F454481

General Info

Members Datasets Scaffolds Average Seq Length
493 306 433 304

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0472173|Ga0496104_0472173_157_1134
Length 325
Sequence VDNGSQAKENTVVVFGGTGFLGRRVVRHLRAHEVSVRIASRHPDRGYELFGRDDPNLQSVGANIHNERSVADALVGAYGVVNAVSLYVEQGQETFQSVHVESARLIAARARQAGVQRLVHVSGIGSDAGSPSLYIRKRGEGELAVRGAFADAILIRPAVMVGPDDSFLTTILKLLRFPIYPMFGRGRTRLQPAYVEDVAEGIARALQGSAKNAVTFECGGPRVYSYEDLLRTVAHQAHLKPLLIPVPFAAWHAIAGVAELFPSPPVTRNQVELMQVDNVTSPEMPGFAELAISPRSVEEILQEILSGGPYRSRGGEGSHRSGPVR

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
7 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
8 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
9 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
10 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
11 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
12 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
13 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
14 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
15 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
16 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
17 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
18 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
19 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
20 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
21 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
22 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
23 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
24 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
25 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
26 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
27 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
28 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
29 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
30 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
31 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
32 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
33 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
34 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
35 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
36 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
37 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
38 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
39 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
40 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
41 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
42 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
43 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
44 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
45 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
46 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
47 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
48 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
49 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
50 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
51 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
52 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
53 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
54 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
134 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
135 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
271 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
281 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
282 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
285 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
286 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
293 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
296 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
297 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
298 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
302 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
303 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
304 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
305 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
306 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.63
Metatranscriptomes 0.2
Isolates 12.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 10.55
Rhizoplane 8.32
Rhizosphere 67.75
Stem 0
Stem Tuber 0
Unclassified 4.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100213830 3300005331 Bacteria 1677
2 Ga0070689_100018646 3300005340 Bacteria 5117
3 Ga0070673_100107175 3300005364 Bacteria 2311
4 Ga0070659_100371927 3300005366 Bacteria 1202
5 Ga0070667_100215838 3300005367 Bacteria 1706
6 Ga0070713_100045080 3300005436 Bacteria 3612
7 Ga0070713_100116036 3300005436 Bacteria 2341
8 Ga0070708_100451648 3300005445 Bacteria 1212
9 Ga0070662_100056222 3300005457 Bacteria 2856
10 Ga0070706_100189950 3300005467 Bacteria 1919
11 Ga0070698_100014542 3300005471 Bacteria 8308
12 Ga0070697_100132438 3300005536 Bacteria 2092
13 Ga0070697_100458216 3300005536 Bacteria 1111
14 Ga0070686_100079431 3300005544 Bacteria 2168
15 Ga0070665_100199568 3300005548 Bacteria 2001
16 Ga0068855_100063084 3300005563 Bacteria 4325
17 Ga0070664_100160869 3300005564 Bacteria 1986
18 Ga0068858_100042283 3300005842 Bacteria 4225
19 Ga0068860_100207670 3300005843 Bacteria 1899
20 Ga0081455_10000637 3300005937 Bacteria 45442
21 Ga0081455_10000930 3300005937 Bacteria 37470
22 Ga0081455_10002589 3300005937 Bacteria 21449
23 Ga0081455_10016270 3300005937 Bacteria 7188
24 Ga0081455_10017266 3300005937 Bacteria 6926
25 Ga0081455_10035763 3300005937 Bacteria 4433
26 Ga0070717_10051852 3300006028 Bacteria 3378
27 Ga0070717_10201771 3300006028 Bacteria 1742
28 Ga0070717_10212178 3300006028 Bacteria 1699
29 Ga0075365_10042780 3300006038 Bacteria 2963
30 Ga0075364_10032190 3300006051 Bacteria 3369
31 Ga0070712_100013364 3300006175 Bacteria 5246
32 Ga0070712_100160426 3300006175 Bacteria 1736
33 Ga0070712_100277075 3300006175 Bacteria 1350
34 Ga0075369_10014361 3300006186 Bacteria 3162
35 Ga0068871_100080559 3300006358 Bacteria 2696
36 Ga0075428_100026409 3300006844 Bacteria 6428
37 Ga0075428_100086785 3300006844 Bacteria 3413
38 Ga0075428_100099825 3300006844 Bacteria 3165
39 Ga0075428_100134824 3300006844 Bacteria 2685
40 Ga0075430_100024610 3300006846 Bacteria 5121
41 Ga0075431_100067519 3300006847 Bacteria 3691
42 Ga0075431_100474464 3300006847 Bacteria 1244
43 Ga0075433_10173967 3300006852 Bacteria 1915
44 Ga0075429_100112295 3300006880 Bacteria 2382
45 Ga0075429_100265214 3300006880 Bacteria 1504
46 Ga0099823_1020249 3300006944 Bacteria 6298
47 Ga0075435_100114999 3300007076 Bacteria 2240
48 Ga0099794_10015700 3300007265 Bacteria 3347
49 Ga0099794_10015925 3300007265 Bacteria 3326
50 Ga0105251_10050346 3300009011 Bacteria 1990
51 Ga0105251_10125249 3300009011 Bacteria 1166
52 Ga0105240_10097376 3300009093 Bacteria 3585
53 Ga0111539_10316918 3300009094 Bacteria 1815
54 Ga0111539_10492804 3300009094 Bacteria 1427
55 Ga0111539_10522281 3300009094 Bacteria 1383
56 Ga0105245_10175400 3300009098 Bacteria 2044
57 Ga0105245_10326932 3300009098 Bacteria 1512
58 Ga0105245_10497549 3300009098 Bacteria 1235
59 Ga0114129_10013167 3300009147 Bacteria 11783
60 Ga0114129_10051866 3300009147 Bacteria 5758
61 Ga0114129_10080691 3300009147 Bacteria 4522
62 Ga0114129_10105785 3300009147 Bacteria 3888
63 Ga0114129_10177513 3300009147 Bacteria 2900
64 Ga0114129_10281744 3300009147 Bacteria 2221
65 Ga0105242_10140256 3300009176 Bacteria 2097
66 Ga0105248_10062004 3300009177 Bacteria 4199
67 Ga0105248_10544967 3300009177 Bacteria 1309
68 Ga0105237_10108344 3300009545 Bacteria 2769
69 Ga0105237_10146790 3300009545 Bacteria 2354
70 Ga0105237_10432989 3300009545 Bacteria 1321
71 Ga0105238_10123848 3300009551 Bacteria 2564
72 Ga0105239_10118699 3300010375 Bacteria 2935
73 Ga0105239_10348308 3300010375 Bacteria 1672
74 Ga0105239_10514706 3300010375 Bacteria 1361
75 Ga0105246_10141711 3300011119 Bacteria 1808
76 Ga0157370_10040742 3300013104 Bacteria 4484
77 Ga0157370_10277742 3300013104 Bacteria 1548
78 Ga0157369_10014923 3300013105 Bacteria 8768
79 Ga0157369_10022574 3300013105 Bacteria 7019
80 Ga0157374_10068359 3300013296 Bacteria 3342
81 Ga0157374_10182823 3300013296 Bacteria 2049
82 Ga0157374_10349278 3300013296 Bacteria 1470
