F454481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 493 | 306 | 433 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0472173|Ga0496104_0472173_157_1134 |
| Length | 325 |
| Sequence | VDNGSQAKENTVVVFGGTGFLGRRVVRHLRAHEVSVRIASRHPDRGYELFGRDDPNLQSVGANIHNERSVADALVGAYGVVNAVSLYVEQGQETFQSVHVESARLIAARARQAGVQRLVHVSGIGSDAGSPSLYIRKRGEGELAVRGAFADAILIRPAVMVGPDDSFLTTILKLLRFPIYPMFGRGRTRLQPAYVEDVAEGIARALQGSAKNAVTFECGGPRVYSYEDLLRTVAHQAHLKPLLIPVPFAAWHAIAGVAELFPSPPVTRNQVELMQVDNVTSPEMPGFAELAISPRSVEEILQEILSGGPYRSRGGEGSHRSGPVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 7 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 8 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 9 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 10 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 11 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 12 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 13 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 14 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 15 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 16 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 17 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 18 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 19 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 20 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 21 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 22 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 23 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 24 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 25 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 26 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 27 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 28 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 29 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 30 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 31 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 32 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 33 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 34 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 35 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 36 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 37 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 38 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 39 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 40 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 41 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 42 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 43 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 44 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 45 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 46 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 47 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 48 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 49 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 50 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 51 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 52 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 53 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 54 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 134 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 135 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 136 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 140 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 149 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 155 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 258 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 271 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 274 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 275 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 276 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 277 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 278 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 279 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 280 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 281 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 282 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 283 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 284 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 286 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 287 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 289 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 294 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 296 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 297 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 302 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 303 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 304 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 305 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 306 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.63 |
| Metatranscriptomes | 0.2 |
| Isolates | 12.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.72 |
| Nodule | 10.55 |
| Rhizoplane | 8.32 |
| Rhizosphere | 67.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100213830 | 3300005331 | Bacteria | 1677 |
| 2 | Ga0070689_100018646 | 3300005340 | Bacteria | 5117 |
| 3 | Ga0070673_100107175 | 3300005364 | Bacteria | 2311 |
| 4 | Ga0070659_100371927 | 3300005366 | Bacteria | 1202 |
| 5 | Ga0070667_100215838 | 3300005367 | Bacteria | 1706 |
| 6 | Ga0070713_100045080 | 3300005436 | Bacteria | 3612 |
| 7 | Ga0070713_100116036 | 3300005436 | Bacteria | 2341 |
| 8 | Ga0070708_100451648 | 3300005445 | Bacteria | 1212 |
| 9 | Ga0070662_100056222 | 3300005457 | Bacteria | 2856 |
| 10 | Ga0070706_100189950 | 3300005467 | Bacteria | 1919 |
| 11 | Ga0070698_100014542 | 3300005471 | Bacteria | 8308 |
| 12 | Ga0070697_100132438 | 3300005536 | Bacteria | 2092 |
| 13 | Ga0070697_100458216 | 3300005536 | Bacteria | 1111 |
| 14 | Ga0070686_100079431 | 3300005544 | Bacteria | 2168 |
| 15 | Ga0070665_100199568 | 3300005548 | Bacteria | 2001 |
| 16 | Ga0068855_100063084 | 3300005563 | Bacteria | 4325 |
| 17 | Ga0070664_100160869 | 3300005564 | Bacteria | 1986 |
| 18 | Ga0068858_100042283 | 3300005842 | Bacteria | 4225 |
| 19 | Ga0068860_100207670 | 3300005843 | Bacteria | 1899 |
| 20 | Ga0081455_10000637 | 3300005937 | Bacteria | 45442 |
| 21 | Ga0081455_10000930 | 3300005937 | Bacteria | 37470 |
| 22 | Ga0081455_10002589 | 3300005937 | Bacteria | 21449 |
| 23 | Ga0081455_10016270 | 3300005937 | Bacteria | 7188 |
| 24 | Ga0081455_10017266 | 3300005937 | Bacteria | 6926 |
| 25 | Ga0081455_10035763 | 3300005937 | Bacteria | 4433 |
| 26 | Ga0070717_10051852 | 3300006028 | Bacteria | 3378 |
| 27 | Ga0070717_10201771 | 3300006028 | Bacteria | 1742 |
| 28 | Ga0070717_10212178 | 3300006028 | Bacteria | 1699 |
| 29 | Ga0075365_10042780 | 3300006038 | Bacteria | 2963 |
| 30 | Ga0075364_10032190 | 3300006051 | Bacteria | 3369 |
| 31 | Ga0070712_100013364 | 3300006175 | Bacteria | 5246 |
| 32 | Ga0070712_100160426 | 3300006175 | Bacteria | 1736 |
| 33 | Ga0070712_100277075 | 3300006175 | Bacteria | 1350 |
| 34 | Ga0075369_10014361 | 3300006186 | Bacteria | 3162 |
| 35 | Ga0068871_100080559 | 3300006358 | Bacteria | 2696 |
| 36 | Ga0075428_100026409 | 3300006844 | Bacteria | 6428 |
| 37 | Ga0075428_100086785 | 3300006844 | Bacteria | 3413 |
| 38 | Ga0075428_100099825 | 3300006844 | Bacteria | 3165 |
| 39 | Ga0075428_100134824 | 3300006844 | Bacteria | 2685 |
| 40 | Ga0075430_100024610 | 3300006846 | Bacteria | 5121 |
| 41 | Ga0075431_100067519 | 3300006847 | Bacteria | 3691 |
| 42 | Ga0075431_100474464 | 3300006847 | Bacteria | 1244 |
| 43 | Ga0075433_10173967 | 3300006852 | Bacteria | 1915 |
| 44 | Ga0075429_100112295 | 3300006880 | Bacteria | 2382 |
| 45 | Ga0075429_100265214 | 3300006880 | Bacteria | 1504 |
| 46 | Ga0099823_1020249 | 3300006944 | Bacteria | 6298 |
| 47 | Ga0075435_100114999 | 3300007076 | Bacteria | 2240 |
| 48 | Ga0099794_10015700 | 3300007265 | Bacteria | 3347 |
| 49 | Ga0099794_10015925 | 3300007265 | Bacteria | 3326 |
| 50 | Ga0105251_10050346 | 3300009011 | Bacteria | 1990 |
| 51 | Ga0105251_10125249 | 3300009011 | Bacteria | 1166 |
| 52 | Ga0105240_10097376 | 3300009093 | Bacteria | 3585 |
| 53 | Ga0111539_10316918 | 3300009094 | Bacteria | 1815 |
| 54 | Ga0111539_10492804 | 3300009094 | Bacteria | 1427 |
| 55 | Ga0111539_10522281 | 3300009094 | Bacteria | 1383 |
