987 4 182
1j2r-assembly1.cif.gz_A crystal structure of escherichia coli gene product yecd at 1.3 a resolution 0.8778 3 181
1xn4-assembly1.cif.gz_A putative mar1 ribonuclease from leishmania major 0.8733 9 184
ID Description Score Start End Superfamily
1j2rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9283 9 180 3.40.50.850
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9147 8 184 3.40.50.850
af_Q2G1H1_2_165_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9099 26 182 3.40.50.850
3txyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9063 5 183 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8837 9 184 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2Z7A0Q6-F1-model_v4 Isochorismatase-like domain-containing protein 0.9695 71 187 GO:0016787
AF-E8X310-F1-model_v4 Isochorismatase hydrolase 0.9659 1 183 GO:0016787
AF-A0A2N9MDT6-F1-model_v4 Isochorismatase hydrolase (Modular protein) 0.9617 1 185 GO:0016787
AF-A0A7W9Z460-F1-model_v4 Nicotinamidase-related amidase 0.9601 1 187 GO:0016787
AF-A0A286EM15-F1-model_v4 Nicotinamidase-related amidase 0.9579 1 184 GO:0005886
GO:0022857

Map