83 Ga0157378_10115641 3300013297 Bacteria 2465
84 Ga0163162_10106925 3300013306 Bacteria 2893
85 Ga0163162_10273556 3300013306 Bacteria 1821
86 Ga0163162_10277047 3300013306 Unclassified 1809
87 Ga0157372_10357207 3300013307 Bacteria 1702
88 Ga0157372_10778183 3300013307 Bacteria 1112
89 Ga0163163_10007784 3300014325 Bacteria 9468
90 Ga0163163_10016453 3300014325 Bacteria 6876
91 Ga0163163_10040195 3300014325 Bacteria 4567
92 Ga0163163_10129501 3300014325 Bacteria 2563
93 Ga0182008_10050035 3300014497 Bacteria 2074
94 Ga0182008_10065154 3300014497 Bacteria 1793
95 Ga0157377_10141494 3300014745 Bacteria 1479
96 Ga0157379_10087760 3300014968 Bacteria 2789
97 Ga0157379_10247297 3300014968 Bacteria 1618
98 Ga0157376_10215302 3300014969 Bacteria 1776
99 Ga0224712_10000657 3300022467 Bacteria 7084
100 Ga0207684_10163747 3300025910 Bacteria 1916
101 Ga0207684_10206337 3300025910 Bacteria 1695
102 Ga0207654_10027016 3300025911 Bacteria 3116
103 Ga0207654_10120798 3300025911 Bacteria 1645
104 Ga0207707_10032511 3300025912 Bacteria 4566
105 Ga0207695_10388263 3300025913 Bacteria 1281
106 Ga0207693_10006496 3300025915 Bacteria 9681
107 Ga0207663_10216503 3300025916 Bacteria 1391
108 Ga0207652_10030777 3300025921 Bacteria 4498
109 Ga0207650_10033992 3300025925 Bacteria 3696
110 Ga0207650_10167170 3300025925 Bacteria 1746
111 Ga0207700_10001928 3300025928 Bacteria 11801
112 Ga0207700_10030347 3300025928 Bacteria 3827
113 Ga0207700_10058663 3300025928 Bacteria 2908
114 Ga0207664_10075166 3300025929 Bacteria 2731
115 Ga0207670_10016818 3300025936 Bacteria 4407
116 Ga0207669_10078787 3300025937 Bacteria 2101
117 Ga0207704_10049036 3300025938 Bacteria 2537
118 Ga0207665_10126626 3300025939 Bacteria 1809
119 Ga0207689_10420576 3300025942 Bacteria 1115
120 Ga0207661_10000630 3300025944 Bacteria 22633
121 Ga0207679_10221233 3300025945 Bacteria 1593
122 Ga0207651_10071957 3300025960 Unclassified 2453
123 Ga0207651_10282004 3300025960 Bacteria 1374
124 Ga0207668_10062222 3300025972 Bacteria 2627
125 Ga0207668_10098373 3300025972 Bacteria 2168
126 Ga0207658_10233103 3300025986 Bacteria 1555
127 Ga0207678_10065388 3300026067 Bacteria 3123
128 Ga0207678_10074054 3300026067 Bacteria 2918
129 Ga0207678_10139978 3300026067 Bacteria 2065
130 Ga0207674_10063082 3300026116 Bacteria 3741
131 Ga0207683_10063761 3300026121 Bacteria 3247
132 Ga0209389_1000015 3300027296 Bacteria 188311
133 Ga0209489_100072 3300027361 Bacteria 138111
134 Ga0209700_100034 3300027363 Bacteria 197276
135 Ga0209588_1006717 3300027671 Bacteria 3359
136 Ga0265332_10059134 3300031238 Bacteria 1641
137 Ga0307509_10023867 3300031507 Bacteria 6856
138 Ga0307516_10003424 3300031730 Bacteria 20395
139 Ga0307516_10041981 3300031730 Bacteria 4541
140 Ga0307516_10057682 3300031730 Bacteria 3781
141 Ga0307516_10295501 3300031730 Bacteria 1297
142 Ga0307516_10318835 3300031730 Bacteria 1226
143 Ga0307507_10140147 3300033179 Bacteria 1857
144 Ga0307510_10020175 3300033180 Bacteria 7797
145 Ga0307510_10305770 3300033180 Bacteria 1051
146 Ga0315911_1000003 3300033442 Bacteria 502217
147 Ga0373926_0009466 3300035083 Bacteria 3256
148 Ga0373953_0045970 3300035117 Bacteria 1752
149 Ga0373943_0014764 3300035170 Bacteria 3542
150 Ga0373943_0094845 3300035170 Bacteria 1551
151 Ga0373946_0020050 3300035171 Bacteria 2581
152 Ga0373935_0021576 3300035692 Bacteria 3944
153 Ga0373927_0034568 3300035695 Bacteria 3288
154 Ga0373927_0069794 3300035695 Bacteria 2274
155 Ga0373947_0023431 3300035725 Bacteria 3590
156 Ga0373937_0023784 3300036401 Bacteria 5523
157 Ga0395900_0067465 3300037418 Bacteria 3675
158 Ga0395898_0305245 3300037466 Bacteria 1518
159 Ga0395901_0088761 3300038443 Bacteria 3234
160 Ga0395901_0134949 3300038443 Bacteria 2594
161 Ga0436360_0994312 3300039438 Bacteria 1911
162 Ga0495617_013706 3300046452 Bacteria 2756
163 Ga0495592_0085352 3300046454 Unclassified 2276
164 Ga0495603_0044040 3300046455 Bacteria 2663
165 Ga0495603_0104234 3300046455 Bacteria 1655
166 Ga0495629_0045329 3300046459 Bacteria 3085
167 Ga0495629_0052354 3300046459 Bacteria 2856
168 Ga0495638_0004740 3300046460 Bacteria 10261
169 Ga0495638_0005224 3300046460 Bacteria 9701
170 Ga0495641_0032011 3300046461 Bacteria 2507
171 Ga0495651_0072702 3300046462 Bacteria 2611
172 Ga0495650_0060289 3300046471 Bacteria 1524
173 Ga0495580_0092695 3300046472 Bacteria 2103
174 Ga0495580_0105181 3300046472 Bacteria 1961
175 Ga0495582_0057462 3300046473 Bacteria 2145
176 Ga0495639_0029315 3300046475 Bacteria 2442
177 Ga0495639_0122574 3300046475 Bacteria 1241
178 Ga0495639_0139947 3300046475 Bacteria 1163
179 Ga0495664_0029533 3300046477 Bacteria 3207
180 Ga0495664_0031784 3300046477 Unclassified 3095
181 Ga0495664_0103340 3300046477 Bacteria 1718
182 Ga0495584_0012550 3300046491 Bacteria 4325
183 Ga0495584_0036478 3300046491 Bacteria 2484
184 Ga0495584_0097673 3300046491 Bacteria 1484
185 Ga0495584_0107150 3300046491 Bacteria 1413
186 Ga0495585_0025666 3300046492 Bacteria 3372
187 Ga0495585_0050527 3300046492 Bacteria 2306
188 Ga0495594_0037382 3300046499 Bacteria 2649
189 Ga0495594_0049923 3300046499 Bacteria 2300
190 Ga0495594_0064619 3300046499 Bacteria 2029
191 Ga0495596_0021978 3300046500 Bacteria 2599
192 Ga0495596_0023563 3300046500 Bacteria 2496
193 Ga0495607_0012881 3300046501 Bacteria 5500
194 Ga0495607_0109979 3300046501 Bacteria 1462
195 Ga0495607_0112566 3300046501 Bacteria 1441
196 Ga0495583_0036141 3300046506 Bacteria 2352
197 Ga0495610_0035722 3300046512 Bacteria 2548
198 Ga0495616_0013005 3300046513 Bacteria 4706
199 Ga0495616_0053921 3300046513 Bacteria 1996
200 Ga0495618_0012254 3300046514 Bacteria 5205
201 Ga0495620_0033821 3300046515 Bacteria 2316
202 Ga0495630_0106514 3300046517 Bacteria 2123
203 Ga0495630_0183498 3300046517 Bacteria 1596
204 Ga0495631_0031154 3300046518 Bacteria 2415
205 Ga0495631_0053982 3300046518 Bacteria 1753
206 Ga0495632_0032990 3300046519 Bacteria 2662
207 Ga0495632_0069029 3300046519 Bacteria 1702
208 Ga0495644_0007531 3300046523 Bacteria 4196
209 Ga0495644_0008945 3300046523 Bacteria 3850
210 Ga0495644_0020835 3300046523 Bacteria 2500
211 Ga0495648_0009128 3300046524 Bacteria 7732
212 Ga0495648_0013712 3300046524 Bacteria 5974
213 Ga0495648_0026804 3300046524 Bacteria 3871
214 Ga0495648_0032919 3300046524 Bacteria 3393
215 Ga0495663_0003143 3300046525 Bacteria 4818
216 Ga0495663_0009716 3300046525 Bacteria 2669
217 Ga0495663_0058227 3300046525 Bacteria 1210
218 Ga0495666_0030424 3300046526 Bacteria 2649
219 Ga0495666_0094417 3300046526 Bacteria 1411
220 Ga0495642_0018060 3300046528 Bacteria 2758
221 Ga0495642_0139012 3300046528 Bacteria 1048
222 Ga0495665_0029119 3300046531 Bacteria 2960
223 Ga0495640_0019583 3300046533 Bacteria 4991
224 Ga0495640_0104844 3300046533 Bacteria 1853
225 Ga0495640_0176001 3300046533 Bacteria 1366
226 Ga0495640_0228120 3300046533 Bacteria 1172
227 Ga0495586_0086792 3300046535 Bacteria 1725
228 Ga0495586_0141138 3300046535 Bacteria 1352
229 Ga0495598_0001732 3300046537 Bacteria 4376
230 Ga0495598_0005236 3300046537 Bacteria 2861
231 Ga0495609_0064717 3300046538 Bacteria 1612
232 Ga0495621_0002644 3300046539 Bacteria 4844
233 Ga0495621_0017625 3300046539 Bacteria 2310
234 Ga0495597_0013712 3300046542 Bacteria 3875
235 Ga0495645_0316365 3300046543 Bacteria 1015
236 Ga0495622_0063490 3300046557 Bacteria 1709
237 Ga0495633_0017030 3300046558 Bacteria 3727
238 Ga0495656_0007832 3300046615 Bacteria 3794
239 Ga0495656_0012919 3300046615 Bacteria 3095
240 Ga0495656_0039528 3300046615 Bacteria 1960
241 Ga0495656_0152869 3300046615 Bacteria 1116
242 Ga0495634_0011334 3300046642 Bacteria 6492
243 Ga0495634_0027510 3300046642 Bacteria 3956
244 Ga0495634_0086331 3300046642 Bacteria 2044
245 Ga0495611_0003456 3300046648 Bacteria 6963
246 Ga0495611_0050802 3300046648 Bacteria 1868
247 Ga0495611_0131888 3300046648 Bacteria 1165
248 Ga0495625_0041966 3300046660 Bacteria 3326
249 Ga0495625_0117097 3300046660 Bacteria 1816
250 Ga0495635_0087519 3300046663 Bacteria 2132
251 Ga0495635_0290789 3300046663 Bacteria 1096
252 Ga0495659_0013958 3300046664 Bacteria 2621
253 Ga0495659_0043694 3300046664 Bacteria 1609
254 Ga0495661_0042919 3300046665 Bacteria 2784
255 Ga0495661_0045872 3300046665 Bacteria 2670
256 Ga0495588_0026223 3300046674 Bacteria 2908
257 Ga0495599_0013289 3300046678 Bacteria 5088
258 Ga0495599_0059081 3300046678 Bacteria 2398