| 56 | Ga0105245_10175400 | 3300009098 | Bacteria | 2044 |
| 57 | Ga0105245_10326932 | 3300009098 | Bacteria | 1512 |
| 58 | Ga0105245_10497549 | 3300009098 | Bacteria | 1235 |
| 59 | Ga0114129_10013167 | 3300009147 | Bacteria | 11783 |
| 60 | Ga0114129_10051866 | 3300009147 | Bacteria | 5758 |
| 61 | Ga0114129_10080691 | 3300009147 | Bacteria | 4522 |
| 62 | Ga0114129_10105785 | 3300009147 | Bacteria | 3888 |
| 63 | Ga0114129_10177513 | 3300009147 | Bacteria | 2900 |
| 64 | Ga0114129_10281744 | 3300009147 | Bacteria | 2221 |
| 65 | Ga0105242_10140256 | 3300009176 | Bacteria | 2097 |
| 66 | Ga0105248_10062004 | 3300009177 | Bacteria | 4199 |
| 67 | Ga0105248_10544967 | 3300009177 | Bacteria | 1309 |
| 68 | Ga0105237_10108344 | 3300009545 | Bacteria | 2769 |
| 69 | Ga0105237_10146790 | 3300009545 | Bacteria | 2354 |
| 70 | Ga0105237_10432989 | 3300009545 | Bacteria | 1321 |
| 71 | Ga0105238_10123848 | 3300009551 | Bacteria | 2564 |
| 72 | Ga0105239_10118699 | 3300010375 | Bacteria | 2935 |
| 73 | Ga0105239_10348308 | 3300010375 | Bacteria | 1672 |
| 74 | Ga0105239_10514706 | 3300010375 | Bacteria | 1361 |
| 75 | Ga0105246_10141711 | 3300011119 | Bacteria | 1808 |
| 76 | Ga0157370_10040742 | 3300013104 | Bacteria | 4484 |
| 77 | Ga0157370_10277742 | 3300013104 | Bacteria | 1548 |
| 78 | Ga0157369_10014923 | 3300013105 | Bacteria | 8768 |
| 79 | Ga0157369_10022574 | 3300013105 | Bacteria | 7019 |
| 80 | Ga0157374_10068359 | 3300013296 | Bacteria | 3342 |
| 81 | Ga0157374_10182823 | 3300013296 | Bacteria | 2049 |
| 82 | Ga0157374_10349278 | 3300013296 | Bacteria | 1470 |
| 83 | Ga0157378_10115641 | 3300013297 | Bacteria | 2465 |
| 84 | Ga0163162_10106925 | 3300013306 | Bacteria | 2893 |
| 85 | Ga0163162_10273556 | 3300013306 | Bacteria | 1821 |
| 86 | Ga0163162_10277047 | 3300013306 | Unclassified | 1809 |
| 87 | Ga0157372_10357207 | 3300013307 | Bacteria | 1702 |
| 88 | Ga0157372_10778183 | 3300013307 | Bacteria | 1112 |
| 89 | Ga0163163_10007784 | 3300014325 | Bacteria | 9468 |
| 90 | Ga0163163_10016453 | 3300014325 | Bacteria | 6876 |
| 91 | Ga0163163_10040195 | 3300014325 | Bacteria | 4567 |
| 92 | Ga0163163_10129501 | 3300014325 | Bacteria | 2563 |
| 93 | Ga0182008_10050035 | 3300014497 | Bacteria | 2074 |
| 94 | Ga0182008_10065154 | 3300014497 | Bacteria | 1793 |
| 95 | Ga0157377_10141494 | 3300014745 | Bacteria | 1479 |
| 96 | Ga0157379_10087760 | 3300014968 | Bacteria | 2789 |
| 97 | Ga0157379_10247297 | 3300014968 | Bacteria | 1618 |
| 98 | Ga0157376_10215302 | 3300014969 | Bacteria | 1776 |
| 99 | Ga0224712_10000657 | 3300022467 | Bacteria | 7084 |
| 100 | Ga0207684_10163747 | 3300025910 | Bacteria | 1916 |
| 101 | Ga0207684_10206337 | 3300025910 | Bacteria | 1695 |
| 102 | Ga0207654_10027016 | 3300025911 | Bacteria | 3116 |
| 103 | Ga0207654_10120798 | 3300025911 | Bacteria | 1645 |
| 104 | Ga0207707_10032511 | 3300025912 | Bacteria | 4566 |
| 105 | Ga0207695_10388263 | 3300025913 | Bacteria | 1281 |
| 106 | Ga0207693_10006496 | 3300025915 | Bacteria | 9681 |
| 107 | Ga0207663_10216503 | 3300025916 | Bacteria | 1391 |
| 108 | Ga0207652_10030777 | 3300025921 | Bacteria | 4498 |
| 109 | Ga0207650_10033992 | 3300025925 | Bacteria | 3696 |
| 110 | Ga0207650_10167170 | 3300025925 | Bacteria | 1746 |
| 111 | Ga0207700_10001928 | 3300025928 | Bacteria | 11801 |
| 112 | Ga0207700_10030347 | 3300025928 | Bacteria | 3827 |
| 113 | Ga0207700_10058663 | 3300025928 | Bacteria | 2908 |
| 114 | Ga0207664_10075166 | 3300025929 | Bacteria | 2731 |
| 115 | Ga0207670_10016818 | 3300025936 | Bacteria | 4407 |
| 116 | Ga0207669_10078787 | 3300025937 | Bacteria | 2101 |
| 117 | Ga0207704_10049036 | 3300025938 | Bacteria | 2537 |
| 118 | Ga0207665_10126626 | 3300025939 | Bacteria | 1809 |
| 119 | Ga0207689_10420576 | 3300025942 | Bacteria | 1115 |
| 120 | Ga0207661_10000630 | 3300025944 | Bacteria | 22633 |
| 121 | Ga0207679_10221233 | 3300025945 | Bacteria | 1593 |
| 122 | Ga0207651_10071957 | 3300025960 | Unclassified | 2453 |
| 123 | Ga0207651_10282004 | 3300025960 | Bacteria | 1374 |
| 124 | Ga0207668_10062222 | 3300025972 | Bacteria | 2627 |
| 125 | Ga0207668_10098373 | 3300025972 | Bacteria | 2168 |
| 126 | Ga0207658_10233103 | 3300025986 | Bacteria | 1555 |
| 127 | Ga0207678_10065388 | 3300026067 | Bacteria | 3123 |
| 128 | Ga0207678_10074054 | 3300026067 | Bacteria | 2918 |
| 129 | Ga0207678_10139978 | 3300026067 | Bacteria | 2065 |
| 130 | Ga0207674_10063082 | 3300026116 | Bacteria | 3741 |
| 131 | Ga0207683_10063761 | 3300026121 | Bacteria | 3247 |
| 132 | Ga0209389_1000015 | 3300027296 | Bacteria | 188311 |
| 133 | Ga0209489_100072 | 3300027361 | Bacteria | 138111 |
| 134 | Ga0209700_100034 | 3300027363 | Bacteria | 197276 |
| 135 | Ga0209588_1006717 | 3300027671 | Bacteria | 3359 |
| 136 | Ga0265332_10059134 | 3300031238 | Bacteria | 1641 |
| 137 | Ga0307509_10023867 | 3300031507 | Bacteria | 6856 |
| 138 | Ga0307516_10003424 | 3300031730 | Bacteria | 20395 |
| 139 | Ga0307516_10041981 | 3300031730 | Bacteria | 4541 |
| 140 | Ga0307516_10057682 | 3300031730 | Bacteria | 3781 |
| 141 | Ga0307516_10295501 | 3300031730 | Bacteria | 1297 |
| 142 | Ga0307516_10318835 | 3300031730 | Bacteria | 1226 |
| 143 | Ga0307507_10140147 | 3300033179 | Bacteria | 1857 |
| 144 | Ga0307510_10020175 | 3300033180 | Bacteria | 7797 |
| 145 | Ga0307510_10305770 | 3300033180 | Bacteria | 1051 |
| 146 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 147 | Ga0373926_0009466 | 3300035083 | Bacteria | 3256 |
| 148 | Ga0373953_0045970 | 3300035117 | Bacteria | 1752 |
| 149 | Ga0373943_0014764 | 3300035170 | Bacteria | 3542 |
| 150 | Ga0373943_0094845 | 3300035170 | Bacteria | 1551 |
| 151 | Ga0373946_0020050 | 3300035171 | Bacteria | 2581 |
| 152 | Ga0373935_0021576 | 3300035692 | Bacteria | 3944 |
| 153 | Ga0373927_0034568 | 3300035695 | Bacteria | 3288 |
| 154 | Ga0373927_0069794 | 3300035695 | Bacteria | 2274 |
| 155 | Ga0373947_0023431 | 3300035725 | Bacteria | 3590 |
| 156 | Ga0373937_0023784 | 3300036401 | Bacteria | 5523 |
| 157 | Ga0395900_0067465 | 3300037418 | Bacteria | 3675 |
| 158 | Ga0395898_0305245 | 3300037466 | Bacteria | 1518 |
| 159 | Ga0395901_0088761 | 3300038443 | Bacteria | 3234 |
| 160 | Ga0395901_0134949 | 3300038443 | Bacteria | 2594 |
| 161 | Ga0436360_0994312 | 3300039438 | Bacteria | 1911 |
| 162 | Ga0495617_013706 | 3300046452 | Bacteria | 2756 |
| 163 | Ga0495592_0085352 | 3300046454 | Unclassified | 2276 |
| 164 | Ga0495603_0044040 | 3300046455 | Bacteria | 2663 |
| 165 | Ga0495603_0104234 | 3300046455 | Bacteria | 1655 |
| 166 | Ga0495629_0045329 | 3300046459 | Bacteria | 3085 |
| 167 | Ga0495629_0052354 | 3300046459 | Bacteria | 2856 |
| 168 | Ga0495638_0004740 | 3300046460 | Bacteria | 10261 |
| 169 | Ga0495638_0005224 | 3300046460 | Bacteria | 9701 |
| 170 | Ga0495641_0032011 | 3300046461 | Bacteria | 2507 |
| 171 | Ga0495651_0072702 | 3300046462 | Bacteria | 2611 |
| 172 | Ga0495650_0060289 | 3300046471 | Bacteria | 1524 |
| 173 | Ga0495580_0092695 | 3300046472 | Bacteria | 2103 |
| 174 | Ga0495580_0105181 | 3300046472 | Bacteria | 1961 |
| 175 | Ga0495582_0057462 | 3300046473 | Bacteria | 2145 |
| 176 | Ga0495639_0029315 | 3300046475 | Bacteria | 2442 |
| 177 | Ga0495639_0122574 | 3300046475 | Bacteria | 1241 |
| 178 | Ga0495639_0139947 | 3300046475 | Bacteria | 1163 |
| 179 | Ga0495664_0029533 | 3300046477 | Bacteria | 3207 |
| 180 | Ga0495664_0031784 | 3300046477 | Unclassified | 3095 |
| 181 | Ga0495664_0103340 | 3300046477 | Bacteria | 1718 |
| 182 | Ga0495584_0012550 | 3300046491 | Bacteria | 4325 |
| 183 | Ga0495584_0036478 | 3300046491 | Bacteria | 2484 |
| 184 | Ga0495584_0097673 | 3300046491 | Bacteria | 1484 |
| 185 | Ga0495584_0107150 | 3300046491 | Bacteria | 1413 |
| 186 | Ga0495585_0025666 | 3300046492 | Bacteria | 3372 |
| 187 | Ga0495585_0050527 | 3300046492 | Bacteria | 2306 |
| 188 | Ga0495594_0037382 | 3300046499 | Bacteria | 2649 |
| 189 | Ga0495594_0049923 | 3300046499 | Bacteria | 2300 |
| 190 | Ga0495594_0064619 | 3300046499 | Bacteria | 2029 |
| 191 | Ga0495596_0021978 | 3300046500 | Bacteria | 2599 |
| 192 | Ga0495596_0023563 | 3300046500 | Bacteria | 2496 |
| 193 | Ga0495607_0012881 | 3300046501 | Bacteria | 5500 |
| 194 | Ga0495607_0109979 | 3300046501 | Bacteria | 1462 |
| 195 | Ga0495607_0112566 | 3300046501 | Bacteria | 1441 |
| 196 | Ga0495583_0036141 | 3300046506 | Bacteria | 2352 |
| 197 | Ga0495610_0035722 | 3300046512 | Bacteria | 2548 |
| 198 | Ga0495616_0013005 | 3300046513 | Bacteria | 4706 |
| 199 | Ga0495616_0053921 | 3300046513 | Bacteria | 1996 |