259 Ga0495599_0061252 3300046678 Bacteria 2352
260 Ga0495646_0011795 3300046680 Bacteria 5557
261 Ga0495647_0034436 3300046681 Bacteria 1896
262 Ga0495647_0059482 3300046681 Bacteria 1505
263 Ga0495647_0076341 3300046681 Bacteria 1350
264 Ga0495658_0008984 3300046683 Bacteria 4967
265 Ga0495658_0214935 3300046683 Bacteria 1202
266 Ga0495669_0013034 3300046684 Bacteria 3542
267 Ga0495669_0153283 3300046684 Bacteria 1092
268 Ga0495624_0123856 3300046690 Bacteria 1587
269 Ga0495670_0010100 3300046691 Bacteria 4642
270 Ga0495670_0023393 3300046691 Bacteria 3049
271 Ga0495671_0104385 3300046692 Bacteria 1384
272 Ga0495649_0014945 3300046694 Bacteria 4435
273 Ga0495649_0022162 3300046694 Bacteria 3554
274 Ga0495649_0058322 3300046694 Bacteria 2080
275 Ga0495589_0072984 3300046794 Bacteria 1675
276 Ga0495589_0164340 3300046794 Bacteria 1057
277 Ga0495600_0137900 3300046809 Bacteria 1583
278 Ga0495660_0136906 3300046810 Bacteria 1223
279 Ga0495581_0091788 3300047315 Unclassified 1762
280 Ga0495581_0202153 3300047315 Bacteria 1162
281 Ga0495581_0214058 3300047315 Bacteria 1126
282 Ga0495636_0004278 3300047318 Bacteria 5603
283 Ga0495636_0030330 3300047318 Bacteria 2210
284 Ga0495674_0075023 3300047319 Unclassified 2911
285 Ga0495674_0089312 3300047319 Bacteria 2634
286 Ga0495674_0093920 3300047319 Unclassified 2559
287 Ga0495672_0099892 3300047320 Bacteria 1576
288 Ga0495672_0145695 3300047320 Bacteria 1232
289 Ga0495676_0161495 3300047321 Bacteria 1585
290 Ga0495676_0182305 3300047321 Bacteria 1471
291 Ga0495676_0253636 3300047321 Bacteria 1199
292 Ga0495683_0109302 3300047323 Bacteria 1321
293 Ga0495675_0098661 3300047444 Bacteria 1830
294 Ga0495675_0199144 3300047444 Bacteria 1220
295 Ga0495677_0027355 3300047445 Bacteria 2070
296 Ga0495677_0079559 3300047445 Bacteria 1227
297 Ga0495679_007805 3300047446 Bacteria 4415
298 Ga0495679_031334 3300047446 Bacteria 1716
299 Ga0495685_031062 3300047447 Bacteria 1837
300 Ga0495673_0015090 3300047469 Bacteria 3992
301 Ga0495673_0016971 3300047469 Bacteria 3708
302 Ga0495681_0038563 3300047470 Bacteria 2340
303 Ga0495684_0079622 3300047471 Bacteria 2487
304 Ga0495684_0104252 3300047471 Bacteria 2143
305 Ga0495684_0127198 3300047471 Bacteria 1916
306 Ga0495686_0025512 3300047472 Bacteria 3873
307 Ga0495686_0046719 3300047472 Bacteria 2735
308 Ga0495602_0016616 3300048088 Bacteria 7397
309 Ga0495602_0045305 3300048088 Bacteria 3981
310 Ga0495602_0076302 3300048088 Bacteria 2840
311 Ga0495602_0151933 3300048088 Bacteria 1819
312 Ga0495615_0000613 3300048090 Bacteria 5013
313 Ga0495615_0005456 3300048090 Bacteria 2288
314 Ga0496100_0133060 3300048903 Bacteria 1754
315 Ga0496101_0343794 3300048904 Bacteria 1172
316 Ga0496102_0274358 3300048905 Bacteria 1590
317 Ga0496102_0326728 3300048905 Bacteria 1445
318 Ga0496103_0037022 3300048906 Bacteria 2990
319 Ga0496104_0063652 3300048907 Bacteria 3498
320 Ga0496104_0262825 3300048907 Bacteria 1638
321 Ga0496104_0298069 3300048907 Bacteria 1524
322 Ga0496104_0298716 3300048907 Bacteria 1522
323 Ga0496104_0472173 3300048907 Bacteria 1166
324 Ga0496105_0019695 3300048908 Bacteria 5444
325 Ga0496105_0074691 3300048908 Bacteria 2800
326 Ga0496105_0201710 3300048908 Bacteria 1623
327 Ga0496106_0078106 3300048909 Bacteria 2539
328 Ga0496107_0086322 3300048910 Bacteria 2290
329 Ga0496108_0004786 3300048911 Bacteria 10919
330 Ga0496108_0006710 3300048911 Bacteria 9321
331 Ga0496108_0022680 3300048911 Bacteria 5163
332 Ga0496109_0004008 3300048912 Bacteria 12300
333 Ga0496109_0021570 3300048912 Bacteria 5697
334 Ga0496109_0028693 3300048912 Bacteria 4980
335 Ga0496109_0141144 3300048912 Bacteria 2252
336 Ga0496110_0021863 3300048913 Bacteria 5423
337 Ga0496110_0125219 3300048913 Bacteria 2318
338 Ga0496110_0253279 3300048913 Bacteria 1602
339 Ga0496110_0359057 3300048913 Bacteria 1327
340 Ga0496111_0004217 3300048914 Bacteria 9053
341 Ga0496111_0053084 3300048914 Bacteria 2928
342 Ga0496111_0075785 3300048914 Bacteria 2451
343 Ga0496112_0014107 3300048915 Bacteria 7399
344 Ga0496112_0026947 3300048915 Bacteria 5539
345 Ga0496112_0040574 3300048915 Bacteria 4551
346 Ga0496112_0235721 3300048915 Bacteria 1783
347 Ga0496112_0254779 3300048915 Bacteria 1705
348 Ga0496113_0000306 3300048916 Bacteria 23294
349 Ga0496113_0009900 3300048916 Bacteria 6280
350 Ga0496113_0154044 3300048916 Bacteria 1814
351 Ga0496114_0397569 3300048917 Bacteria 1220
352 Ga0496115_0016002 3300048918 Bacteria 5704
353 Ga0496115_0093469 3300048918 Bacteria 2459
354 Ga0496125_0059384 3300048928 Bacteria 3082
355 Ga0496126_0609289 3300048929 Bacteria 859
356 Ga0495682_0012310 3300049460 Bacteria 3282
357 Ga0495682_0018052 3300049460 Bacteria 2657
358 Ga0501037_0170683 3300049573 Bacteria 1546
359 Ga0501040_0033431 3300049576 Bacteria 3484
360 Ga0501041_0124556 3300049577 Bacteria 1603
361 Ga0501075_0132226 3300049591 Bacteria 1901
362 Ga0501075_0179667 3300049591 Unclassified 1615
363 Ga0501035_0075961 3300049822 Bacteria 2971
364 nmdc:mga03683_96924_c1 3300050489 Bacteria 1292
365 nmdc:mga00v17_13282_c1 3300050491 Bacteria 4567
366 nmdc:mga0k408_45552_c1 3300050493 Bacteria 2531
367 nmdc:mga06z11_216292_c1 3300050494 Bacteria 1118
368 nmdc:mga05p37_208724_c1 3300050507 Bacteria 2362
369 nmdc:mga05p37_230142_c1 3300050507 Bacteria 2234
370 nmdc:mga05p37_37645_c1 3300050507 Bacteria 5932
371 nmdc:mga05p37_49929_c1 3300050507 Bacteria 5146
372 nmdc:mga05p37_50294_c1 3300050507 Bacteria 5126
373 nmdc:mga05p37_81606_c1 3300050507 Bacteria 3983
374 nmdc:mga09592_6142_c1 3300050508 Bacteria 9782
375 nmdc:mga0qj67_176950_c1 3300050509 Bacteria 1733
376 nmdc:mga06r32_14387_c1 3300050510 Bacteria 7181
377 nmdc:mga06r32_32585_c1 3300050510 Bacteria 4904
378 nmdc:mga08y16_525415_c1 3300050511 Bacteria 1200
379 nmdc:mga0n895_38581_c1 3300050512 Bacteria 4629
380 nmdc:mga0rr50_112044_c1 3300050513 Bacteria 2160
381 nmdc:mga0rr50_45536_c1 3300050513 Bacteria 3225
382 nmdc:mga0a205_129959_c1 3300050515 Bacteria 2419
383 nmdc:mga0sz30_7244_c1 3300050516 Bacteria 4156
384 Ga0495601_0003352 3300053077 Bacteria 9174
385 Ga0495601_0018020 3300053077 Bacteria 4292
386 Ga0495601_0026787 3300053077 Plasmid 3561
387 Ga0495601_0092814 3300053077 Bacteria 1944
388 Ga0495601_0149454 3300053077 Bacteria 1525
389 Ga0495601_0164131 3300053077 Bacteria 1452
390 Ga0495612_0015784 3300053078 Bacteria 3027
391 Ga0495612_0019869 3300053078 Bacteria 2691
392 Ga0495612_0034254 3300053078 Unclassified 2056
393 Ga0500610_0091071 3300053079 Bacteria 1584
394 Ga0495655_0033845 3300053083 Bacteria 1260
395 Ga0495619_0048294 3300053085 Bacteria 2804
396 Ga0495619_0218683 3300053085 Bacteria 1319
397 Ga0495619_0274149 3300053085 Bacteria 1169
398 Ga0500578_0033516 3300053086 Bacteria 3300
399 Ga0500643_000210 3300053087 Bacteria 55059
400 Ga0500643_019213 3300053087 Bacteria 2254
401 Ga0500583_0019067 3300053092 Bacteria 2804
402 Ga0500651_0002157 3300053093 Bacteria 10272
403 Ga0500641_0023426 3300053096 Bacteria 2374
404 Ga0500650_0044987 3300053098 Bacteria 2044
405 Ga0500650_0055646 3300053098 Bacteria 1842
406 Ga0500555_005225 3300053103 Bacteria 3682
407 Ga0500555_036480 3300053103 Bacteria 1379
408 Ga0500562_004550 3300053108 Bacteria 3503
409 Ga0500562_014818 3300053108 Bacteria 1998
410 Ga0500594_0068001 3300053118 Bacteria 1041
411 Ga0500595_015442 3300053119 Bacteria 2865
412 Ga0500642_0020752 3300053130 Bacteria 2588
413 Ga0500658_0005099 3300053134 Bacteria 4889
414 Ga0500559_0063946 3300053136 Bacteria 1645
415 Ga0500573_0021956 3300053140 Bacteria 3662
416 Ga0500573_0051769 3300053140 Bacteria 2361
417 Ga0500577_0067587 3300053142 Bacteria 1393
418 Ga0500577_0081949 3300053142 Bacteria 1288
419 Ga0500589_055607 3300053147 Bacteria 1826
420 Ga0500604_0016137 3300053151 Bacteria 2054
421 Ga0500616_0007197 3300053153 Bacteria 7116
422 Ga0500622_0004296 3300053156 Bacteria 9027
423 Ga0500622_0008571 3300053156 Bacteria 5708
424 Ga0500627_0131499 3300053158 Bacteria 1130
425 Ga0500633_0002567 3300053160 Bacteria 3770
426 Ga0500636_0039064 3300053177 Bacteria 2806
427 Ga0500636_0082385 3300053177 Bacteria 1852
428 Ga0500637_0135939 3300053178 Bacteria 1424
429 Ga0500657_101856 3300053728 Bacteria 1183
430 Ga0500645_007041 3300053730 Bacteria 3950
431 Ga0500599_000332 3300053736 Bacteria 4665
432 Ga0501084_0135036 3300054114 Unclassified 2077
433 Ga0501082_0072189 3300060353 Bacteria 2973

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100458216 Ga0070697_1004582161 237
2 3300048929 Ga0496126_0609289 Ga0496126_0609289_32_802 255
3 iso_pu_bacteria 2513237094 2513638835 280
4 3300046528 Ga0495642_0139012 Ga0495642_0139012_41_955 281
5 3300046491 Ga0495584_0107150 Ga0495584_0107150_223_1134 282
6 3300046794 Ga0495589_0164340 Ga0495589_0164340_52_963 282
7 iso_pu_bacteria 2508501042 2508697152 282
8 iso_pu_bacteria 2935648319 2935655855 282
9 iso_pu_bacteria 2935656913 2935664734 282
10 iso_pu_bacteria 2935959822 2935963938 282
11 iso_pu_bacteria 2935984226 2935988117 282
12 iso_pu_bacteria 2936019824 2936027324 282
13 iso_pu_bacteria 2936028420 2936036792 282
14 iso_pu_bacteria 2936055302 2936063156 282
15 iso_pu_bacteria 8016630954 8016633224 282
16 3300046460 Ga0495638_0005224 Ga0495638_0005224_4556_5437 286
17 3300046512 Ga0495610_0035722 Ga0495610_0035722_436_1299 286
18 3300046524 Ga0495648_0013712 Ga0495648_0013712_4487_5350 286
19 3300046648 Ga0495611_0050802 Ga0495611_0050802_918_1778 286
20 3300053086 Ga0500578_0033516 Ga0500578_0033516_616_1479 286
21 3300053087 Ga0500643_000210 Ga0500643_000210_28676_29539 286
22 3300053098 Ga0500650_0055646 Ga0500650_0055646_740_1603 286
23 3300053103 Ga0500555_005225 Ga0500555_005225_2527_3387 286
24 3300053108 Ga0500562_004550 Ga0500562_004550_2073_2954 286
25 3300053118 Ga0500594_0068001 Ga0500594_0068001_82_945 286
26 3300053130 Ga0500642_0020752 Ga0500642_0020752_345_1205 286
27 3300053142 Ga0500577_0081949 Ga0500577_0081949_190_1050 286
28 3300053147 Ga0500589_055607 Ga0500589_055607_13_876 286
29 3300053151 Ga0500604_0016137 Ga0500604_0016137_377_1240 286
30 3300053153 Ga0500616_0007197 Ga0500616_0007197_5259_6122 286
31 3300053156 Ga0500622_0008571 Ga0500622_0008571_1205_2068 286
32 3300053160 Ga0500633_0002567 Ga0500633_0002567_2721_3584 286
33 3300053730 Ga0500645_007041 Ga0500645_007041_2657_3520 286
34 3300053736 Ga0500599_000332 Ga0500599_000332_1021_1884 286
35 3300014497 Ga0182008_10065154 Ga0182008_100651542 288
36 iso_pu_bacteria 2874620515 2874622400 292
37 iso_pu_bacteria 2885374607 2885376596 292
38 iso_pu_bacteria 2903748898 2903751447 292
39 iso_pu_bacteria 2904666416 2904671593 292
40 3300046694 Ga0495649_0014945 Ga0495649_0014945_3333_4247 293
41 iso_pu_bacteria 8019619141 8019621347 293
42 3300046526 Ga0495666_0030424 Ga0495666_0030424_1238_2128 296
43 3300038443 Ga0395901_0134949 Ga0395901_0134949_19_948 297
44 iso_pu_bacteria 2599185301 2599940634 297
45 3300007265 Ga0099794_10015700 Ga0099794_100157003 298
46 iso_pu_bacteria 2513237096 2513661130 298
47 iso_pu_bacteria 2513237145 2513916940 298
48 iso_pu_bacteria 2935630451 2935636831 298
49 iso_pu_bacteria 2941507105 2941513468 298
50 iso_pu_bacteria 2941515067 2941521431 298
51 iso_pu_bacteria 2941523033 2941529249 298
52 iso_pu_bacteria 3005474847 3005480739 298
53 3300005340 Ga0070689_100018646 Ga0070689_1000186462 299
54 3300005364 Ga0070673_100107175 Ga0070673_1001071753 299
55 3300005467 Ga0070706_100189950 Ga0070706_1001899501 299
56 3300006175 Ga0070712_100277075 Ga0070712_1002770751 299
57 3300009094 Ga0111539_10492804 Ga0111539_104928041 299
58 3300010375 Ga0105239_10348308 Ga0105239_103483082 299
59 3300025910 Ga0207684_10206337 Ga0207684_102063371 299
60 3300025925 Ga0207650_10033992 Ga0207650_100339923 299
61 3300025936 Ga0207670_10016818 Ga0207670_100168182 299
62 3300025960 Ga0207651_10071957 Ga0207651_100719573 299
63 3300046664 Ga0495659_0043694 Ga0495659_0043694_594_1499 299
64 3300005548 Ga0070665_100199568 Ga0070665_1001995683 300
65 3300005937 Ga0081455_10000637 Ga0081455_1000063712 300
66 3300005937 Ga0081455_10035763 Ga0081455_100357632 300
67 3300006175 Ga0070712_100160426 Ga0070712_1001604262 300
68 3300006844 Ga0075428_100134824 Ga0075428_1001348243 300
69 3300006847 Ga0075431_100474464 Ga0075431_1004744642 300
70 3300006852 Ga0075433_10173967 Ga0075433_101739672 300
71 3300009098 Ga0105245_10326932 Ga0105245_103269322 300
72 3300009147 Ga0114129_10051866 Ga0114129_100518661 300
73 3300009147 Ga0114129_10281744 Ga0114129_102817442 300
74 3300013296 Ga0157374_10068359 Ga0157374_100683593 300
75 3300013297 Ga0157378_10115641 Ga0157378_101156412 300
76 3300013306 Ga0163162_10277047 Ga0163162_102770471 300
77 3300014968 Ga0157379_10087760 Ga0157379_100877602 300
78 3300033442 Ga0315911_1000003 Ga0315911_1000003350 300
79 3300037418 Ga0395900_0067465 Ga0395900_0067465_79_990 300
80 3300038443 Ga0395901_0088761 Ga0395901_0088761_2059_2970 300
81 3300046501 Ga0495607_0112566 Ga0495607_0112566_348_1259 300
82 3300048905 Ga0496102_0326728 Ga0496102_0326728_47_958 300
83 3300048906 Ga0496103_0037022 Ga0496103_0037022_26_937 300
84 3300048918 Ga0496115_0093469 Ga0496115_0093469_28_939 300
85 3300049576 Ga0501040_0033431 Ga0501040_0033431_958_1875 300
86 3300049577 Ga0501041_0124556 Ga0501041_0124556_473_1390 300
87 3300049591 Ga0501075_0132226 Ga0501075_0132226_774_1691 300
88 3300050507 nmdc:mga05p37_208724_c1 nmdc:mga05p37_208724_c1_572_1483 300
89 3300050507 nmdc:mga05p37_49929_c1 nmdc:mga05p37_49929_c1_4162_5073 300
90 3300050513 nmdc:mga0rr50_112044_c1 nmdc:mga0rr50_112044_c1_1109_2020 300
91 3300050515 nmdc:mga0a205_129959_c1 nmdc:mga0a205_129959_c1_146_1057 300
92 3300053134 Ga0500658_0005099 Ga0500658_0005099_3796_4710 300
93 3300054114 Ga0501084_0135036 Ga0501084_0135036_112_1029 300
94 3300060353 Ga0501082_0072189 Ga0501082_0072189_2024_2941 300
95 3300005536 Ga0070697_100132438 Ga0070697_1001324381 301
96 3300049573 Ga0501037_0170683 Ga0501037_0170683_249_1166 301
97 3300049822 Ga0501035_0075961 Ga0501035_0075961_1509_2426 301
98 3300005436 Ga0070713_100045080 Ga0070713_1000450802 302
99 3300005436 Ga0070713_100116036 Ga0070713_1001160362 302
100 3300006028 Ga0070717_10212178 Ga0070717_102121782 302
101 3300006038 Ga0075365_10042780 Ga0075365_100427804 302
102 3300006051 Ga0075364_10032190 Ga0075364_100321902 302
103 3300006186 Ga0075369_10014361 Ga0075369_100143611 302
104 3300006844 Ga0075428_100086785 Ga0075428_1000867853 302
105 3300009147 Ga0114129_10177513 Ga0114129_101775135 302
106 3300014968 Ga0157379_10247297 Ga0157379_102472972 302
107 3300025915 Ga0207693_10006496 Ga0207693_100064969 302
108 3300025928 Ga0207700_10030347 Ga0207700_100303475 302
109 3300025928 Ga0207700_10058663 Ga0207700_100586632 302
110 3300035117 Ga0373953_0045970 Ga0373953_0045970_331_1242 302
111 3300046454 Ga0495592_0085352 Ga0495592_0085352_315_1226 302
112 3300046460 Ga0495638_0004740 Ga0495638_0004740_1689_2609 302
113 3300046477 Ga0495664_0029533 Ga0495664_0029533_1642_2553 302
114 3300046477 Ga0495664_0031784 Ga0495664_0031784_2114_3025 302
115 3300046615 Ga0495656_0152869 Ga0495656_0152869_185_1093 302
116 3300046642 Ga0495634_0086331 Ga0495634_0086331_548_1471 302
117 3300046678 Ga0495599_0013289 Ga0495599_0013289_623_1558 302
118 3300046678 Ga0495599_0059081 Ga0495599_0059081_548_1459 302
119 3300046809 Ga0495600_0137900 Ga0495600_0137900_651_1562 302
120 3300047319 Ga0495674_0075023 Ga0495674_0075023_416_1327 302
121 3300047444 Ga0495675_0098661 Ga0495675_0098661_804_1721 302
122 3300048088 Ga0495602_0016616 Ga0495602_0016616_5445_6356 302
123 3300048088 Ga0495602_0045305 Ga0495602_0045305_1012_1923 302
124 3300048088 Ga0495602_0076302 Ga0495602_0076302_1574_2509 302
125 3300048907 Ga0496104_0472173 Ga0496104_0472173_157_1134 302
126 3300050489 nmdc:mga03683_96924_c1 nmdc:mga03683_96924_c1_230_1153 302
127 3300050491 nmdc:mga00v17_13282_c1 nmdc:mga00v17_13282_c1_2874_3797 302