| 200 | Ga0495618_0012254 | 3300046514 | Bacteria | 5205 |
| 201 | Ga0495620_0033821 | 3300046515 | Bacteria | 2316 |
| 202 | Ga0495630_0106514 | 3300046517 | Bacteria | 2123 |
| 203 | Ga0495630_0183498 | 3300046517 | Bacteria | 1596 |
| 204 | Ga0495631_0031154 | 3300046518 | Bacteria | 2415 |
| 205 | Ga0495631_0053982 | 3300046518 | Bacteria | 1753 |
| 206 | Ga0495632_0032990 | 3300046519 | Bacteria | 2662 |
| 207 | Ga0495632_0069029 | 3300046519 | Bacteria | 1702 |
| 208 | Ga0495644_0007531 | 3300046523 | Bacteria | 4196 |
| 209 | Ga0495644_0008945 | 3300046523 | Bacteria | 3850 |
| 210 | Ga0495644_0020835 | 3300046523 | Bacteria | 2500 |
| 211 | Ga0495648_0009128 | 3300046524 | Bacteria | 7732 |
| 212 | Ga0495648_0013712 | 3300046524 | Bacteria | 5974 |
| 213 | Ga0495648_0026804 | 3300046524 | Bacteria | 3871 |
| 214 | Ga0495648_0032919 | 3300046524 | Bacteria | 3393 |
| 215 | Ga0495663_0003143 | 3300046525 | Bacteria | 4818 |
| 216 | Ga0495663_0009716 | 3300046525 | Bacteria | 2669 |
| 217 | Ga0495663_0058227 | 3300046525 | Bacteria | 1210 |
| 218 | Ga0495666_0030424 | 3300046526 | Bacteria | 2649 |
| 219 | Ga0495666_0094417 | 3300046526 | Bacteria | 1411 |
| 220 | Ga0495642_0018060 | 3300046528 | Bacteria | 2758 |
| 221 | Ga0495642_0139012 | 3300046528 | Bacteria | 1048 |
| 222 | Ga0495665_0029119 | 3300046531 | Bacteria | 2960 |
| 223 | Ga0495640_0019583 | 3300046533 | Bacteria | 4991 |
| 224 | Ga0495640_0104844 | 3300046533 | Bacteria | 1853 |
| 225 | Ga0495640_0176001 | 3300046533 | Bacteria | 1366 |
| 226 | Ga0495640_0228120 | 3300046533 | Bacteria | 1172 |
| 227 | Ga0495586_0086792 | 3300046535 | Bacteria | 1725 |
| 228 | Ga0495586_0141138 | 3300046535 | Bacteria | 1352 |
| 229 | Ga0495598_0001732 | 3300046537 | Bacteria | 4376 |
| 230 | Ga0495598_0005236 | 3300046537 | Bacteria | 2861 |
| 231 | Ga0495609_0064717 | 3300046538 | Bacteria | 1612 |
| 232 | Ga0495621_0002644 | 3300046539 | Bacteria | 4844 |
| 233 | Ga0495621_0017625 | 3300046539 | Bacteria | 2310 |
| 234 | Ga0495597_0013712 | 3300046542 | Bacteria | 3875 |
| 235 | Ga0495645_0316365 | 3300046543 | Bacteria | 1015 |
| 236 | Ga0495622_0063490 | 3300046557 | Bacteria | 1709 |
| 237 | Ga0495633_0017030 | 3300046558 | Bacteria | 3727 |
| 238 | Ga0495656_0007832 | 3300046615 | Bacteria | 3794 |
| 239 | Ga0495656_0012919 | 3300046615 | Bacteria | 3095 |
| 240 | Ga0495656_0039528 | 3300046615 | Bacteria | 1960 |
| 241 | Ga0495656_0152869 | 3300046615 | Bacteria | 1116 |
| 242 | Ga0495634_0011334 | 3300046642 | Bacteria | 6492 |
| 243 | Ga0495634_0027510 | 3300046642 | Bacteria | 3956 |
| 244 | Ga0495634_0086331 | 3300046642 | Bacteria | 2044 |
| 245 | Ga0495611_0003456 | 3300046648 | Bacteria | 6963 |
| 246 | Ga0495611_0050802 | 3300046648 | Bacteria | 1868 |
| 247 | Ga0495611_0131888 | 3300046648 | Bacteria | 1165 |
| 248 | Ga0495625_0041966 | 3300046660 | Bacteria | 3326 |
| 249 | Ga0495625_0117097 | 3300046660 | Bacteria | 1816 |
| 250 | Ga0495635_0087519 | 3300046663 | Bacteria | 2132 |
| 251 | Ga0495635_0290789 | 3300046663 | Bacteria | 1096 |
| 252 | Ga0495659_0013958 | 3300046664 | Bacteria | 2621 |
| 253 | Ga0495659_0043694 | 3300046664 | Bacteria | 1609 |
| 254 | Ga0495661_0042919 | 3300046665 | Bacteria | 2784 |
| 255 | Ga0495661_0045872 | 3300046665 | Bacteria | 2670 |
| 256 | Ga0495588_0026223 | 3300046674 | Bacteria | 2908 |
| 257 | Ga0495599_0013289 | 3300046678 | Bacteria | 5088 |
| 258 | Ga0495599_0059081 | 3300046678 | Bacteria | 2398 |
| 259 | Ga0495599_0061252 | 3300046678 | Bacteria | 2352 |
| 260 | Ga0495646_0011795 | 3300046680 | Bacteria | 5557 |
| 261 | Ga0495647_0034436 | 3300046681 | Bacteria | 1896 |
| 262 | Ga0495647_0059482 | 3300046681 | Bacteria | 1505 |
| 263 | Ga0495647_0076341 | 3300046681 | Bacteria | 1350 |
| 264 | Ga0495658_0008984 | 3300046683 | Bacteria | 4967 |
| 265 | Ga0495658_0214935 | 3300046683 | Bacteria | 1202 |
| 266 | Ga0495669_0013034 | 3300046684 | Bacteria | 3542 |
| 267 | Ga0495669_0153283 | 3300046684 | Bacteria | 1092 |
| 268 | Ga0495624_0123856 | 3300046690 | Bacteria | 1587 |
| 269 | Ga0495670_0010100 | 3300046691 | Bacteria | 4642 |
| 270 | Ga0495670_0023393 | 3300046691 | Bacteria | 3049 |
| 271 | Ga0495671_0104385 | 3300046692 | Bacteria | 1384 |
| 272 | Ga0495649_0014945 | 3300046694 | Bacteria | 4435 |
| 273 | Ga0495649_0022162 | 3300046694 | Bacteria | 3554 |
| 274 | Ga0495649_0058322 | 3300046694 | Bacteria | 2080 |
| 275 | Ga0495589_0072984 | 3300046794 | Bacteria | 1675 |
| 276 | Ga0495589_0164340 | 3300046794 | Bacteria | 1057 |
| 277 | Ga0495600_0137900 | 3300046809 | Bacteria | 1583 |
| 278 | Ga0495660_0136906 | 3300046810 | Bacteria | 1223 |
| 279 | Ga0495581_0091788 | 3300047315 | Unclassified | 1762 |
| 280 | Ga0495581_0202153 | 3300047315 | Bacteria | 1162 |
| 281 | Ga0495581_0214058 | 3300047315 | Bacteria | 1126 |
| 282 | Ga0495636_0004278 | 3300047318 | Bacteria | 5603 |
| 283 | Ga0495636_0030330 | 3300047318 | Bacteria | 2210 |
| 284 | Ga0495674_0075023 | 3300047319 | Unclassified | 2911 |
| 285 | Ga0495674_0089312 | 3300047319 | Bacteria | 2634 |
| 286 | Ga0495674_0093920 | 3300047319 | Unclassified | 2559 |
| 287 | Ga0495672_0099892 | 3300047320 | Bacteria | 1576 |
| 288 | Ga0495672_0145695 | 3300047320 | Bacteria | 1232 |
| 289 | Ga0495676_0161495 | 3300047321 | Bacteria | 1585 |
| 290 | Ga0495676_0182305 | 3300047321 | Bacteria | 1471 |
| 291 | Ga0495676_0253636 | 3300047321 | Bacteria | 1199 |
| 292 | Ga0495683_0109302 | 3300047323 | Bacteria | 1321 |
| 293 | Ga0495675_0098661 | 3300047444 | Bacteria | 1830 |
| 294 | Ga0495675_0199144 | 3300047444 | Bacteria | 1220 |
| 295 | Ga0495677_0027355 | 3300047445 | Bacteria | 2070 |
| 296 | Ga0495677_0079559 | 3300047445 | Bacteria | 1227 |
| 297 | Ga0495679_007805 | 3300047446 | Bacteria | 4415 |
| 298 | Ga0495679_031334 | 3300047446 | Bacteria | 1716 |
| 299 | Ga0495685_031062 | 3300047447 | Bacteria | 1837 |
| 300 | Ga0495673_0015090 | 3300047469 | Bacteria | 3992 |
| 301 | Ga0495673_0016971 | 3300047469 | Bacteria | 3708 |
| 302 | Ga0495681_0038563 | 3300047470 | Bacteria | 2340 |
| 303 | Ga0495684_0079622 | 3300047471 | Bacteria | 2487 |
| 304 | Ga0495684_0104252 | 3300047471 | Bacteria | 2143 |
| 305 | Ga0495684_0127198 | 3300047471 | Bacteria | 1916 |
| 306 | Ga0495686_0025512 | 3300047472 | Bacteria | 3873 |
| 307 | Ga0495686_0046719 | 3300047472 | Bacteria | 2735 |
| 308 | Ga0495602_0016616 | 3300048088 | Bacteria | 7397 |
| 309 | Ga0495602_0045305 | 3300048088 | Bacteria | 3981 |
| 310 | Ga0495602_0076302 | 3300048088 | Bacteria | 2840 |
| 311 | Ga0495602_0151933 | 3300048088 | Bacteria | 1819 |
| 312 | Ga0495615_0000613 | 3300048090 | Bacteria | 5013 |
| 313 | Ga0495615_0005456 | 3300048090 | Bacteria | 2288 |
| 314 | Ga0496100_0133060 | 3300048903 | Bacteria | 1754 |
| 315 | Ga0496101_0343794 | 3300048904 | Bacteria | 1172 |
| 316 | Ga0496102_0274358 | 3300048905 | Bacteria | 1590 |
| 317 | Ga0496102_0326728 | 3300048905 | Bacteria | 1445 |
| 318 | Ga0496103_0037022 | 3300048906 | Bacteria | 2990 |
| 319 | Ga0496104_0063652 | 3300048907 | Bacteria | 3498 |
| 320 | Ga0496104_0262825 | 3300048907 | Bacteria | 1638 |
| 321 | Ga0496104_0298069 | 3300048907 | Bacteria | 1524 |
| 322 | Ga0496104_0298716 | 3300048907 | Bacteria | 1522 |
| 323 | Ga0496104_0472173 | 3300048907 | Bacteria | 1166 |
| 324 | Ga0496105_0019695 | 3300048908 | Bacteria | 5444 |
| 325 | Ga0496105_0074691 | 3300048908 | Bacteria | 2800 |
| 326 | Ga0496105_0201710 | 3300048908 | Bacteria | 1623 |
| 327 | Ga0496106_0078106 | 3300048909 | Bacteria | 2539 |
| 328 | Ga0496107_0086322 | 3300048910 | Bacteria | 2290 |
| 329 | Ga0496108_0004786 | 3300048911 | Bacteria | 10919 |
| 330 | Ga0496108_0006710 | 3300048911 | Bacteria | 9321 |
| 331 | Ga0496108_0022680 | 3300048911 | Bacteria | 5163 |
| 332 | Ga0496109_0004008 | 3300048912 | Bacteria | 12300 |
| 333 | Ga0496109_0021570 | 3300048912 | Bacteria | 5697 |
| 334 | Ga0496109_0028693 | 3300048912 | Bacteria | 4980 |
| 335 | Ga0496109_0141144 | 3300048912 | Bacteria | 2252 |
| 336 | Ga0496110_0021863 | 3300048913 | Bacteria | 5423 |
| 337 | Ga0496110_0125219 | 3300048913 | Bacteria | 2318 |
| 338 | Ga0496110_0253279 | 3300048913 | Bacteria | 1602 |
| 339 | Ga0496110_0359057 | 3300048913 | Bacteria | 1327 |
| 340 | Ga0496111_0004217 | 3300048914 | Bacteria | 9053 |
| 341 | Ga0496111_0053084 | 3300048914 | Bacteria | 2928 |
| 342 | Ga0496111_0075785 | 3300048914 | Bacteria | 2451 |
| 343 | Ga0496112_0014107 | 3300048915 | Bacteria | 7399 |
| 344 | Ga0496112_0026947 | 3300048915 | Bacteria | 5539 |