128 3300050493 nmdc:mga0k408_45552_c1 nmdc:mga0k408_45552_c1_236_1159 302
129 3300050507 nmdc:mga05p37_230142_c1 nmdc:mga05p37_230142_c1_251_1174 302
130 3300050516 nmdc:mga0sz30_7244_c1 nmdc:mga0sz30_7244_c1_393_1316 302
131 3300053077 Ga0495601_0026787 Ga0495601_0026787_1486_2397 302
132 3300053078 Ga0495612_0019869 Ga0495612_0019869_1304_2215 302
133 3300053078 Ga0495612_0034254 Ga0495612_0034254_483_1394 302
134 iso_pu_bacteria 2513237092 2513625603 302
135 iso_pu_bacteria 2791355082 2792581028 302
136 iso_pu_bacteria 2847930680 2847939796 302
137 iso_pu_bacteria 2871495908 2871496223 302
138 iso_pu_bacteria 2874168670 2874170098 302
139 iso_pu_bacteria 2878760144 2878760452 302
140 iso_pu_bacteria 2878767105 2878767415 302
141 iso_pu_bacteria 2879083081 2879088231 302
142 iso_pu_bacteria 2885409591 2885410961 302
143 iso_pu_bacteria 2903540706 2903541017 302
144 iso_pu_bacteria 2906643746 2906649318 302
145 iso_pu_bacteria 2924762789 2924767870 302
146 iso_pu_bacteria 2935675223 2935680229 302
147 iso_pu_bacteria 2935684952 2935693722 302
148 iso_pu_bacteria 2935694250 2935700782 302
149 iso_pu_bacteria 2935713505 2935722419 302
150 iso_pu_bacteria 2935722832 2935731728 302
151 iso_pu_bacteria 2935732158 2935740937 302
152 iso_pu_bacteria 2935741537 2935750360 302
153 iso_pu_bacteria 2935750917 2935759907 302
154 iso_pu_bacteria 2935760218 2935768728 302
155 iso_pu_bacteria 2937994558 2937994870 302
156 iso_pu_bacteria 2940556831 2940565812 302
157 iso_pu_bacteria 2958165035 2958165350 302
158 iso_pu_bacteria 2961163497 2961163808 302
159 iso_pu_bacteria 2965018300 2965018613 302
160 iso_pu_bacteria 2968171901 2968172214 302
161 iso_pu_bacteria 2970554993 2970555304 302
162 iso_pu_bacteria 2987659509 2987659820 302
163 iso_pu_bacteria 2987666974 2987672276 302
164 iso_pu_bacteria 3004188549 3004188867 302
165 iso_pu_bacteria 3005483717 3005490560 302
166 iso_pu_bacteria 8006984368 8006992748 302
167 iso_pu_bacteria 8019648815 8019654664 302
168 iso_pu_bacteria 8049293176 8049297153 302
169 3300005331 Ga0070670_100213830 Ga0070670_1002138302 303
170 3300005366 Ga0070659_100371927 Ga0070659_1003719271 303
171 3300005367 Ga0070667_100215838 Ga0070667_1002158381 303
172 3300005445 Ga0070708_100451648 Ga0070708_1004516482 303
173 3300005457 Ga0070662_100056222 Ga0070662_1000562221 303
174 3300005471 Ga0070698_100014542 Ga0070698_1000145422 303
175 3300005544 Ga0070686_100079431 Ga0070686_1000794312 303
176 3300005563 Ga0068855_100063084 Ga0068855_1000630844 303
177 3300005564 Ga0070664_100160869 Ga0070664_1001608693 303
178 3300005842 Ga0068858_100042283 Ga0068858_1000422834 303
179 3300005843 Ga0068860_100207670 Ga0068860_1002076703 303
180 3300005937 Ga0081455_10000930 Ga0081455_100009305 303
181 3300005937 Ga0081455_10002589 Ga0081455_1000258920 303
182 3300005937 Ga0081455_10016270 Ga0081455_100162707 303
183 3300005937 Ga0081455_10017266 Ga0081455_100172669 303
184 3300006028 Ga0070717_10051852 Ga0070717_100518522 303
185 3300006028 Ga0070717_10201771 Ga0070717_102017712 303
186 3300006175 Ga0070712_100013364 Ga0070712_1000133644 303
187 3300006358 Ga0068871_100080559 Ga0068871_1000805595 303
188 3300006844 Ga0075428_100026409 Ga0075428_1000264098 303
189 3300006844 Ga0075428_100099825 Ga0075428_1000998251 303
190 3300006846 Ga0075430_100024610 Ga0075430_1000246102 303
191 3300006847 Ga0075431_100067519 Ga0075431_1000675193 303
192 3300006880 Ga0075429_100112295 Ga0075429_1001122953 303
193 3300006880 Ga0075429_100265214 Ga0075429_1002652142 303
194 3300006944 Ga0099823_1020249 Ga0099823_10202495 303
195 3300007076 Ga0075435_100114999 Ga0075435_1001149992 303
196 3300007265 Ga0099794_10015925 Ga0099794_100159253 303
197 3300009011 Ga0105251_10050346 Ga0105251_100503463 303
198 3300009011 Ga0105251_10125249 Ga0105251_101252491 303
199 3300009093 Ga0105240_10097376 Ga0105240_100973764 303
200 3300009094 Ga0111539_10316918 Ga0111539_103169182 303
201 3300009094 Ga0111539_10522281 Ga0111539_105222812 303
202 3300009098 Ga0105245_10175400 Ga0105245_101754001 303
203 3300009098 Ga0105245_10497549 Ga0105245_104975491 303
204 3300009147 Ga0114129_10013167 Ga0114129_1001316721 303
205 3300009147 Ga0114129_10080691 Ga0114129_100806913 303
206 3300009147 Ga0114129_10105785 Ga0114129_101057853 303
207 3300009176 Ga0105242_10140256 Ga0105242_101402564 303
208 3300009177 Ga0105248_10062004 Ga0105248_100620046 303
209 3300009177 Ga0105248_10544967 Ga0105248_105449671 303
210 3300009545 Ga0105237_10108344 Ga0105237_101083442 303
211 3300009545 Ga0105237_10146790 Ga0105237_101467903 303
212 3300009545 Ga0105237_10432989 Ga0105237_104329892 303
213 3300009551 Ga0105238_10123848 Ga0105238_101238482 303
214 3300010375 Ga0105239_10118699 Ga0105239_101186992 303
215 3300010375 Ga0105239_10514706 Ga0105239_105147061 303
216 3300011119 Ga0105246_10141711 Ga0105246_101417112 303
217 3300013104 Ga0157370_10040742 Ga0157370_100407423 303
218 3300013104 Ga0157370_10277742 Ga0157370_102777422 303
219 3300013105 Ga0157369_10014923 Ga0157369_100149231 303
220 3300013105 Ga0157369_10022574 Ga0157369_100225743 303
221 3300013296 Ga0157374_10182823 Ga0157374_101828232 303
222 3300013296 Ga0157374_10349278 Ga0157374_103492782 303
223 3300013306 Ga0163162_10106925 Ga0163162_101069255 303
224 3300013306 Ga0163162_10273556 Ga0163162_102735562 303
225 3300013307 Ga0157372_10357207 Ga0157372_103572072 303
226 3300013307 Ga0157372_10778183 Ga0157372_107781831 303
227 3300014325 Ga0163163_10007784 Ga0163163_100077847 303
228 3300014325 Ga0163163_10016453 Ga0163163_1001645311 303
229 3300014325 Ga0163163_10040195 Ga0163163_100401952 303
230 3300014325 Ga0163163_10129501 Ga0163163_101295011 303
231 3300014497 Ga0182008_10050035 Ga0182008_100500352 303
232 3300014745 Ga0157377_10141494 Ga0157377_101414942 303
233 3300014969 Ga0157376_10215302 Ga0157376_102153022 303
234 3300022467 Ga0224712_10000657 Ga0224712_100006576 303
235 3300025910 Ga0207684_10163747 Ga0207684_101637472 303
236 3300025911 Ga0207654_10027016 Ga0207654_100270162 303
237 3300025911 Ga0207654_10120798 Ga0207654_101207982 303
238 3300025912 Ga0207707_10032511 Ga0207707_100325112 303
239 3300025913 Ga0207695_10388263 Ga0207695_103882632 303
240 3300025916 Ga0207663_10216503 Ga0207663_102165031 303
241 3300025921 Ga0207652_10030777 Ga0207652_100307779 303
242 3300025925 Ga0207650_10167170 Ga0207650_101671702 303
243 3300025928 Ga0207700_10001928 Ga0207700_100019283 303
244 3300025929 Ga0207664_10075166 Ga0207664_100751662 303
245 3300025937 Ga0207669_10078787 Ga0207669_100787873 303
246 3300025938 Ga0207704_10049036 Ga0207704_100490363 303
247 3300025939 Ga0207665_10126626 Ga0207665_101266262 303
248 3300025942 Ga0207689_10420576 Ga0207689_104205761 303
249 3300025944 Ga0207661_10000630 Ga0207661_1000063019 303
250 3300025945 Ga0207679_10221233 Ga0207679_102212332 303
251 3300025960 Ga0207651_10282004 Ga0207651_102820042 303
252 3300025972 Ga0207668_10062222 Ga0207668_100622222 303
253 3300025972 Ga0207668_10098373 Ga0207668_100983733 303
254 3300025986 Ga0207658_10233103 Ga0207658_102331032 303
255 3300026067 Ga0207678_10065388 Ga0207678_100653882 303
256 3300026067 Ga0207678_10074054 Ga0207678_100740542 303
257 3300026067 Ga0207678_10139978 Ga0207678_101399782 303
258 3300026116 Ga0207674_10063082 Ga0207674_100630821 303
259 3300026121 Ga0207683_10063761 Ga0207683_100637612 303
260 3300027296 Ga0209389_1000015 Ga0209389_100001596 303
261 3300027361 Ga0209489_100072 Ga0209489_10007257 303
262 3300027363 Ga0209700_100034 Ga0209700_10003487 303
263 3300027671 Ga0209588_1006717 Ga0209588_10067172 303
264 3300031238 Ga0265332_10059134 Ga0265332_100591342 303
265 3300031507 Ga0307509_10023867 Ga0307509_100238675 303
266 3300031730 Ga0307516_10003424 Ga0307516_100034246 303
267 3300031730 Ga0307516_10041981 Ga0307516_100419818 303
268 3300031730 Ga0307516_10057682 Ga0307516_100576823 303
269 3300031730 Ga0307516_10295501 Ga0307516_102955011 303
270 3300031730 Ga0307516_10318835 Ga0307516_103188351 303
271 3300033179 Ga0307507_10140147 Ga0307507_101401473 303
272 3300033180 Ga0307510_10020175 Ga0307510_100201757 303
273 3300033180 Ga0307510_10305770 Ga0307510_103057701 303
274 3300035083 Ga0373926_0009466 Ga0373926_0009466_1031_1954 303
275 3300035170 Ga0373943_0014764 Ga0373943_0014764_2607_3527 303
276 3300035170 Ga0373943_0094845 Ga0373943_0094845_510_1421 303
277 3300035171 Ga0373946_0020050 Ga0373946_0020050_19_942 303
278 3300035692 Ga0373935_0021576 Ga0373935_0021576_2300_3220 303
279 3300035695 Ga0373927_0034568 Ga0373927_0034568_1486_2406 303
280 3300035695 Ga0373927_0069794 Ga0373927_0069794_671_1594 303
281 3300035725 Ga0373947_0023431 Ga0373947_0023431_1369_2289 303
282 3300036401 Ga0373937_0023784 Ga0373937_0023784_3295_4215 303
283 3300037466 Ga0395898_0305245 Ga0395898_0305245_216_1277 303
284 3300039438 Ga0436360_0994312 Ga0436360_0994312_507_1427 303
285 3300046452 Ga0495617_013706 Ga0495617_013706_1357_2280 303
286 3300046455 Ga0495603_0044040 Ga0495603_0044040_1161_2081 303
287 3300046455 Ga0495603_0104234 Ga0495603_0104234_665_1588 303
288 3300046459 Ga0495629_0045329 Ga0495629_0045329_581_1492 303
289 3300046459 Ga0495629_0052354 Ga0495629_0052354_1135_2055 303
290 3300046461 Ga0495641_0032011 Ga0495641_0032011_885_1805 303
291 3300046462 Ga0495651_0072702 Ga0495651_0072702_1605_2525 303
292 3300046471 Ga0495650_0060289 Ga0495650_0060289_233_1156 303
293 3300046472 Ga0495580_0092695 Ga0495580_0092695_781_1692 303
294 3300046472 Ga0495580_0105181 Ga0495580_0105181_672_1592 303
295 3300046473 Ga0495582_0057462 Ga0495582_0057462_654_1574 303
296 3300046475 Ga0495639_0029315 Ga0495639_0029315_615_1535 303
297 3300046475 Ga0495639_0122574 Ga0495639_0122574_33_953 303
298 3300046475 Ga0495639_0139947 Ga0495639_0139947_163_1086 303
299 3300046477 Ga0495664_0103340 Ga0495664_0103340_264_1187 303
300 3300046491 Ga0495584_0012550 Ga0495584_0012550_613_1524 303
301 3300046491 Ga0495584_0036478 Ga0495584_0036478_247_1170 303
302 3300046491 Ga0495584_0097673 Ga0495584_0097673_520_1440 303
303 3300046492 Ga0495585_0025666 Ga0495585_0025666_684_1604 303
304 3300046492 Ga0495585_0050527 Ga0495585_0050527_669_1592 303
305 3300046499 Ga0495594_0037382 Ga0495594_0037382_212_1135 303
306 3300046499 Ga0495594_0049923 Ga0495594_0049923_605_1525 303
307 3300046499 Ga0495594_0064619 Ga0495594_0064619_572_1483 303
308 3300046500 Ga0495596_0021978 Ga0495596_0021978_334_1257 303
309 3300046500 Ga0495596_0023563 Ga0495596_0023563_1462_2385 303
310 3300046501 Ga0495607_0012881 Ga0495607_0012881_2269_3189 303
311 3300046501 Ga0495607_0109979 Ga0495607_0109979_59_982 303
312 3300046506 Ga0495583_0036141 Ga0495583_0036141_60_983 303
313 3300046513 Ga0495616_0013005 Ga0495616_0013005_3755_4678 303
314 3300046513 Ga0495616_0053921 Ga0495616_0053921_129_1052 303
315 3300046514 Ga0495618_0012254 Ga0495618_0012254_3606_4526 303
316 3300046515 Ga0495620_0033821 Ga0495620_0033821_490_1413 303
317 3300046517 Ga0495630_0106514 Ga0495630_0106514_953_1873 303
318 3300046517 Ga0495630_0183498 Ga0495630_0183498_569_1480 303
319 3300046518 Ga0495631_0031154 Ga0495631_0031154_322_1245 303
320 3300046518 Ga0495631_0053982 Ga0495631_0053982_692_1603 303
321 3300046519 Ga0495632_0032990 Ga0495632_0032990_205_1128 303
322 3300046519 Ga0495632_0069029 Ga0495632_0069029_458_1381 303
323 3300046523 Ga0495644_0007531 Ga0495644_0007531_3113_4036 303
324 3300046523 Ga0495644_0008945 Ga0495644_0008945_2095_3015 303
325 3300046523 Ga0495644_0020835 Ga0495644_0020835_928_1851 303
326 3300046524 Ga0495648_0009128 Ga0495648_0009128_6074_7000 303
327 3300046524 Ga0495648_0026804 Ga0495648_0026804_375_1298 303
328 3300046524 Ga0495648_0032919 Ga0495648_0032919_234_1157 303
329 3300046525 Ga0495663_0003143 Ga0495663_0003143_896_1819 303
330 3300046525 Ga0495663_0009716 Ga0495663_0009716_13_936 303
331 3300046525 Ga0495663_0058227 Ga0495663_0058227_213_1124 303
332 3300046526 Ga0495666_0094417 Ga0495666_0094417_128_1048 303
333 3300046528 Ga0495642_0018060 Ga0495642_0018060_212_1135 303
334 3300046531 Ga0495665_0029119 Ga0495665_0029119_1412_2332 303
335 3300046533 Ga0495640_0019583 Ga0495640_0019583_3171_4091 303
336 3300046533 Ga0495640_0104844 Ga0495640_0104844_701_1621 303
337 3300046533 Ga0495640_0176001 Ga0495640_0176001_429_1352 303
338 3300046533 Ga0495640_0228120 Ga0495640_0228120_151_1062 303
339 3300046535 Ga0495586_0086792 Ga0495586_0086792_101_1021 303
340 3300046535 Ga0495586_0141138 Ga0495586_0141138_46_966 303
341 3300046537 Ga0495598_0001732 Ga0495598_0001732_2587_3510 303
342 3300046537 Ga0495598_0005236 Ga0495598_0005236_1216_2139 303
343 3300046538 Ga0495609_0064717 Ga0495609_0064717_280_1203 303
344 3300046539 Ga0495621_0002644 Ga0495621_0002644_1370_2293 303
345 3300046539 Ga0495621_0017625 Ga0495621_0017625_1369_2292 303
346 3300046542 Ga0495597_0013712 Ga0495597_0013712_102_1025 303
347 3300046543 Ga0495645_0316365 Ga0495645_0316365_27_971 303
348 3300046557 Ga0495622_0063490 Ga0495622_0063490_779_1699 303
349 3300046558 Ga0495633_0017030 Ga0495633_0017030_10_933 303
350 3300046615 Ga0495656_0007832 Ga0495656_0007832_199_1122 303
351 3300046615 Ga0495656_0012919 Ga0495656_0012919_436_1356 303
352 3300046615 Ga0495656_0039528 Ga0495656_0039528_949_1860 303
353 3300046642 Ga0495634_0011334 Ga0495634_0011334_2685_3605 303
354 3300046642 Ga0495634_0027510 Ga0495634_0027510_1004_1924 303
355 3300046648 Ga0495611_0003456 Ga0495611_0003456_655_1578 303
356 3300046648 Ga0495611_0131888 Ga0495611_0131888_40_963 303
357 3300046660 Ga0495625_0041966 Ga0495625_0041966_2126_3049 303
358 3300046660 Ga0495625_0117097 Ga0495625_0117097_42_965 303
359 3300046663 Ga0495635_0087519 Ga0495635_0087519_1100_2020 303
360 3300046663 Ga0495635_0290789 Ga0495635_0290789_49_969 303
361 3300046664 Ga0495659_0013958 Ga0495659_0013958_118_1041 303
362 3300046665 Ga0495661_0042919 Ga0495661_0042919_1431_2354 303
363 3300046665 Ga0495661_0045872 Ga0495661_0045872_1633_2556 303
364 3300046674 Ga0495588_0026223 Ga0495588_0026223_1420_2343 303
365 3300046678 Ga0495599_0061252 Ga0495599_0061252_405_1325 303
366 3300046680 Ga0495646_0011795 Ga0495646_0011795_748_1668 303
367 3300046681 Ga0495647_0034436 Ga0495647_0034436_836_1756 303
368 3300046681 Ga0495647_0059482 Ga0495647_0059482_230_1150 303
369 3300046681 Ga0495647_0076341 Ga0495647_0076341_14_937 303
370 3300046683 Ga0495658_0008984 Ga0495658_0008984_1383_2303 303
371 3300046683 Ga0495658_0214935 Ga0495658_0214935_201_1112 303
372 3300046684 Ga0495669_0013034 Ga0495669_0013034_2602_3525 303
373 3300046684 Ga0495669_0153283 Ga0495669_0153283_56_976 303
374 3300046690 Ga0495624_0123856 Ga0495624_0123856_189_1112 303
375 3300046691 Ga0495670_0010100 Ga0495670_0010100_3373_4296 303
376 3300046691 Ga0495670_0023393 Ga0495670_0023393_556_1479 303
377 3300046692 Ga0495671_0104385 Ga0495671_0104385_413_1333 303
378 3300046694 Ga0495649_0022162 Ga0495649_0022162_2373_3296 303