| 345 | Ga0496112_0040574 | 3300048915 | Bacteria | 4551 |
| 346 | Ga0496112_0235721 | 3300048915 | Bacteria | 1783 |
| 347 | Ga0496112_0254779 | 3300048915 | Bacteria | 1705 |
| 348 | Ga0496113_0000306 | 3300048916 | Bacteria | 23294 |
| 349 | Ga0496113_0009900 | 3300048916 | Bacteria | 6280 |
| 350 | Ga0496113_0154044 | 3300048916 | Bacteria | 1814 |
| 351 | Ga0496114_0397569 | 3300048917 | Bacteria | 1220 |
| 352 | Ga0496115_0016002 | 3300048918 | Bacteria | 5704 |
| 353 | Ga0496115_0093469 | 3300048918 | Bacteria | 2459 |
| 354 | Ga0496125_0059384 | 3300048928 | Bacteria | 3082 |
| 355 | Ga0496126_0609289 | 3300048929 | Bacteria | 859 |
| 356 | Ga0495682_0012310 | 3300049460 | Bacteria | 3282 |
| 357 | Ga0495682_0018052 | 3300049460 | Bacteria | 2657 |
| 358 | Ga0501037_0170683 | 3300049573 | Bacteria | 1546 |
| 359 | Ga0501040_0033431 | 3300049576 | Bacteria | 3484 |
| 360 | Ga0501041_0124556 | 3300049577 | Bacteria | 1603 |
| 361 | Ga0501075_0132226 | 3300049591 | Bacteria | 1901 |
| 362 | Ga0501075_0179667 | 3300049591 | Unclassified | 1615 |
| 363 | Ga0501035_0075961 | 3300049822 | Bacteria | 2971 |
| 364 | nmdc:mga03683_96924_c1 | 3300050489 | Bacteria | 1292 |
| 365 | nmdc:mga00v17_13282_c1 | 3300050491 | Bacteria | 4567 |
| 366 | nmdc:mga0k408_45552_c1 | 3300050493 | Bacteria | 2531 |
| 367 | nmdc:mga06z11_216292_c1 | 3300050494 | Bacteria | 1118 |
| 368 | nmdc:mga05p37_208724_c1 | 3300050507 | Bacteria | 2362 |
| 369 | nmdc:mga05p37_230142_c1 | 3300050507 | Bacteria | 2234 |
| 370 | nmdc:mga05p37_37645_c1 | 3300050507 | Bacteria | 5932 |
| 371 | nmdc:mga05p37_49929_c1 | 3300050507 | Bacteria | 5146 |
| 372 | nmdc:mga05p37_50294_c1 | 3300050507 | Bacteria | 5126 |
| 373 | nmdc:mga05p37_81606_c1 | 3300050507 | Bacteria | 3983 |
| 374 | nmdc:mga09592_6142_c1 | 3300050508 | Bacteria | 9782 |
| 375 | nmdc:mga0qj67_176950_c1 | 3300050509 | Bacteria | 1733 |
| 376 | nmdc:mga06r32_14387_c1 | 3300050510 | Bacteria | 7181 |
| 377 | nmdc:mga06r32_32585_c1 | 3300050510 | Bacteria | 4904 |
| 378 | nmdc:mga08y16_525415_c1 | 3300050511 | Bacteria | 1200 |
| 379 | nmdc:mga0n895_38581_c1 | 3300050512 | Bacteria | 4629 |
| 380 | nmdc:mga0rr50_112044_c1 | 3300050513 | Bacteria | 2160 |
| 381 | nmdc:mga0rr50_45536_c1 | 3300050513 | Bacteria | 3225 |
| 382 | nmdc:mga0a205_129959_c1 | 3300050515 | Bacteria | 2419 |
| 383 | nmdc:mga0sz30_7244_c1 | 3300050516 | Bacteria | 4156 |
| 384 | Ga0495601_0003352 | 3300053077 | Bacteria | 9174 |
| 385 | Ga0495601_0018020 | 3300053077 | Bacteria | 4292 |
| 386 | Ga0495601_0026787 | 3300053077 | Plasmid | 3561 |
| 387 | Ga0495601_0092814 | 3300053077 | Bacteria | 1944 |
| 388 | Ga0495601_0149454 | 3300053077 | Bacteria | 1525 |
| 389 | Ga0495601_0164131 | 3300053077 | Bacteria | 1452 |
| 390 | Ga0495612_0015784 | 3300053078 | Bacteria | 3027 |
| 391 | Ga0495612_0019869 | 3300053078 | Bacteria | 2691 |
| 392 | Ga0495612_0034254 | 3300053078 | Unclassified | 2056 |
| 393 | Ga0500610_0091071 | 3300053079 | Bacteria | 1584 |
| 394 | Ga0495655_0033845 | 3300053083 | Bacteria | 1260 |
| 395 | Ga0495619_0048294 | 3300053085 | Bacteria | 2804 |
| 396 | Ga0495619_0218683 | 3300053085 | Bacteria | 1319 |
| 397 | Ga0495619_0274149 | 3300053085 | Bacteria | 1169 |
| 398 | Ga0500578_0033516 | 3300053086 | Bacteria | 3300 |
| 399 | Ga0500643_000210 | 3300053087 | Bacteria | 55059 |
| 400 | Ga0500643_019213 | 3300053087 | Bacteria | 2254 |
| 401 | Ga0500583_0019067 | 3300053092 | Bacteria | 2804 |
| 402 | Ga0500651_0002157 | 3300053093 | Bacteria | 10272 |
| 403 | Ga0500641_0023426 | 3300053096 | Bacteria | 2374 |
| 404 | Ga0500650_0044987 | 3300053098 | Bacteria | 2044 |
| 405 | Ga0500650_0055646 | 3300053098 | Bacteria | 1842 |
| 406 | Ga0500555_005225 | 3300053103 | Bacteria | 3682 |
| 407 | Ga0500555_036480 | 3300053103 | Bacteria | 1379 |
| 408 | Ga0500562_004550 | 3300053108 | Bacteria | 3503 |
| 409 | Ga0500562_014818 | 3300053108 | Bacteria | 1998 |
| 410 | Ga0500594_0068001 | 3300053118 | Bacteria | 1041 |
| 411 | Ga0500595_015442 | 3300053119 | Bacteria | 2865 |
| 412 | Ga0500642_0020752 | 3300053130 | Bacteria | 2588 |
| 413 | Ga0500658_0005099 | 3300053134 | Bacteria | 4889 |
| 414 | Ga0500559_0063946 | 3300053136 | Bacteria | 1645 |
| 415 | Ga0500573_0021956 | 3300053140 | Bacteria | 3662 |
| 416 | Ga0500573_0051769 | 3300053140 | Bacteria | 2361 |
| 417 | Ga0500577_0067587 | 3300053142 | Bacteria | 1393 |
| 418 | Ga0500577_0081949 | 3300053142 | Bacteria | 1288 |
| 419 | Ga0500589_055607 | 3300053147 | Bacteria | 1826 |
| 420 | Ga0500604_0016137 | 3300053151 | Bacteria | 2054 |
| 421 | Ga0500616_0007197 | 3300053153 | Bacteria | 7116 |
| 422 | Ga0500622_0004296 | 3300053156 | Bacteria | 9027 |
| 423 | Ga0500622_0008571 | 3300053156 | Bacteria | 5708 |
| 424 | Ga0500627_0131499 | 3300053158 | Bacteria | 1130 |
| 425 | Ga0500633_0002567 | 3300053160 | Bacteria | 3770 |
| 426 | Ga0500636_0039064 | 3300053177 | Bacteria | 2806 |
| 427 | Ga0500636_0082385 | 3300053177 | Bacteria | 1852 |
| 428 | Ga0500637_0135939 | 3300053178 | Bacteria | 1424 |
| 429 | Ga0500657_101856 | 3300053728 | Bacteria | 1183 |
| 430 | Ga0500645_007041 | 3300053730 | Bacteria | 3950 |
| 431 | Ga0500599_000332 | 3300053736 | Bacteria | 4665 |
| 432 | Ga0501084_0135036 | 3300054114 | Unclassified | 2077 |
| 433 | Ga0501082_0072189 | 3300060353 | Bacteria | 2973 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_100458216 | Ga0070697_1004582161 | 237 |
| 2 | 3300048929 | Ga0496126_0609289 | Ga0496126_0609289_32_802 | 255 |
| 3 | iso_pu_bacteria | 2513237094 | 2513638835 | 280 |
| 4 | 3300046528 | Ga0495642_0139012 | Ga0495642_0139012_41_955 | 281 |
| 5 | 3300046491 | Ga0495584_0107150 | Ga0495584_0107150_223_1134 | 282 |
| 6 | 3300046794 | Ga0495589_0164340 | Ga0495589_0164340_52_963 | 282 |
| 7 | iso_pu_bacteria | 2508501042 | 2508697152 | 282 |
| 8 | iso_pu_bacteria | 2935648319 | 2935655855 | 282 |
| 9 | iso_pu_bacteria | 2935656913 | 2935664734 | 282 |
| 10 | iso_pu_bacteria | 2935959822 | 2935963938 | 282 |
| 11 | iso_pu_bacteria | 2935984226 | 2935988117 | 282 |
| 12 | iso_pu_bacteria | 2936019824 | 2936027324 | 282 |
| 13 | iso_pu_bacteria | 2936028420 | 2936036792 | 282 |
| 14 | iso_pu_bacteria | 2936055302 | 2936063156 | 282 |
| 15 | iso_pu_bacteria | 8016630954 | 8016633224 | 282 |
| 16 | 3300046460 | Ga0495638_0005224 | Ga0495638_0005224_4556_5437 | 286 |
| 17 | 3300046512 | Ga0495610_0035722 | Ga0495610_0035722_436_1299 | 286 |
| 18 | 3300046524 | Ga0495648_0013712 | Ga0495648_0013712_4487_5350 | 286 |
| 19 | 3300046648 | Ga0495611_0050802 | Ga0495611_0050802_918_1778 | 286 |
| 20 | 3300053086 | Ga0500578_0033516 | Ga0500578_0033516_616_1479 | 286 |
| 21 | 3300053087 | Ga0500643_000210 | Ga0500643_000210_28676_29539 | 286 |
| 22 | 3300053098 | Ga0500650_0055646 | Ga0500650_0055646_740_1603 | 286 |
| 23 | 3300053103 | Ga0500555_005225 | Ga0500555_005225_2527_3387 | 286 |
| 24 | 3300053108 | Ga0500562_004550 | Ga0500562_004550_2073_2954 | 286 |
| 25 | 3300053118 | Ga0500594_0068001 | Ga0500594_0068001_82_945 | 286 |
| 26 | 3300053130 | Ga0500642_0020752 | Ga0500642_0020752_345_1205 | 286 |
| 27 | 3300053142 | Ga0500577_0081949 | Ga0500577_0081949_190_1050 | 286 |
| 28 | 3300053147 | Ga0500589_055607 | Ga0500589_055607_13_876 | 286 |
| 29 | 3300053151 | Ga0500604_0016137 | Ga0500604_0016137_377_1240 | 286 |
| 30 | 3300053153 | Ga0500616_0007197 | Ga0500616_0007197_5259_6122 | 286 |
| 31 | 3300053156 | Ga0500622_0008571 | Ga0500622_0008571_1205_2068 | 286 |
| 32 | 3300053160 | Ga0500633_0002567 | Ga0500633_0002567_2721_3584 | 286 |
| 33 | 3300053730 | Ga0500645_007041 | Ga0500645_007041_2657_3520 | 286 |
| 34 | 3300053736 | Ga0500599_000332 | Ga0500599_000332_1021_1884 | 286 |
| 35 | 3300014497 | Ga0182008_10065154 | Ga0182008_100651542 | 288 |
| 36 | iso_pu_bacteria | 2874620515 | 2874622400 | 292 |
| 37 | iso_pu_bacteria | 2885374607 | 2885376596 | 292 |
| 38 | iso_pu_bacteria | 2903748898 | 2903751447 | 292 |
| 39 | iso_pu_bacteria | 2904666416 | 2904671593 | 292 |
| 40 | 3300046694 | Ga0495649_0014945 | Ga0495649_0014945_3333_4247 | 293 |
| 41 | iso_pu_bacteria | 8019619141 | 8019621347 | 293 |
| 42 | 3300046526 | Ga0495666_0030424 | Ga0495666_0030424_1238_2128 | 296 |
| 43 | 3300038443 | Ga0395901_0134949 | Ga0395901_0134949_19_948 | 297 |
| 44 | iso_pu_bacteria | 2599185301 | 2599940634 | 297 |
| 45 | 3300007265 | Ga0099794_10015700 | Ga0099794_100157003 | 298 |
| 46 | iso_pu_bacteria | 2513237096 | 2513661130 | 298 |
| 47 | iso_pu_bacteria | 2513237145 | 2513916940 | 298 |