379 3300046694 Ga0495649_0058322 Ga0495649_0058322_236_1159 303
380 3300046794 Ga0495589_0072984 Ga0495589_0072984_513_1436 303
381 3300046810 Ga0495660_0136906 Ga0495660_0136906_54_965 303
382 3300047315 Ga0495581_0091788 Ga0495581_0091788_148_1068 303
383 3300047315 Ga0495581_0202153 Ga0495581_0202153_55_966 303
384 3300047315 Ga0495581_0214058 Ga0495581_0214058_172_1083 303
385 3300047318 Ga0495636_0004278 Ga0495636_0004278_160_1083 303
386 3300047318 Ga0495636_0030330 Ga0495636_0030330_117_1040 303
387 3300047319 Ga0495674_0089312 Ga0495674_0089312_875_1795 303
388 3300047319 Ga0495674_0093920 Ga0495674_0093920_743_1663 303
389 3300047320 Ga0495672_0099892 Ga0495672_0099892_18_941 303
390 3300047320 Ga0495672_0145695 Ga0495672_0145695_81_1004 303
391 3300047321 Ga0495676_0161495 Ga0495676_0161495_127_1047 303
392 3300047321 Ga0495676_0182305 Ga0495676_0182305_284_1195 303
393 3300047321 Ga0495676_0253636 Ga0495676_0253636_211_1122 303
394 3300047323 Ga0495683_0109302 Ga0495683_0109302_281_1204 303
395 3300047444 Ga0495675_0199144 Ga0495675_0199144_205_1149 303
396 3300047445 Ga0495677_0027355 Ga0495677_0027355_847_1764 303
397 3300047445 Ga0495677_0079559 Ga0495677_0079559_98_1021 303
398 3300047446 Ga0495679_007805 Ga0495679_007805_3317_4240 303
399 3300047446 Ga0495679_031334 Ga0495679_031334_599_1519 303
400 3300047447 Ga0495685_031062 Ga0495685_031062_436_1347 303
401 3300047469 Ga0495673_0015090 Ga0495673_0015090_2211_3134 303
402 3300047469 Ga0495673_0016971 Ga0495673_0016971_121_1044 303
403 3300047470 Ga0495681_0038563 Ga0495681_0038563_225_1148 303
404 3300047471 Ga0495684_0079622 Ga0495684_0079622_737_1657 303
405 3300047471 Ga0495684_0104252 Ga0495684_0104252_786_1706 303
406 3300047471 Ga0495684_0127198 Ga0495684_0127198_839_1759 303
407 3300047472 Ga0495686_0025512 Ga0495686_0025512_52_975 303
408 3300047472 Ga0495686_0046719 Ga0495686_0046719_395_1318 303
409 3300048088 Ga0495602_0151933 Ga0495602_0151933_779_1705 303
410 3300048090 Ga0495615_0000613 Ga0495615_0000613_234_1157 303
411 3300048090 Ga0495615_0005456 Ga0495615_0005456_136_1059 303
412 3300048903 Ga0496100_0133060 Ga0496100_0133060_659_1570 303
413 3300048904 Ga0496101_0343794 Ga0496101_0343794_136_1047 303
414 3300048905 Ga0496102_0274358 Ga0496102_0274358_202_1125 303
415 3300048907 Ga0496104_0063652 Ga0496104_0063652_200_1111 303
416 3300048907 Ga0496104_0262825 Ga0496104_0262825_606_1517 303
417 3300048907 Ga0496104_0298069 Ga0496104_0298069_421_1341 303
418 3300048907 Ga0496104_0298716 Ga0496104_0298716_124_1047 303
419 3300048908 Ga0496105_0019695 Ga0496105_0019695_816_1727 303
420 3300048908 Ga0496105_0074691 Ga0496105_0074691_1767_2678 303
421 3300048908 Ga0496105_0201710 Ga0496105_0201710_619_1563 303
422 3300048909 Ga0496106_0078106 Ga0496106_0078106_1334_2257 303
423 3300048910 Ga0496107_0086322 Ga0496107_0086322_1285_2196 303
424 3300048911 Ga0496108_0004786 Ga0496108_0004786_9620_10531 303
425 3300048911 Ga0496108_0006710 Ga0496108_0006710_4547_5467 303
426 3300048911 Ga0496108_0022680 Ga0496108_0022680_2139_3062 303
427 3300048912 Ga0496109_0004008 Ga0496109_0004008_2843_3754 303
428 3300048912 Ga0496109_0021570 Ga0496109_0021570_510_1433 303
429 3300048912 Ga0496109_0028693 Ga0496109_0028693_2489_3400 303
430 3300048912 Ga0496109_0141144 Ga0496109_0141144_665_1585 303
431 3300048913 Ga0496110_0021863 Ga0496110_0021863_4042_4953 303
432 3300048913 Ga0496110_0125219 Ga0496110_0125219_154_1098 303
433 3300048913 Ga0496110_0253279 Ga0496110_0253279_198_1118 303
434 3300048913 Ga0496110_0359057 Ga0496110_0359057_202_1113 303
435 3300048914 Ga0496111_0004217 Ga0496111_0004217_2564_3475 303
436 3300048914 Ga0496111_0053084 Ga0496111_0053084_808_1752 303
437 3300048914 Ga0496111_0075785 Ga0496111_0075785_1457_2380 303
438 3300048915 Ga0496112_0014107 Ga0496112_0014107_2764_3675 303
439 3300048915 Ga0496112_0026947 Ga0496112_0026947_644_1588 303
440 3300048915 Ga0496112_0040574 Ga0496112_0040574_2305_3228 303
441 3300048915 Ga0496112_0235721 Ga0496112_0235721_122_1033 303
442 3300048915 Ga0496112_0254779 Ga0496112_0254779_131_1051 303
443 3300048916 Ga0496113_0000306 Ga0496113_0000306_22261_23172 303
444 3300048916 Ga0496113_0009900 Ga0496113_0009900_4458_5402 303
445 3300048916 Ga0496113_0154044 Ga0496113_0154044_537_1457 303
446 3300048917 Ga0496114_0397569 Ga0496114_0397569_253_1164 303
447 3300048918 Ga0496115_0016002 Ga0496115_0016002_1246_2157 303
448 3300048928 Ga0496125_0059384 Ga0496125_0059384_993_1937 303
449 3300049460 Ga0495682_0012310 Ga0495682_0012310_703_1626 303
450 3300049460 Ga0495682_0018052 Ga0495682_0018052_1339_2262 303
451 3300049591 Ga0501075_0179667 Ga0501075_0179667_285_1220 303
452 3300050494 nmdc:mga06z11_216292_c1 nmdc:mga06z11_216292_c1_59_982 303
453 3300050507 nmdc:mga05p37_37645_c1 nmdc:mga05p37_37645_c1_4803_5726 303
454 3300050507 nmdc:mga05p37_50294_c1 nmdc:mga05p37_50294_c1_3455_4378 303
455 3300050507 nmdc:mga05p37_81606_c1 nmdc:mga05p37_81606_c1_1113_2024 303
456 3300050508 nmdc:mga09592_6142_c1 nmdc:mga09592_6142_c1_7408_8319 303
457 3300050509 nmdc:mga0qj67_176950_c1 nmdc:mga0qj67_176950_c1_748_1659 303
458 3300050510 nmdc:mga06r32_14387_c1 nmdc:mga06r32_14387_c1_461_1384 303
459 3300050510 nmdc:mga06r32_32585_c1 nmdc:mga06r32_32585_c1_1533_2444 303
460 3300050511 nmdc:mga08y16_525415_c1 nmdc:mga08y16_525415_c1_55_978 303
461 3300050512 nmdc:mga0n895_38581_c1 nmdc:mga0n895_38581_c1_2305_3228 303
462 3300050513 nmdc:mga0rr50_45536_c1 nmdc:mga0rr50_45536_c1_1974_2897 303
463 3300053077 Ga0495601_0003352 Ga0495601_0003352_1057_1977 303
464 3300053077 Ga0495601_0018020 Ga0495601_0018020_2150_3070 303
465 3300053077 Ga0495601_0092814 Ga0495601_0092814_959_1879 303
466 3300053077 Ga0495601_0149454 Ga0495601_0149454_358_1275 303
467 3300053077 Ga0495601_0164131 Ga0495601_0164131_448_1359 303
468 3300053078 Ga0495612_0015784 Ga0495612_0015784_1209_2129 303
469 3300053079 Ga0500610_0091071 Ga0500610_0091071_207_1130 303
470 3300053083 Ga0495655_0033845 Ga0495655_0033845_238_1161 303
471 3300053085 Ga0495619_0048294 Ga0495619_0048294_959_1879 303
472 3300053085 Ga0495619_0218683 Ga0495619_0218683_83_994 303
473 3300053085 Ga0495619_0274149 Ga0495619_0274149_120_1031 303
474 3300053087 Ga0500643_019213 Ga0500643_019213_132_1055 303
475 3300053092 Ga0500583_0019067 Ga0500583_0019067_1070_1993 303
476 3300053093 Ga0500651_0002157 Ga0500651_0002157_7193_8116 303
477 3300053096 Ga0500641_0023426 Ga0500641_0023426_447_1370 303
478 3300053098 Ga0500650_0044987 Ga0500650_0044987_28_951 303
479 3300053103 Ga0500555_036480 Ga0500555_036480_226_1149 303
480 3300053108 Ga0500562_014818 Ga0500562_014818_1045_1968 303
481 3300053119 Ga0500595_015442 Ga0500595_015442_707_1630 303
482 3300053136 Ga0500559_0063946 Ga0500559_0063946_275_1201 303
483 3300053140 Ga0500573_0021956 Ga0500573_0021956_1663_2589 303
484 3300053140 Ga0500573_0051769 Ga0500573_0051769_371_1294 303
485 3300053142 Ga0500577_0067587 Ga0500577_0067587_401_1324 303
486 3300053156 Ga0500622_0004296 Ga0500622_0004296_6817_7737 303
487 3300053158 Ga0500627_0131499 Ga0500627_0131499_38_961 303
488 3300053177 Ga0500636_0039064 Ga0500636_0039064_642_1568 303
489 3300053177 Ga0500636_0082385 Ga0500636_0082385_610_1533 303
490 3300053178 Ga0500637_0135939 Ga0500637_0135939_131_1054 303
491 3300053728 Ga0500657_101856 Ga0500657_101856_58_981 303
492 iso_pu_bacteria 2903768456 2903773904 303
493 iso_pu_bacteria 8056681323 8056685517 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