| 48 | iso_pu_bacteria | 2935630451 | 2935636831 | 298 |
| 49 | iso_pu_bacteria | 2941507105 | 2941513468 | 298 |
| 50 | iso_pu_bacteria | 2941515067 | 2941521431 | 298 |
| 51 | iso_pu_bacteria | 2941523033 | 2941529249 | 298 |
| 52 | iso_pu_bacteria | 3005474847 | 3005480739 | 298 |
| 53 | 3300005340 | Ga0070689_100018646 | Ga0070689_1000186462 | 299 |
| 54 | 3300005364 | Ga0070673_100107175 | Ga0070673_1001071753 | 299 |
| 55 | 3300005467 | Ga0070706_100189950 | Ga0070706_1001899501 | 299 |
| 56 | 3300006175 | Ga0070712_100277075 | Ga0070712_1002770751 | 299 |
| 57 | 3300009094 | Ga0111539_10492804 | Ga0111539_104928041 | 299 |
| 58 | 3300010375 | Ga0105239_10348308 | Ga0105239_103483082 | 299 |
| 59 | 3300025910 | Ga0207684_10206337 | Ga0207684_102063371 | 299 |
| 60 | 3300025925 | Ga0207650_10033992 | Ga0207650_100339923 | 299 |
| 61 | 3300025936 | Ga0207670_10016818 | Ga0207670_100168182 | 299 |
| 62 | 3300025960 | Ga0207651_10071957 | Ga0207651_100719573 | 299 |
| 63 | 3300046664 | Ga0495659_0043694 | Ga0495659_0043694_594_1499 | 299 |
| 64 | 3300005548 | Ga0070665_100199568 | Ga0070665_1001995683 | 300 |
| 65 | 3300005937 | Ga0081455_10000637 | Ga0081455_1000063712 | 300 |
| 66 | 3300005937 | Ga0081455_10035763 | Ga0081455_100357632 | 300 |
| 67 | 3300006175 | Ga0070712_100160426 | Ga0070712_1001604262 | 300 |
| 68 | 3300006844 | Ga0075428_100134824 | Ga0075428_1001348243 | 300 |
| 69 | 3300006847 | Ga0075431_100474464 | Ga0075431_1004744642 | 300 |
| 70 | 3300006852 | Ga0075433_10173967 | Ga0075433_101739672 | 300 |
| 71 | 3300009098 | Ga0105245_10326932 | Ga0105245_103269322 | 300 |
| 72 | 3300009147 | Ga0114129_10051866 | Ga0114129_100518661 | 300 |
| 73 | 3300009147 | Ga0114129_10281744 | Ga0114129_102817442 | 300 |
| 74 | 3300013296 | Ga0157374_10068359 | Ga0157374_100683593 | 300 |
| 75 | 3300013297 | Ga0157378_10115641 | Ga0157378_101156412 | 300 |
| 76 | 3300013306 | Ga0163162_10277047 | Ga0163162_102770471 | 300 |
| 77 | 3300014968 | Ga0157379_10087760 | Ga0157379_100877602 | 300 |
| 78 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003350 | 300 |
| 79 | 3300037418 | Ga0395900_0067465 | Ga0395900_0067465_79_990 | 300 |
| 80 | 3300038443 | Ga0395901_0088761 | Ga0395901_0088761_2059_2970 | 300 |
| 81 | 3300046501 | Ga0495607_0112566 | Ga0495607_0112566_348_1259 | 300 |
| 82 | 3300048905 | Ga0496102_0326728 | Ga0496102_0326728_47_958 | 300 |
| 83 | 3300048906 | Ga0496103_0037022 | Ga0496103_0037022_26_937 | 300 |
| 84 | 3300048918 | Ga0496115_0093469 | Ga0496115_0093469_28_939 | 300 |
| 85 | 3300049576 | Ga0501040_0033431 | Ga0501040_0033431_958_1875 | 300 |
| 86 | 3300049577 | Ga0501041_0124556 | Ga0501041_0124556_473_1390 | 300 |
| 87 | 3300049591 | Ga0501075_0132226 | Ga0501075_0132226_774_1691 | 300 |
| 88 | 3300050507 | nmdc:mga05p37_208724_c1 | nmdc:mga05p37_208724_c1_572_1483 | 300 |
| 89 | 3300050507 | nmdc:mga05p37_49929_c1 | nmdc:mga05p37_49929_c1_4162_5073 | 300 |
| 90 | 3300050513 | nmdc:mga0rr50_112044_c1 | nmdc:mga0rr50_112044_c1_1109_2020 | 300 |
| 91 | 3300050515 | nmdc:mga0a205_129959_c1 | nmdc:mga0a205_129959_c1_146_1057 | 300 |
| 92 | 3300053134 | Ga0500658_0005099 | Ga0500658_0005099_3796_4710 | 300 |
| 93 | 3300054114 | Ga0501084_0135036 | Ga0501084_0135036_112_1029 | 300 |
| 94 | 3300060353 | Ga0501082_0072189 | Ga0501082_0072189_2024_2941 | 300 |
| 95 | 3300005536 | Ga0070697_100132438 | Ga0070697_1001324381 | 301 |
| 96 | 3300049573 | Ga0501037_0170683 | Ga0501037_0170683_249_1166 | 301 |
| 97 | 3300049822 | Ga0501035_0075961 | Ga0501035_0075961_1509_2426 | 301 |
| 98 | 3300005436 | Ga0070713_100045080 | Ga0070713_1000450802 | 302 |
| 99 | 3300005436 | Ga0070713_100116036 | Ga0070713_1001160362 | 302 |
| 100 | 3300006028 | Ga0070717_10212178 | Ga0070717_102121782 | 302 |
| 101 | 3300006038 | Ga0075365_10042780 | Ga0075365_100427804 | 302 |
| 102 | 3300006051 | Ga0075364_10032190 | Ga0075364_100321902 | 302 |
| 103 | 3300006186 | Ga0075369_10014361 | Ga0075369_100143611 | 302 |
| 104 | 3300006844 | Ga0075428_100086785 | Ga0075428_1000867853 | 302 |
| 105 | 3300009147 | Ga0114129_10177513 | Ga0114129_101775135 | 302 |
| 106 | 3300014968 | Ga0157379_10247297 | Ga0157379_102472972 | 302 |
| 107 | 3300025915 | Ga0207693_10006496 | Ga0207693_100064969 | 302 |
| 108 | 3300025928 | Ga0207700_10030347 | Ga0207700_100303475 | 302 |
| 109 | 3300025928 | Ga0207700_10058663 | Ga0207700_100586632 | 302 |
| 110 | 3300035117 | Ga0373953_0045970 | Ga0373953_0045970_331_1242 | 302 |
| 111 | 3300046454 | Ga0495592_0085352 | Ga0495592_0085352_315_1226 | 302 |
| 112 | 3300046460 | Ga0495638_0004740 | Ga0495638_0004740_1689_2609 | 302 |
| 113 | 3300046477 | Ga0495664_0029533 | Ga0495664_0029533_1642_2553 | 302 |
| 114 | 3300046477 | Ga0495664_0031784 | Ga0495664_0031784_2114_3025 | 302 |
| 115 | 3300046615 | Ga0495656_0152869 | Ga0495656_0152869_185_1093 | 302 |
| 116 | 3300046642 | Ga0495634_0086331 | Ga0495634_0086331_548_1471 | 302 |
| 117 | 3300046678 | Ga0495599_0013289 | Ga0495599_0013289_623_1558 | 302 |
| 118 | 3300046678 | Ga0495599_0059081 | Ga0495599_0059081_548_1459 | 302 |
| 119 | 3300046809 | Ga0495600_0137900 | Ga0495600_0137900_651_1562 | 302 |
| 120 | 3300047319 | Ga0495674_0075023 | Ga0495674_0075023_416_1327 | 302 |
| 121 | 3300047444 | Ga0495675_0098661 | Ga0495675_0098661_804_1721 | 302 |
| 122 | 3300048088 | Ga0495602_0016616 | Ga0495602_0016616_5445_6356 | 302 |
| 123 | 3300048088 | Ga0495602_0045305 | Ga0495602_0045305_1012_1923 | 302 |
| 124 | 3300048088 | Ga0495602_0076302 | Ga0495602_0076302_1574_2509 | 302 |
| 125 | 3300048907 | Ga0496104_0472173 | Ga0496104_0472173_157_1134 | 302 |
| 126 | 3300050489 | nmdc:mga03683_96924_c1 | nmdc:mga03683_96924_c1_230_1153 | 302 |
| 127 | 3300050491 | nmdc:mga00v17_13282_c1 | nmdc:mga00v17_13282_c1_2874_3797 | 302 |
| 128 | 3300050493 | nmdc:mga0k408_45552_c1 | nmdc:mga0k408_45552_c1_236_1159 | 302 |
| 129 | 3300050507 | nmdc:mga05p37_230142_c1 | nmdc:mga05p37_230142_c1_251_1174 | 302 |
| 130 | 3300050516 | nmdc:mga0sz30_7244_c1 | nmdc:mga0sz30_7244_c1_393_1316 | 302 |
| 131 | 3300053077 | Ga0495601_0026787 | Ga0495601_0026787_1486_2397 | 302 |
| 132 | 3300053078 | Ga0495612_0019869 | Ga0495612_0019869_1304_2215 | 302 |
| 133 | 3300053078 | Ga0495612_0034254 | Ga0495612_0034254_483_1394 | 302 |
| 134 | iso_pu_bacteria | 2513237092 | 2513625603 | 302 |
| 135 | iso_pu_bacteria | 2791355082 | 2792581028 | 302 |
| 136 | iso_pu_bacteria | 2847930680 | 2847939796 | 302 |
| 137 | iso_pu_bacteria | 2871495908 | 2871496223 | 302 |
| 138 | iso_pu_bacteria | 2874168670 | 2874170098 | 302 |
| 139 | iso_pu_bacteria | 2878760144 | 2878760452 | 302 |
| 140 | iso_pu_bacteria | 2878767105 | 2878767415 | 302 |
| 141 | iso_pu_bacteria | 2879083081 | 2879088231 | 302 |
| 142 | iso_pu_bacteria | 2885409591 | 2885410961 | 302 |
| 143 | iso_pu_bacteria | 2903540706 | 2903541017 | 302 |
| 144 | iso_pu_bacteria | 2906643746 | 2906649318 | 302 |
| 145 | iso_pu_bacteria | 2924762789 | 2924767870 | 302 |
| 146 | iso_pu_bacteria | 2935675223 | 2935680229 | 302 |
| 147 | iso_pu_bacteria | 2935684952 | 2935693722 | 302 |
| 148 | iso_pu_bacteria | 2935694250 | 2935700782 | 302 |
| 149 | iso_pu_bacteria | 2935713505 | 2935722419 | 302 |
| 150 | iso_pu_bacteria | 2935722832 | 2935731728 | 302 |
| 151 | iso_pu_bacteria | 2935732158 | 2935740937 | 302 |
| 152 | iso_pu_bacteria | 2935741537 | 2935750360 | 302 |
| 153 | iso_pu_bacteria | 2935750917 | 2935759907 | 302 |
| 154 | iso_pu_bacteria | 2935760218 | 2935768728 | 302 |
| 155 | iso_pu_bacteria | 2937994558 | 2937994870 | 302 |
| 156 | iso_pu_bacteria | 2940556831 | 2940565812 | 302 |
| 157 | iso_pu_bacteria | 2958165035 | 2958165350 | 302 |
| 158 | iso_pu_bacteria | 2961163497 | 2961163808 | 302 |
| 159 | iso_pu_bacteria | 2965018300 | 2965018613 | 302 |
| 160 | iso_pu_bacteria | 2968171901 | 2968172214 | 302 |
| 161 | iso_pu_bacteria | 2970554993 | 2970555304 | 302 |
| 162 | iso_pu_bacteria | 2987659509 | 2987659820 | 302 |
| 163 | iso_pu_bacteria | 2987666974 | 2987672276 | 302 |
| 164 | iso_pu_bacteria | 3004188549 | 3004188867 | 302 |
| 165 | iso_pu_bacteria | 3005483717 | 3005490560 | 302 |
| 166 | iso_pu_bacteria | 8006984368 | 8006992748 | 302 |
| 167 | iso_pu_bacteria | 8019648815 | 8019654664 | 302 |
| 168 | iso_pu_bacteria | 8049293176 | 8049297153 | 302 |
| 169 | 3300005331 | Ga0070670_100213830 | Ga0070670_1002138302 | 303 |
| 170 | 3300005366 | Ga0070659_100371927 | Ga0070659_1003719271 | 303 |
| 171 | 3300005367 | Ga0070667_100215838 | Ga0070667_1002158381 | 303 |
| 172 | 3300005445 | Ga0070708_100451648 | Ga0070708_1004516482 | 303 |
| 173 | 3300005457 | Ga0070662_100056222 | Ga0070662_1000562221 | 303 |
| 174 | 3300005471 | Ga0070698_100014542 | Ga0070698_1000145422 | 303 |
| 175 | 3300005544 | Ga0070686_100079431 | Ga0070686_1000794312 | 303 |
| 176 | 3300005563 | Ga0068855_100063084 | Ga0068855_1000630844 | 303 |
| 177 | 3300005564 | Ga0070664_100160869 | Ga0070664_1001608693 | 303 |
| 178 | 3300005842 | Ga0068858_100042283 | Ga0068858_1000422834 | 303 |
| 179 | 3300005843 | Ga0068860_100207670 | Ga0068860_1002076703 | 303 |
| 180 | 3300005937 | Ga0081455_10000930 | Ga0081455_100009305 | 303 |
| 181 | 3300005937 | Ga0081455_10002589 | Ga0081455_1000258920 | 303 |
| 182 | 3300005937 | Ga0081455_10016270 | Ga0081455_100162707 | 303 |
| 183 | 3300005937 | Ga0081455_10017266 | Ga0081455_100172669 | 303 |
| 184 | 3300006028 | Ga0070717_10051852 | Ga0070717_100518522 | 303 |
| 185 | 3300006028 | Ga0070717_10201771 | Ga0070717_102017712 | 303 |
| 186 | 3300006175 | Ga0070712_100013364 | Ga0070712_1000133644 | 303 |
| 187 | 3300006358 | Ga0068871_100080559 | Ga0068871_1000805595 | 303 |
| 188 | 3300006844 | Ga0075428_100026409 | Ga0075428_1000264098 | 303 |
| 189 | 3300006844 | Ga0075428_100099825 | Ga0075428_1000998251 | 303 |
| 190 | 3300006846 | Ga0075430_100024610 | Ga0075430_1000246102 | 303 |
| 191 | 3300006847 | Ga0075431_100067519 | Ga0075431_1000675193 | 303 |
| 192 | 3300006880 | Ga0075429_100112295 | Ga0075429_1001122953 | 303 |
| 193 | 3300006880 | Ga0075429_100265214 | Ga0075429_1002652142 | 303 |
| 194 | 3300006944 | Ga0099823_1020249 | Ga0099823_10202495 | 303 |
| 195 | 3300007076 | Ga0075435_100114999 | Ga0075435_1001149992 | 303 |
| 196 | 3300007265 | Ga0099794_10015925 | Ga0099794_100159253 | 303 |
| 197 | 3300009011 | Ga0105251_10050346 | Ga0105251_100503463 | 303 |
| 198 | 3300009011 | Ga0105251_10125249 | Ga0105251_101252491 | 303 |
| 199 | 3300009093 | Ga0105240_10097376 | Ga0105240_100973764 | 303 |
| 200 | 3300009094 | Ga0111539_10316918 | Ga0111539_103169182 | 303 |
| 201 | 3300009094 | Ga0111539_10522281 | Ga0111539_105222812 | 303 |
| 202 | 3300009098 | Ga0105245_10175400 | Ga0105245_101754001 | 303 |
| 203 | 3300009098 | Ga0105245_10497549 | Ga0105245_104975491 | 303 |
| 204 | 3300009147 | Ga0114129_10013167 | Ga0114129_1001316721 | 303 |
| 205 | 3300009147 | Ga0114129_10080691 | Ga0114129_100806913 | 303 |
| 206 | 3300009147 | Ga0114129_10105785 | Ga0114129_101057853 | 303 |
| 207 | 3300009176 | Ga0105242_10140256 | Ga0105242_101402564 | 303 |
| 208 | 3300009177 | Ga0105248_10062004 | Ga0105248_100620046 | 303 |
| 209 | 3300009177 | Ga0105248_10544967 | Ga0105248_105449671 | 303 |
| 210 | 3300009545 | Ga0105237_10108344 | Ga0105237_101083442 | 303 |
| 211 | 3300009545 | Ga0105237_10146790 | Ga0105237_101467903 | 303 |
| 212 | 3300009545 | Ga0105237_10432989 | Ga0105237_104329892 | 303 |
| 213 | 3300009551 | Ga0105238_10123848 | Ga0105238_101238482 | 303 |
| 214 | 3300010375 | Ga0105239_10118699 | Ga0105239_101186992 | 303 |
| 215 | 3300010375 | Ga0105239_10514706 | Ga0105239_105147061 | 303 |
| 216 | 3300011119 | Ga0105246_10141711 | Ga0105246_101417112 | 303 |
| 217 | 3300013104 | Ga0157370_10040742 | Ga0157370_100407423 | 303 |
| 218 | 3300013104 | Ga0157370_10277742 | Ga0157370_102777422 | 303 |
| 219 | 3300013105 | Ga0157369_10014923 | Ga0157369_100149231 | 303 |
| 220 | 3300013105 | Ga0157369_10022574 | Ga0157369_100225743 | 303 |
| 221 | 3300013296 | Ga0157374_10182823 | Ga0157374_101828232 | 303 |
| 222 | 3300013296 | Ga0157374_10349278 | Ga0157374_103492782 | 303 |
| 223 | 3300013306 | Ga0163162_10106925 | Ga0163162_101069255 | 303 |
| 224 | 3300013306 | Ga0163162_10273556 | Ga0163162_102735562 | 303 |
| 225 | 3300013307 | Ga0157372_10357207 | Ga0157372_103572072 | 303 |
| 226 | 3300013307 | Ga0157372_10778183 | Ga0157372_107781831 | 303 |
| 227 | 3300014325 | Ga0163163_10007784 | Ga0163163_100077847 | 303 |
| 228 | 3300014325 | Ga0163163_10016453 | Ga0163163_1001645311 | 303 |
| 229 | 3300014325 | Ga0163163_10040195 | Ga0163163_100401952 | 303 |
| 230 | 3300014325 | Ga0163163_10129501 | Ga0163163_101295011 | 303 |
| 231 | 3300014497 | Ga0182008_10050035 | Ga0182008_100500352 | 303 |
| 232 | 3300014745 | Ga0157377_10141494 | Ga0157377_101414942 | 303 |
| 233 | 3300014969 | Ga0157376_10215302 | Ga0157376_102153022 | 303 |
| 234 | 3300022467 | Ga0224712_10000657 | Ga0224712_100006576 | 303 |
| 235 | 3300025910 | Ga0207684_10163747 | Ga0207684_101637472 | 303 |
| 236 | 3300025911 | Ga0207654_10027016 | Ga0207654_100270162 | 303 |
| 237 | 3300025911 | Ga0207654_10120798 | Ga0207654_101207982 | 303 |
| 238 | 3300025912 | Ga0207707_10032511 | Ga0207707_100325112 | 303 |
| 239 | 3300025913 | Ga0207695_10388263 | Ga0207695_103882632 | 303 |
| 240 | 3300025916 | Ga0207663_10216503 | Ga0207663_102165031 | 303 |
| 241 | 3300025921 | Ga0207652_10030777 | Ga0207652_100307779 | 303 |
| 242 | 3300025925 | Ga0207650_10167170 | Ga0207650_101671702 | 303 |
| 243 | 3300025928 | Ga0207700_10001928 | Ga0207700_100019283 | 303 |
| 244 | 3300025929 | Ga0207664_10075166 | Ga0207664_100751662 | 303 |
| 245 | 3300025937 | Ga0207669_10078787 | Ga0207669_100787873 | 303 |
| 246 | 3300025938 | Ga0207704_10049036 | Ga0207704_100490363 | 303 |
| 247 | 3300025939 | Ga0207665_10126626 | Ga0207665_101266262 | 303 |
| 248 | 3300025942 | Ga0207689_10420576 | Ga0207689_104205761 | 303 |
| 249 | 3300025944 | Ga0207661_10000630 | Ga0207661_1000063019 | 303 |
| 250 | 3300025945 | Ga0207679_10221233 | Ga0207679_102212332 | 303 |
| 251 | 3300025960 | Ga0207651_10282004 | Ga0207651_102820042 | 303 |
| 252 | 3300025972 | Ga0207668_10062222 | Ga0207668_100622222 | 303 |
| 253 | 3300025972 | Ga0207668_10098373 | Ga0207668_100983733 | 303 |
| 254 | 3300025986 | Ga0207658_10233103 | Ga0207658_102331032 | 303 |
| 255 | 3300026067 | Ga0207678_10065388 | Ga0207678_100653882 | 303 |
| 256 | 3300026067 | Ga0207678_10074054 | Ga0207678_100740542 | 303 |
| 257 | 3300026067 | Ga0207678_10139978 | Ga0207678_101399782 | 303 |
| 258 | 3300026116 | Ga0207674_10063082 | Ga0207674_100630821 | 303 |
| 259 | 3300026121 | Ga0207683_10063761 | Ga0207683_100637612 | 303 |
| 260 | 3300027296 | Ga0209389_1000015 | Ga0209389_100001596 | 303 |
| 261 | 3300027361 | Ga0209489_100072 | Ga0209489_10007257 | 303 |
| 262 | 3300027363 | Ga0209700_100034 | Ga0209700_10003487 | 303 |
| 263 | 3300027671 | Ga0209588_1006717 | Ga0209588_10067172 | 303 |
| 264 | 3300031238 | Ga0265332_10059134 | Ga0265332_100591342 | 303 |
| 265 | 3300031507 | Ga0307509_10023867 | Ga0307509_100238675 | 303 |
| 266 | 3300031730 | Ga0307516_10003424 | Ga0307516_100034246 | 303 |
| 267 | 3300031730 | Ga0307516_10041981 | Ga0307516_100419818 | 303 |
| 268 | 3300031730 | Ga0307516_10057682 | Ga0307516_100576823 | 303 |
| 269 | 3300031730 | Ga0307516_10295501 | Ga0307516_102955011 | 303 |
| 270 | 3300031730 | Ga0307516_10318835 | Ga0307516_103188351 | 303 |
| 271 | 3300033179 | Ga0307507_10140147 | Ga0307507_101401473 | 303 |
| 272 | 3300033180 | Ga0307510_10020175 | Ga0307510_100201757 | 303 |
| 273 | 3300033180 | Ga0307510_10305770 | Ga0307510_103057701 | 303 |
| 274 | 3300035083 | Ga0373926_0009466 | Ga0373926_0009466_1031_1954 | 303 |
| 275 | 3300035170 | Ga0373943_0014764 | Ga0373943_0014764_2607_3527 | 303 |
| 276 | 3300035170 | Ga0373943_0094845 | Ga0373943_0094845_510_1421 | 303 |
| 277 | 3300035171 | Ga0373946_0020050 | Ga0373946_0020050_19_942 | 303 |
| 278 | 3300035692 | Ga0373935_0021576 | Ga0373935_0021576_2300_3220 | 303 |
| 279 | 3300035695 | Ga0373927_0034568 | Ga0373927_0034568_1486_2406 | 303 |
| 280 | 3300035695 | Ga0373927_0069794 | Ga0373927_0069794_671_1594 | 303 |
| 281 | 3300035725 | Ga0373947_0023431 | Ga0373947_0023431_1369_2289 | 303 |
| 282 | 3300036401 | Ga0373937_0023784 | Ga0373937_0023784_3295_4215 | 303 |
| 283 | 3300037466 | Ga0395898_0305245 | Ga0395898_0305245_216_1277 | 303 |
| 284 | 3300039438 | Ga0436360_0994312 | Ga0436360_0994312_507_1427 | 303 |
| 285 | 3300046452 | Ga0495617_013706 | Ga0495617_013706_1357_2280 | 303 |
| 286 | 3300046455 | Ga0495603_0044040 | Ga0495603_0044040_1161_2081 | 303 |
| 287 | 3300046455 | Ga0495603_0104234 | Ga0495603_0104234_665_1588 | 303 |
| 288 | 3300046459 | Ga0495629_0045329 | Ga0495629_0045329_581_1492 | 303 |
| 289 | 3300046459 | Ga0495629_0052354 | Ga0495629_0052354_1135_2055 | 303 |
| 290 | 3300046461 | Ga0495641_0032011 | Ga0495641_0032011_885_1805 | 303 |
| 291 | 3300046462 | Ga0495651_0072702 | Ga0495651_0072702_1605_2525 | 303 |
| 292 | 3300046471 | Ga0495650_0060289 | Ga0495650_0060289_233_1156 | 303 |