12

131

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

16

161

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

13

132

0.81

PF04321

RmlD_sub_bind

RmlD substrate binding domain

10

264

0.81

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

12

219

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w35-assembly1.cif.gz_J deactive state ci from dq-nadh dataset, subclass 3 0.9357 4 302
7r41-assembly1.cif.gz_P bovine complex i in the presence of im1761092, active class i (composite map) 0.9328 4 302
7v2f-assembly1.cif.gz_J deactive state complex i from q10-nadh dataset 0.9308 4 302
6zkg-assembly1.cif.gz_d complex i with nadh, closed 0.9298 4 302
6zr2-assembly1.cif.gz_P cryo-em structure of respiratory complex i in the active state from mus musculus at 3.1 a 0.9295 5 302
ID Description Score Start End Superfamily
af_Q559Z0_43_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9418 8 292 3.40.50.720
af_Q9SK66_71_329_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 7 256 3.40.50.720
af_Q559Z0_43_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9261 8 292 3.40.50.720
af_Q9DC69_47_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9231 2 211 3.40.50.720
af_Q4DU32_30_254_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9127 5 214 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1H1NBM7-F1-model_v4 Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains 0.9722 2 302 GO:0044877
GO:1901006
AF-A0A3A8AQE4-F1-model_v4 Complex I NDUFA9 subunit family protein 0.966 2 302 GO:0044877
GO:1901006
AF-A0A6N7GYD0-F1-model_v4 NAD(P)H-binding protein 0.9632 4 303 GO:0044877
GO:1901006
AF-A0A4V3NMS5-F1-model_v4 deleted 0.9587 54 181
AF-A0A1T4PKI1-F1-model_v4 NADH dehydrogenase 0.9562 1 303 GO:0044877
GO:1901006

Feature Viewer

pLDDT pTM Quality
89.52 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map