| 293 | 3300046472 | Ga0495580_0092695 | Ga0495580_0092695_781_1692 | 303 |
| 294 | 3300046472 | Ga0495580_0105181 | Ga0495580_0105181_672_1592 | 303 |
| 295 | 3300046473 | Ga0495582_0057462 | Ga0495582_0057462_654_1574 | 303 |
| 296 | 3300046475 | Ga0495639_0029315 | Ga0495639_0029315_615_1535 | 303 |
| 297 | 3300046475 | Ga0495639_0122574 | Ga0495639_0122574_33_953 | 303 |
| 298 | 3300046475 | Ga0495639_0139947 | Ga0495639_0139947_163_1086 | 303 |
| 299 | 3300046477 | Ga0495664_0103340 | Ga0495664_0103340_264_1187 | 303 |
| 300 | 3300046491 | Ga0495584_0012550 | Ga0495584_0012550_613_1524 | 303 |
| 301 | 3300046491 | Ga0495584_0036478 | Ga0495584_0036478_247_1170 | 303 |
| 302 | 3300046491 | Ga0495584_0097673 | Ga0495584_0097673_520_1440 | 303 |
| 303 | 3300046492 | Ga0495585_0025666 | Ga0495585_0025666_684_1604 | 303 |
| 304 | 3300046492 | Ga0495585_0050527 | Ga0495585_0050527_669_1592 | 303 |
| 305 | 3300046499 | Ga0495594_0037382 | Ga0495594_0037382_212_1135 | 303 |
| 306 | 3300046499 | Ga0495594_0049923 | Ga0495594_0049923_605_1525 | 303 |
| 307 | 3300046499 | Ga0495594_0064619 | Ga0495594_0064619_572_1483 | 303 |
| 308 | 3300046500 | Ga0495596_0021978 | Ga0495596_0021978_334_1257 | 303 |
| 309 | 3300046500 | Ga0495596_0023563 | Ga0495596_0023563_1462_2385 | 303 |
| 310 | 3300046501 | Ga0495607_0012881 | Ga0495607_0012881_2269_3189 | 303 |
| 311 | 3300046501 | Ga0495607_0109979 | Ga0495607_0109979_59_982 | 303 |
| 312 | 3300046506 | Ga0495583_0036141 | Ga0495583_0036141_60_983 | 303 |
| 313 | 3300046513 | Ga0495616_0013005 | Ga0495616_0013005_3755_4678 | 303 |
| 314 | 3300046513 | Ga0495616_0053921 | Ga0495616_0053921_129_1052 | 303 |
| 315 | 3300046514 | Ga0495618_0012254 | Ga0495618_0012254_3606_4526 | 303 |
| 316 | 3300046515 | Ga0495620_0033821 | Ga0495620_0033821_490_1413 | 303 |
| 317 | 3300046517 | Ga0495630_0106514 | Ga0495630_0106514_953_1873 | 303 |
| 318 | 3300046517 | Ga0495630_0183498 | Ga0495630_0183498_569_1480 | 303 |
| 319 | 3300046518 | Ga0495631_0031154 | Ga0495631_0031154_322_1245 | 303 |
| 320 | 3300046518 | Ga0495631_0053982 | Ga0495631_0053982_692_1603 | 303 |
| 321 | 3300046519 | Ga0495632_0032990 | Ga0495632_0032990_205_1128 | 303 |
| 322 | 3300046519 | Ga0495632_0069029 | Ga0495632_0069029_458_1381 | 303 |
| 323 | 3300046523 | Ga0495644_0007531 | Ga0495644_0007531_3113_4036 | 303 |
| 324 | 3300046523 | Ga0495644_0008945 | Ga0495644_0008945_2095_3015 | 303 |
| 325 | 3300046523 | Ga0495644_0020835 | Ga0495644_0020835_928_1851 | 303 |
| 326 | 3300046524 | Ga0495648_0009128 | Ga0495648_0009128_6074_7000 | 303 |
| 327 | 3300046524 | Ga0495648_0026804 | Ga0495648_0026804_375_1298 | 303 |
| 328 | 3300046524 | Ga0495648_0032919 | Ga0495648_0032919_234_1157 | 303 |
| 329 | 3300046525 | Ga0495663_0003143 | Ga0495663_0003143_896_1819 | 303 |
| 330 | 3300046525 | Ga0495663_0009716 | Ga0495663_0009716_13_936 | 303 |
| 331 | 3300046525 | Ga0495663_0058227 | Ga0495663_0058227_213_1124 | 303 |
| 332 | 3300046526 | Ga0495666_0094417 | Ga0495666_0094417_128_1048 | 303 |
| 333 | 3300046528 | Ga0495642_0018060 | Ga0495642_0018060_212_1135 | 303 |
| 334 | 3300046531 | Ga0495665_0029119 | Ga0495665_0029119_1412_2332 | 303 |
| 335 | 3300046533 | Ga0495640_0019583 | Ga0495640_0019583_3171_4091 | 303 |
| 336 | 3300046533 | Ga0495640_0104844 | Ga0495640_0104844_701_1621 | 303 |
| 337 | 3300046533 | Ga0495640_0176001 | Ga0495640_0176001_429_1352 | 303 |
| 338 | 3300046533 | Ga0495640_0228120 | Ga0495640_0228120_151_1062 | 303 |
| 339 | 3300046535 | Ga0495586_0086792 | Ga0495586_0086792_101_1021 | 303 |
| 340 | 3300046535 | Ga0495586_0141138 | Ga0495586_0141138_46_966 | 303 |
| 341 | 3300046537 | Ga0495598_0001732 | Ga0495598_0001732_2587_3510 | 303 |
| 342 | 3300046537 | Ga0495598_0005236 | Ga0495598_0005236_1216_2139 | 303 |
| 343 | 3300046538 | Ga0495609_0064717 | Ga0495609_0064717_280_1203 | 303 |
| 344 | 3300046539 | Ga0495621_0002644 | Ga0495621_0002644_1370_2293 | 303 |
| 345 | 3300046539 | Ga0495621_0017625 | Ga0495621_0017625_1369_2292 | 303 |
| 346 | 3300046542 | Ga0495597_0013712 | Ga0495597_0013712_102_1025 | 303 |
| 347 | 3300046543 | Ga0495645_0316365 | Ga0495645_0316365_27_971 | 303 |
| 348 | 3300046557 | Ga0495622_0063490 | Ga0495622_0063490_779_1699 | 303 |
| 349 | 3300046558 | Ga0495633_0017030 | Ga0495633_0017030_10_933 | 303 |
| 350 | 3300046615 | Ga0495656_0007832 | Ga0495656_0007832_199_1122 | 303 |
| 351 | 3300046615 | Ga0495656_0012919 | Ga0495656_0012919_436_1356 | 303 |
| 352 | 3300046615 | Ga0495656_0039528 | Ga0495656_0039528_949_1860 | 303 |
| 353 | 3300046642 | Ga0495634_0011334 | Ga0495634_0011334_2685_3605 | 303 |
| 354 | 3300046642 | Ga0495634_0027510 | Ga0495634_0027510_1004_1924 | 303 |
| 355 | 3300046648 | Ga0495611_0003456 | Ga0495611_0003456_655_1578 | 303 |
| 356 | 3300046648 | Ga0495611_0131888 | Ga0495611_0131888_40_963 | 303 |
| 357 | 3300046660 | Ga0495625_0041966 | Ga0495625_0041966_2126_3049 | 303 |
| 358 | 3300046660 | Ga0495625_0117097 | Ga0495625_0117097_42_965 | 303 |
| 359 | 3300046663 | Ga0495635_0087519 | Ga0495635_0087519_1100_2020 | 303 |
| 360 | 3300046663 | Ga0495635_0290789 | Ga0495635_0290789_49_969 | 303 |
| 361 | 3300046664 | Ga0495659_0013958 | Ga0495659_0013958_118_1041 | 303 |
| 362 | 3300046665 | Ga0495661_0042919 | Ga0495661_0042919_1431_2354 | 303 |
| 363 | 3300046665 | Ga0495661_0045872 | Ga0495661_0045872_1633_2556 | 303 |
| 364 | 3300046674 | Ga0495588_0026223 | Ga0495588_0026223_1420_2343 | 303 |
| 365 | 3300046678 | Ga0495599_0061252 | Ga0495599_0061252_405_1325 | 303 |
| 366 | 3300046680 | Ga0495646_0011795 | Ga0495646_0011795_748_1668 | 303 |
| 367 | 3300046681 | Ga0495647_0034436 | Ga0495647_0034436_836_1756 | 303 |
| 368 | 3300046681 | Ga0495647_0059482 | Ga0495647_0059482_230_1150 | 303 |
| 369 | 3300046681 | Ga0495647_0076341 | Ga0495647_0076341_14_937 | 303 |
| 370 | 3300046683 | Ga0495658_0008984 | Ga0495658_0008984_1383_2303 | 303 |
| 371 | 3300046683 | Ga0495658_0214935 | Ga0495658_0214935_201_1112 | 303 |
| 372 | 3300046684 | Ga0495669_0013034 | Ga0495669_0013034_2602_3525 | 303 |
| 373 | 3300046684 | Ga0495669_0153283 | Ga0495669_0153283_56_976 | 303 |
| 374 | 3300046690 | Ga0495624_0123856 | Ga0495624_0123856_189_1112 | 303 |
| 375 | 3300046691 | Ga0495670_0010100 | Ga0495670_0010100_3373_4296 | 303 |
| 376 | 3300046691 | Ga0495670_0023393 | Ga0495670_0023393_556_1479 | 303 |
| 377 | 3300046692 | Ga0495671_0104385 | Ga0495671_0104385_413_1333 | 303 |
| 378 | 3300046694 | Ga0495649_0022162 | Ga0495649_0022162_2373_3296 | 303 |
| 379 | 3300046694 | Ga0495649_0058322 | Ga0495649_0058322_236_1159 | 303 |
| 380 | 3300046794 | Ga0495589_0072984 | Ga0495589_0072984_513_1436 | 303 |
| 381 | 3300046810 | Ga0495660_0136906 | Ga0495660_0136906_54_965 | 303 |
| 382 | 3300047315 | Ga0495581_0091788 | Ga0495581_0091788_148_1068 | 303 |
| 383 | 3300047315 | Ga0495581_0202153 | Ga0495581_0202153_55_966 | 303 |
| 384 | 3300047315 | Ga0495581_0214058 | Ga0495581_0214058_172_1083 | 303 |
| 385 | 3300047318 | Ga0495636_0004278 | Ga0495636_0004278_160_1083 | 303 |
| 386 | 3300047318 | Ga0495636_0030330 | Ga0495636_0030330_117_1040 | 303 |
| 387 | 3300047319 | Ga0495674_0089312 | Ga0495674_0089312_875_1795 | 303 |
| 388 | 3300047319 | Ga0495674_0093920 | Ga0495674_0093920_743_1663 | 303 |
| 389 | 3300047320 | Ga0495672_0099892 | Ga0495672_0099892_18_941 | 303 |
| 390 | 3300047320 | Ga0495672_0145695 | Ga0495672_0145695_81_1004 | 303 |
| 391 | 3300047321 | Ga0495676_0161495 | Ga0495676_0161495_127_1047 | 303 |
| 392 | 3300047321 | Ga0495676_0182305 | Ga0495676_0182305_284_1195 | 303 |
| 393 | 3300047321 | Ga0495676_0253636 | Ga0495676_0253636_211_1122 | 303 |
| 394 | 3300047323 | Ga0495683_0109302 | Ga0495683_0109302_281_1204 | 303 |
| 395 | 3300047444 | Ga0495675_0199144 | Ga0495675_0199144_205_1149 | 303 |
| 396 | 3300047445 | Ga0495677_0027355 | Ga0495677_0027355_847_1764 | 303 |
| 397 | 3300047445 | Ga0495677_0079559 | Ga0495677_0079559_98_1021 | 303 |
| 398 | 3300047446 | Ga0495679_007805 | Ga0495679_007805_3317_4240 | 303 |
| 399 | 3300047446 | Ga0495679_031334 | Ga0495679_031334_599_1519 | 303 |
| 400 | 3300047447 | Ga0495685_031062 | Ga0495685_031062_436_1347 | 303 |
| 401 | 3300047469 | Ga0495673_0015090 | Ga0495673_0015090_2211_3134 | 303 |
| 402 | 3300047469 | Ga0495673_0016971 | Ga0495673_0016971_121_1044 | 303 |
| 403 | 3300047470 | Ga0495681_0038563 | Ga0495681_0038563_225_1148 | 303 |
| 404 | 3300047471 | Ga0495684_0079622 | Ga0495684_0079622_737_1657 | 303 |
| 405 | 3300047471 | Ga0495684_0104252 | Ga0495684_0104252_786_1706 | 303 |
| 406 | 3300047471 | Ga0495684_0127198 | Ga0495684_0127198_839_1759 | 303 |
| 407 | 3300047472 | Ga0495686_0025512 | Ga0495686_0025512_52_975 | 303 |
| 408 | 3300047472 | Ga0495686_0046719 | Ga0495686_0046719_395_1318 | 303 |
| 409 | 3300048088 | Ga0495602_0151933 | Ga0495602_0151933_779_1705 | 303 |
| 410 | 3300048090 | Ga0495615_0000613 | Ga0495615_0000613_234_1157 | 303 |
| 411 | 3300048090 | Ga0495615_0005456 | Ga0495615_0005456_136_1059 | 303 |
| 412 | 3300048903 | Ga0496100_0133060 | Ga0496100_0133060_659_1570 | 303 |
| 413 | 3300048904 | Ga0496101_0343794 | Ga0496101_0343794_136_1047 | 303 |
| 414 | 3300048905 | Ga0496102_0274358 | Ga0496102_0274358_202_1125 | 303 |
| 415 | 3300048907 | Ga0496104_0063652 | Ga0496104_0063652_200_1111 | 303 |
| 416 | 3300048907 | Ga0496104_0262825 | Ga0496104_0262825_606_1517 | 303 |
| 417 | 3300048907 | Ga0496104_0298069 | Ga0496104_0298069_421_1341 | 303 |
| 418 | 3300048907 | Ga0496104_0298716 | Ga0496104_0298716_124_1047 | 303 |
| 419 | 3300048908 | Ga0496105_0019695 | Ga0496105_0019695_816_1727 | 303 |
| 420 | 3300048908 | Ga0496105_0074691 | Ga0496105_0074691_1767_2678 | 303 |
| 421 | 3300048908 | Ga0496105_0201710 | Ga0496105_0201710_619_1563 | 303 |
| 422 | 3300048909 | Ga0496106_0078106 | Ga0496106_0078106_1334_2257 | 303 |
| 423 | 3300048910 | Ga0496107_0086322 | Ga0496107_0086322_1285_2196 | 303 |
| 424 | 3300048911 | Ga0496108_0004786 | Ga0496108_0004786_9620_10531 | 303 |
| 425 | 3300048911 | Ga0496108_0006710 | Ga0496108_0006710_4547_5467 | 303 |
| 426 | 3300048911 | Ga0496108_0022680 | Ga0496108_0022680_2139_3062 | 303 |
| 427 | 3300048912 | Ga0496109_0004008 | Ga0496109_0004008_2843_3754 | 303 |
| 428 | 3300048912 | Ga0496109_0021570 | Ga0496109_0021570_510_1433 | 303 |
| 429 | 3300048912 | Ga0496109_0028693 | Ga0496109_0028693_2489_3400 | 303 |
| 430 | 3300048912 | Ga0496109_0141144 | Ga0496109_0141144_665_1585 | 303 |
| 431 | 3300048913 | Ga0496110_0021863 | Ga0496110_0021863_4042_4953 | 303 |
| 432 | 3300048913 | Ga0496110_0125219 | Ga0496110_0125219_154_1098 | 303 |
| 433 | 3300048913 | Ga0496110_0253279 | Ga0496110_0253279_198_1118 | 303 |
| 434 | 3300048913 | Ga0496110_0359057 | Ga0496110_0359057_202_1113 | 303 |
| 435 | 3300048914 | Ga0496111_0004217 | Ga0496111_0004217_2564_3475 | 303 |
| 436 | 3300048914 | Ga0496111_0053084 | Ga0496111_0053084_808_1752 | 303 |
| 437 | 3300048914 | Ga0496111_0075785 | Ga0496111_0075785_1457_2380 | 303 |
| 438 | 3300048915 | Ga0496112_0014107 | Ga0496112_0014107_2764_3675 | 303 |
| 439 | 3300048915 | Ga0496112_0026947 | Ga0496112_0026947_644_1588 | 303 |
| 440 | 3300048915 | Ga0496112_0040574 | Ga0496112_0040574_2305_3228 | 303 |
| 441 | 3300048915 | Ga0496112_0235721 | Ga0496112_0235721_122_1033 | 303 |
| 442 | 3300048915 | Ga0496112_0254779 | Ga0496112_0254779_131_1051 | 303 |
| 443 | 3300048916 | Ga0496113_0000306 | Ga0496113_0000306_22261_23172 | 303 |
| 444 | 3300048916 | Ga0496113_0009900 | Ga0496113_0009900_4458_5402 | 303 |
| 445 | 3300048916 | Ga0496113_0154044 | Ga0496113_0154044_537_1457 | 303 |
| 446 | 3300048917 | Ga0496114_0397569 | Ga0496114_0397569_253_1164 | 303 |
| 447 | 3300048918 | Ga0496115_0016002 | Ga0496115_0016002_1246_2157 | 303 |
| 448 | 3300048928 | Ga0496125_0059384 | Ga0496125_0059384_993_1937 | 303 |
| 449 | 3300049460 | Ga0495682_0012310 | Ga0495682_0012310_703_1626 | 303 |
| 450 | 3300049460 | Ga0495682_0018052 | Ga0495682_0018052_1339_2262 | 303 |
| 451 | 3300049591 | Ga0501075_0179667 | Ga0501075_0179667_285_1220 | 303 |
| 452 | 3300050494 | nmdc:mga06z11_216292_c1 | nmdc:mga06z11_216292_c1_59_982 | 303 |
| 453 | 3300050507 | nmdc:mga05p37_37645_c1 | nmdc:mga05p37_37645_c1_4803_5726 | 303 |
| 454 | 3300050507 | nmdc:mga05p37_50294_c1 | nmdc:mga05p37_50294_c1_3455_4378 | 303 |
| 455 | 3300050507 | nmdc:mga05p37_81606_c1 | nmdc:mga05p37_81606_c1_1113_2024 | 303 |
| 456 | 3300050508 | nmdc:mga09592_6142_c1 | nmdc:mga09592_6142_c1_7408_8319 | 303 |
| 457 | 3300050509 | nmdc:mga0qj67_176950_c1 | nmdc:mga0qj67_176950_c1_748_1659 | 303 |
| 458 | 3300050510 | nmdc:mga06r32_14387_c1 | nmdc:mga06r32_14387_c1_461_1384 | 303 |
| 459 | 3300050510 | nmdc:mga06r32_32585_c1 | nmdc:mga06r32_32585_c1_1533_2444 | 303 |
| 460 | 3300050511 | nmdc:mga08y16_525415_c1 | nmdc:mga08y16_525415_c1_55_978 | 303 |
| 461 | 3300050512 | nmdc:mga0n895_38581_c1 | nmdc:mga0n895_38581_c1_2305_3228 | 303 |
| 462 | 3300050513 | nmdc:mga0rr50_45536_c1 | nmdc:mga0rr50_45536_c1_1974_2897 | 303 |
| 463 | 3300053077 | Ga0495601_0003352 | Ga0495601_0003352_1057_1977 | 303 |
| 464 | 3300053077 | Ga0495601_0018020 | Ga0495601_0018020_2150_3070 | 303 |
| 465 | 3300053077 | Ga0495601_0092814 | Ga0495601_0092814_959_1879 | 303 |
| 466 | 3300053077 | Ga0495601_0149454 | Ga0495601_0149454_358_1275 | 303 |
| 467 | 3300053077 | Ga0495601_0164131 | Ga0495601_0164131_448_1359 | 303 |
| 468 | 3300053078 | Ga0495612_0015784 | Ga0495612_0015784_1209_2129 | 303 |
| 469 | 3300053079 | Ga0500610_0091071 | Ga0500610_0091071_207_1130 | 303 |
| 470 | 3300053083 | Ga0495655_0033845 | Ga0495655_0033845_238_1161 | 303 |
| 471 | 3300053085 | Ga0495619_0048294 | Ga0495619_0048294_959_1879 | 303 |
| 472 | 3300053085 | Ga0495619_0218683 | Ga0495619_0218683_83_994 | 303 |
| 473 | 3300053085 | Ga0495619_0274149 | Ga0495619_0274149_120_1031 | 303 |
| 474 | 3300053087 | Ga0500643_019213 | Ga0500643_019213_132_1055 | 303 |
| 475 | 3300053092 | Ga0500583_0019067 | Ga0500583_0019067_1070_1993 | 303 |
| 476 | 3300053093 | Ga0500651_0002157 | Ga0500651_0002157_7193_8116 | 303 |
| 477 | 3300053096 | Ga0500641_0023426 | Ga0500641_0023426_447_1370 | 303 |
| 478 | 3300053098 | Ga0500650_0044987 | Ga0500650_0044987_28_951 | 303 |
| 479 | 3300053103 | Ga0500555_036480 | Ga0500555_036480_226_1149 | 303 |
| 480 | 3300053108 | Ga0500562_014818 | Ga0500562_014818_1045_1968 | 303 |
| 481 | 3300053119 | Ga0500595_015442 | Ga0500595_015442_707_1630 | 303 |
| 482 | 3300053136 | Ga0500559_0063946 | Ga0500559_0063946_275_1201 | 303 |
| 483 | 3300053140 | Ga0500573_0021956 | Ga0500573_0021956_1663_2589 | 303 |
| 484 | 3300053140 | Ga0500573_0051769 | Ga0500573_0051769_371_1294 | 303 |
| 485 | 3300053142 | Ga0500577_0067587 | Ga0500577_0067587_401_1324 | 303 |
| 486 | 3300053156 | Ga0500622_0004296 | Ga0500622_0004296_6817_7737 | 303 |
| 487 | 3300053158 | Ga0500627_0131499 | Ga0500627_0131499_38_961 | 303 |
| 488 | 3300053177 | Ga0500636_0039064 | Ga0500636_0039064_642_1568 | 303 |
| 489 | 3300053177 | Ga0500636_0082385 | Ga0500636_0082385_610_1533 | 303 |
| 490 | 3300053178 | Ga0500637_0135939 | Ga0500637_0135939_131_1054 | 303 |
| 491 | 3300053728 | Ga0500657_101856 | Ga0500657_101856_58_981 | 303 |
| 492 | iso_pu_bacteria | 2903768456 | 2903773904 | 303 |
| 493 | iso_pu_bacteria | 8056681323 | 8056685517 | 303 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w35-assembly1.cif.gz_J | deactive state ci from dq-nadh dataset, subclass 3 | 0.9357 | 4 | 302 |
| 7r41-assembly1.cif.gz_P | bovine complex i in the presence of im1761092, active class i (composite map) | 0.9328 | 4 | 302 |
| 7v2f-assembly1.cif.gz_J | deactive state complex i from q10-nadh dataset | 0.9308 | 4 | 302 |
| 6zkg-assembly1.cif.gz_d | complex i with nadh, closed | 0.9298 | 4 | 302 |
| 6zr2-assembly1.cif.gz_P | cryo-em structure of respiratory complex i in the active state from mus musculus at 3.1 a | 0.9295 | 5 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q559Z0_43_331_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9418 | 8 | 292 | 3.40.50.720 |
| af_Q9SK66_71_329_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.936 | 7 | 256 | 3.40.50.720 |
| af_Q559Z0_43_331_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9261 | 8 | 292 | 3.40.50.720 |
| af_Q9DC69_47_264_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9231 | 2 | 211 | 3.40.50.720 |
| af_Q4DU32_30_254_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9127 | 5 | 214 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H1NBM7-F1-model_v4 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | 0.9722 | 2 | 302 |
GO:0044877
GO:1901006 |
| AF-A0A3A8AQE4-F1-model_v4 | Complex I NDUFA9 subunit family protein | 0.966 | 2 | 302 |
GO:0044877
GO:1901006 |
| AF-A0A6N7GYD0-F1-model_v4 | NAD(P)H-binding protein | 0.9632 | 4 | 303 |
GO:0044877
GO:1901006 |
| AF-A0A4V3NMS5-F1-model_v4 | deleted | 0.9587 | 54 | 181 |
|
| AF-A0A1T4PKI1-F1-model_v4 | NADH dehydrogenase | 0.9562 | 1 | 303 |
GO:0044877
GO:1901006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar