F454485

General Info

Members Datasets Scaffolds Average Seq Length
493 270 986 294

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0192145|Ga0496112_0192145_629_1696
Length 355
Sequence LVHDCVVLLWKLAKWVRGRLAARRAGSAGPEAARAVTEVGRPAVDRRTSPVDPDAVVSVRGLRKSYGGFEAVRGVDLDVQHGEVFAFLGPNGAGKTTTVEILEGYRPRNGGEVRVFGVDPAEAPRSWRDRLGVVLQDSQPESYLTVRQCLELYAGYFTAPRPIAETLELVGLADRMEAMTTELSGGQRRRLDVALALVGNPELVFLDEPTTGFDPSARRAAWEVIAGLRSLGKTIFLTTHYMDEAERLADRIAVIADGVIVAEGTPWTLGGRDRAASIISFSLPDGHSLETLPDAFRHEAQVEVSGRVTIRSERPMPALQALSAWALERRLDLADIDVHRPTLEDVYLSLIGQPS

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
264 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
269 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
270 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.2
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 12.78
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0192145 3300048915 Bacteria 2003
2 JGI25404J52841_10001178 3300003659 Bacteria 4464
3 Ga0070683_100013919 3300005329 Bacteria 7027
4 Ga0070683_100043328 3300005329 Bacteria 4148
5 Ga0070683_100103216 3300005329 Bacteria 2686
6 Ga0070677_10000004 3300005333 Bacteria 81101
7 Ga0070680_100056117 3300005336 Bacteria 3219
8 Ga0070682_100000013 3300005337 Bacteria 254641
9 Ga0068868_100000285 3300005338 Bacteria 33993
10 Ga0070689_100250616 3300005340 Bacteria 1461
11 Ga0070691_10013209 3300005341 Bacteria 3784
12 Ga0070661_100000023 3300005344 Bacteria 123104
13 Ga0070675_100000101 3300005354 Bacteria 50140
14 Ga0070674_100000008 3300005356 Bacteria 143844
15 Ga0070674_100000029 3300005356 Bacteria 69489
16 Ga0070673_100005926 3300005364 Bacteria 7897
17 Ga0070703_10020521 3300005406 Bacteria 1923
18 Ga0070714_100019159 3300005435 Bacteria 5570
19 Ga0070714_100074136 3300005435 Bacteria 2950
20 Ga0070713_100000009 3300005436 Bacteria 153056
21 Ga0070713_100247322 3300005436 Bacteria 1625
22 Ga0070713_100471207 3300005436 Bacteria 1182
23 Ga0070701_10063552 3300005438 Bacteria 1953
24 Ga0070711_100003340 3300005439 Bacteria 9338
25 Ga0070700_100109911 3300005441 Bacteria 1831
26 Ga0070708_100011753 3300005445 Bacteria 7123
27 Ga0070708_100059392 3300005445 Archaea 3409
28 Ga0070663_100003079 3300005455 Bacteria 9535
29 Ga0070678_100002401 3300005456 Bacteria 10255
30 Ga0070662_100000004 3300005457 Bacteria 195534
31 Ga0070681_10008992 3300005458 Bacteria 9822
32 Ga0070681_10151849 3300005458 Bacteria 2242
33 Ga0070707_100000019 3300005468 Bacteria 132161
34 Ga0070707_100053678 3300005468 Archaea 3864
35 Ga0070707_100404541 3300005468 Unclassified 1325
36 Ga0070699_100004955 3300005518 Archaea 11743
37 Ga0070699_100251724 3300005518 Bacteria 1578
38 Ga0070679_100001522 3300005530 Bacteria 20653
39 Ga0070679_100082234 3300005530 Bacteria 3210
40 Ga0070684_100025299 3300005535 Bacteria 4988
41 Ga0070684_100042362 3300005535 Bacteria 3929
42 Ga0070684_100111966 3300005535 Bacteria 2448
43 Ga0070697_100003630 3300005536 Bacteria 11853
44 Ga0070697_100011615 3300005536 Bacteria 6884
45 Ga0068853_100103929 3300005539 Bacteria 2514
46 Ga0070665_100000106 3300005548 Bacteria 157315
47 Ga0070704_100142480 3300005549 Bacteria 1873
48 Ga0068855_100061658 3300005563 Bacteria 4381
49 Ga0068857_100215924 3300005577 Bacteria 1751
50 Ga0068854_100000114 3300005578 Bacteria 55089
51 Ga0068854_100030249 3300005578 Bacteria 3756
52 Ga0068856_100000577 3300005614 Bacteria 40018
53 Ga0068856_100267644 3300005614 Bacteria 1725
54 Ga0068852_100000184 3300005616 Bacteria 42515
55 Ga0068852_100039119 3300005616 Bacteria 3991
56 Ga0068852_100133781 3300005616 Bacteria 2287
57 Ga0068859_100009154 3300005617 Bacteria 10001
58 Ga0068864_100000045 3300005618 Bacteria 154739
59 Ga0068866_10000001 3300005718 Bacteria 519680
60 Ga0068866_10000031 3300005718 Bacteria 56943
61 Ga0068866_10134243 3300005718 Bacteria 1412
62 Ga0068861_100190574 3300005719 Bacteria 1714
63 Ga0068851_10136390 3300005834 Bacteria 1331
64 Ga0068858_100099843 3300005842 Bacteria 2707
65 Ga0068860_100022494 3300005843 Bacteria 6097
66 Ga0068860_100638755 3300005843 Bacteria 1072
67 Ga0068862_100016408 3300005844 Bacteria 6163
68 Ga0081455_10002158 3300005937 Bacteria 23486
69 Ga0081455_10045334 3300005937 Bacteria 3826
70 Ga0081455_10122181 3300005937 Bacteria 2050
71 Ga0081538_10029740 3300005981 Bacteria 3725
72 Ga0081538_10089907 3300005981 Bacteria 1592
73 Ga0081538_10144826 3300005981 Bacteria 1088
74 Ga0081540_1000139 3300005983 Bacteria 76578
75 Ga0081540_1000392 3300005983 Bacteria 43576
76 Ga0081539_10000791 3300005985 Bacteria 61600
77 Ga0081539_10002283 3300005985 Bacteria 27787
78 Ga0081539_10002976 3300005985 Bacteria 22226
79 Ga0070715_10000001 3300006163 Bacteria 693690
80 Ga0070716_100289077 3300006173 Bacteria 1135
81 Ga0075434_100311289 3300006871 Bacteria 1595
82 Ga0068865_100000160 3300006881 Bacteria 36781
83 Ga0075436_100002125 3300006914 Bacteria 13667
84 Ga0097620_100009154 3300006931 Bacteria 10001
85 Ga0075435_100002843 3300007076 Bacteria 11586
86 Ga0099794_10006908 3300007265 Archaea 4628
87 Ga0105240_10543539 3300009093 Bacteria 1286
88 Ga0111539_11085785 3300009094 Bacteria 930
89 Ga0105245_10008155 3300009098 Bacteria 9161
90 Ga0105247_10000393 3300009101 Bacteria 37140
91 Ga0105243_10146104 3300009148 Bacteria 2023
92 Ga0105241_10121290 3300009174 Bacteria 2105
93 Ga0105242_10000893 3300009176 Bacteria 23179
94 Ga0105242_10046076 3300009176 Bacteria 3537
95 Ga0105248_10000249 3300009177 Bacteria 62662
96 Ga0105248_10020610 3300009177 Bacteria 7306
97 Ga0105248_10530594 3300009177 Bacteria 1327
98 Ga0105238_10000011 3300009551 Bacteria 261080
99 Ga0105238_10136363 3300009551 Bacteria 2432
100 Ga0105249_10026806 3300009553 Bacteria 5197
101 Ga0105249_10306849 3300009553 Bacteria 1594
102 Ga0105249_10538302 3300009553 Bacteria 1217
103 Ga0105239_10076029 3300010375 Bacteria 3693
104 Ga0105239_10104990 3300010375 Bacteria 3128
105 Ga0157371_10002351 3300013102 Bacteria 18095
106 Ga0157370_10024759 3300013104 Bacteria 5943
107 Ga0157369_10016377 3300013105 Bacteria 8340
108 Ga0157374_10034846 3300013296 Bacteria 4602
109 Ga0157378_10031324 3300013297 Bacteria 4699
110 Ga0157378_10092729 3300013297 Bacteria 2748
111 Ga0157372_10000129 3300013307 Bacteria 82491
112 Ga0157372_10046424 3300013307 Bacteria 4822
113 Ga0157375_10000112 3300013308 Bacteria 79146
114 Ga0157375_10469068 3300013308 Bacteria 1424
115 Ga0157380_10000093 3300014326 Bacteria 48915
116 Ga0157380_10000408 3300014326 Bacteria 26076
117 Ga0157380_10141471 3300014326 Bacteria 2068
118 Ga0157379_10001717 3300014968 Bacteria 18137
119 Ga0157379_10044467 3300014968 Bacteria 3965
120 Ga0157379_10275441 3300014968 Bacteria 1531
121 Ga0163161_10167243 3300017792 Bacteria 1680
122 Ga0206353_10089411 3300020082 Bacteria 2756
123 Ga0207656_10096329 3300025321 Bacteria 1351
124 Ga0207682_10000031 3300025893 Bacteria 57806
125 Ga0207642_10000002 3300025899 Bacteria 658166
126 Ga0207642_10000919 3300025899 Bacteria 9217
127 Ga0207710_10000195 3300025900 Bacteria 57216
128 Ga0207685_10000036 3300025905 Bacteria 65666
129 Ga0207643_10137897 3300025908 Bacteria 1455
130 Ga0207707_10013823 3300025912 Bacteria 7038
131 Ga0207707_10016625 3300025912 Bacteria 6414
132 Ga0207707_10112429 3300025912 Bacteria 2381
133 Ga0207695_10100322 3300025913 Bacteria 2891
134 Ga0207663_10143876 3300025916 Bacteria 1664
135 Ga0207649_10000063 3300025920 Bacteria 96360
136 Ga0207652_10000349 3300025921 Bacteria 47896
137 Ga0207652_10043823 3300025921 Bacteria 3811
138 Ga0207652_10056664 3300025921 Bacteria 3374
139 Ga0207646_10000001 3300025922 Bacteria 1242027
140 Ga0207646_10000006 3300025922 Bacteria 510716
141 Ga0207646_10010529 3300025922 Archaea 9026
142 Ga0207646_10172851 3300025922 Bacteria 1951
143 Ga0207646_10308907 3300025922 Unclassified 1429
144 Ga0207646_10354406 3300025922 Unclassified 1326
145 Ga0207681_10177338 3300025923 Bacteria 1620
146 Ga0207694_10000004 3300025924 Bacteria 967075
147 Ga0207694_10049610 3300025924 Bacteria 3249
148 Ga0207659_10000010 3300025926 Bacteria 286639
149 Ga0207687_10000018 3300025927 Bacteria 236159
150 Ga0207687_10000177 3300025927 Bacteria 42164
151 Ga0207687_10004028 3300025927 Bacteria 9845
152 Ga0207687_10010603 3300025927 Bacteria 6023
153 Ga0207700_10000025 3300025928 Bacteria 147429
154 Ga0207700_10048817 3300025928 Bacteria 3145
155 Ga0207664_10048957 3300025929 Bacteria 3326
156 Ga0207706_10000012 3300025933 Bacteria 195475
157 Ga0207686_10023096 3300025934 Bacteria 3588
158 Ga0207686_10265341 3300025934 Bacteria 1261
159 Ga0207709_10096394 3300025935 Bacteria 1946
160 Ga0207670_10167372 3300025936 Bacteria 1645
161 Ga0207669_10000004 3300025937 Bacteria 196828
162 Ga0207669_10000012 3300025937 Bacteria 138242
163 Ga0207704_10000236 3300025938 Bacteria 27317
164 Ga0207704_10449357 3300025938 Bacteria 1028
165 Ga0207665_10291061 3300025939 Bacteria 1218
166 Ga0207711_10000020 3300025941 Bacteria 363325
167 Ga0207711_10044815 3300025941 Bacteria 3778
168 Ga0207711_10373744 3300025941 Bacteria 1322
169 Ga0207661_10000095 3300025944 Bacteria 56458
170 Ga0207661_10070678 3300025944 Bacteria 2850
171 Ga0207661_10074244 3300025944 Bacteria 2787
172 Ga0207667_10062752 3300025949 Bacteria 3884
173 Ga0207651_10000460 3300025960 Bacteria 17106
174 Ga0207712_10000007 3300025961 Bacteria 539589
175 Ga0207712_10037840 3300025961 Bacteria 3295
176 Ga0207668_10144035 3300025972 Bacteria 1836
177 Ga0207640_10000015 3300025981 Bacteria 215411
178 Ga0207640_10028740 3300025981 Bacteria 3404
179 Ga0207640_10137065 3300025981 Bacteria 1778
180 Ga0207677_10000331 3300026023 Bacteria 34043
181 Ga0207703_10000040 3300026035 Bacteria 168191
182 Ga0207703_10081201 3300026035 Bacteria 2702
183 Ga0207703_10117759 3300026035 Bacteria 2276
184 Ga0207639_10007405 3300026041 Bacteria 7482
185 Ga0207678_10007745 3300026067 Bacteria 9489
186 Ga0207708_10131923 3300026075 Bacteria 1954
187 Ga0207708_10203293 3300026075 Bacteria 1581
188 Ga0207702_10000060 3300026078 Bacteria 125473
189 Ga0207702_10003607 3300026078 Bacteria 14060
190 Ga0207702_10244217 3300026078 Bacteria 1683
191 Ga0207702_10256597 3300026078 Bacteria 1644
192 Ga0207641_10025406 3300026088 Bacteria 4884
193 Ga0207648_10081248 3300026089 Bacteria 2827
194 Ga0207676_10000016 3300026095 Bacteria 311561
195 Ga0207676_10122445 3300026095 Bacteria 2196
196 Ga0207674_10028955 3300026116 Bacteria 5838
197 Ga0207674_10099830 3300026116 Bacteria 2885
198 Ga0207675_100218471 3300026118 Bacteria 1836
199 Ga0207675_100509528 3300026118 Bacteria 1199
200 Ga0207683_10003745 3300026121 Bacteria 13186
201 Ga0207683_10127556 3300026121 Bacteria 2287
202 Ga0207698_10000012 3300026142 Bacteria 260061
203 Ga0207698_10031252 3300026142 Bacteria 3841
204 Ga0207698_10070948 3300026142 Bacteria 2762
205 Ga0209588_1000724 3300027671 Bacteria 8330
206 Ga0209588_1002617 3300027671 Bacteria 4899
207 Ga0268265_10072570 3300028380 Bacteria 2685
208 Ga0268264_10031067 3300028381 Bacteria 4379
209 Ga0265337_1000231 3300028556 Bacteria 30088
210 Ga0265326_10000007 3300028558 Bacteria 223057
211 Ga0265319_1000025 3300028563 Bacteria 142639
212 Ga0265322_10000001 3300028654 Bacteria 543854
213 Ga0265336_10009094 3300028666 Bacteria 3448
214 Ga0265338_10000473 3300028800 Bacteria 71777
215 Ga0265338_10000764 3300028800 Bacteria 54866
216 Ga0265338_10325401 3300028800 Bacteria 1112
217 Ga0265324_10001009 3300029957 Bacteria 17266
218 Ga0265328_10009838 3300031239 Bacteria 3872
219 Ga0265320_10000002 3300031240 Bacteria 542875
220 Ga0265325_10001007 3300031241 Bacteria 20278
221 Ga0265329_10006540 3300031242 Bacteria 4613
222 Ga0265339_10000855 3300031249 Bacteria 23413
223 Ga0265339_10119610 3300031249 Bacteria 1355
224 Ga0265331_10016502 3300031250 Bacteria 3875
225 Ga0265327_10000011 3300031251 Bacteria 543807
226 Ga0265316_10037070 3300031344 Bacteria 3940
227 Ga0265313_10001275 3300031595 Bacteria 23871
228 Ga0265314_10000062 3300031711 Bacteria 159496
229 Ga0265314_10011335 3300031711 Bacteria 7368
230 Ga0307409_100030889 3300031995 Bacteria 3857
231 Ga0373937_0064484 3300036401 Bacteria 3370
232 Ga0373937_0539446 3300036401 Bacteria 1108
233 Ga0395899_0198897 3300037312 Bacteria 1399
234 Ga0395900_0254734 3300037418 Bacteria 1755
235 Ga0395898_0071994 3300037466 Bacteria 3340
236 Ga0395898_0262701 3300037466 Bacteria 1647
237 Ga0436364_0955823 3300037853 Bacteria 15001
238 Ga0395901_0022836 3300038443 Bacteria 6414
239 Ga0395901_0398136 3300038443 Bacteria 1415
240 Ga0439434_0025262 3300042435 Bacteria 1792
241 Ga0466966_0063617 3300044684 Bacteria 2324
242 Ga0466966_0082841 3300044684 Bacteria 1996
243 Ga0466963_0000001 3300044694 Bacteria 110556
244 Ga0466963_0000739 3300044694 Bacteria 16098
245 Ga0466971_0024517 3300044719 Bacteria 2691
246 Ga0466957_0015669 3300044842 Bacteria 4428
247 Ga0466957_0078135 3300044842 Bacteria 2057
248 Ga0466960_0069729 3300044901 Bacteria 1747
249 Ga0466958_0050321 3300045836 Bacteria 2523
250 Ga0466967_0000065 3300045976 Bacteria 39018
251 Ga0466967_0008096 3300045976 Bacteria 7666
252 Ga0466967_0251359 3300045976 Bacteria 1689
253 Ga0466967_0436365 3300045976 Bacteria 1278
254 Ga0466967_0437856 3300045976 Bacteria 1276
255 Ga0495592_0000036 3300046454 Bacteria 125461
256 Ga0495592_0177405 3300046454 Bacteria 1454
257 Ga0495603_0000030 3300046455 Bacteria 60760
258 Ga0495603_0006771 3300046455 Bacteria 6875
259 Ga0495629_0000272 3300046459 Bacteria 44883
260 Ga0495629_0043316 3300046459 Bacteria 3160
261 Ga0495638_0079564 3300046460 Bacteria 1993
262 Ga0495641_0000044 3300046461 Bacteria 77415
263 Ga0495582_0000011 3300046473 Bacteria 113352
264 Ga0495662_0000458 3300046476 Bacteria 18383
265 Ga0495662_0006939 3300046476 Bacteria 5628
266 Ga0495594_0000003 3300046499 Bacteria 199267
267 Ga0495608_0000068 3300046511 Bacteria 79694
268 Ga0495608_0001071 3300046511 Bacteria 19292
269 Ga0495608_0009335 3300046511 Bacteria 6859
270 Ga0495608_0062435 3300046511 Bacteria 2448
271 Ga0495618_0000594 3300046514 Bacteria 25841
272 Ga0495620_0000144 3300046515 Bacteria 58204
273 Ga0495620_0082178 3300046515 Bacteria 1302
274 Ga0495628_0001219 3300046516 Bacteria 23555
275 Ga0495628_0002850 3300046516 Bacteria 15497
276 Ga0495628_0040965 3300046516 Bacteria 3698
277 Ga0495630_0000056 3300046517 Bacteria 91477
278 Ga0495630_0000408 3300046517 Bacteria 33471
279 Ga0495630_0000541 3300046517 Bacteria 27642
280 Ga0495644_0000642 3300046523 Bacteria 14607
281 Ga0495652_0000019 3300046529 Bacteria 190248
282 Ga0495587_0002971 3300046536 Bacteria 11337
283 Ga0495587_0043155 3300046536 Bacteria 2687
284 Ga0495645_0019069 3300046543 Bacteria 4938
285 Ga0495622_0000180 3300046557 Bacteria 51095
286 Ga0495633_0042722 3300046558 Bacteria 2152
287 Ga0495667_0000032 3300046559 Bacteria 143493
288 Ga0495634_0000247 3300046642 Bacteria 50931
289 Ga0495634_0024941 3300046642 Bacteria 4191
290 Ga0495625_0000696 3300046660 Bacteria 47763
291 Ga0495635_0000016 3300046663 Bacteria 214088
292 Ga0495588_0000165 3300046674 Bacteria 85841
293 Ga0495657_0000004 3300046675 Bacteria 266465
294 Ga0495657_0041818 3300046675 Bacteria 3134
295 Ga0495657_0085327 3300046675 Bacteria 2035
296 Ga0495623_0216623 3300046679 Bacteria 1093
297 Ga0495647_0000008 3300046681 Bacteria 101193
298 Ga0495658_0000005 3300046683 Bacteria 149839
299 Ga0495658_0019458 3300046683 Bacteria 3544
300 Ga0495613_0000113 3300046689 Bacteria 79559
301 Ga0495613_0000203 3300046689 Bacteria 58232
302 Ga0495624_0000008 3300046690 Bacteria 145035
303 Ga0495624_0009779 3300046690 Bacteria 6636
304 Ga0495649_0000554 3300046694 Bacteria 31688
305 Ga0495600_0000787 3300046809 Bacteria 16744
306 Ga0495600_0030738 3300046809 Bacteria 3478
307 Ga0495604_0000019 3300047317 Bacteria 175064
308 Ga0495604_0030624 3300047317 Bacteria 4272
309 Ga0495676_0000299 3300047321 Bacteria 40098
310 Ga0495676_0002794 3300047321 Bacteria 15713
311 Ga0495676_0042134 3300047321 Bacteria 3751
312 Ga0495680_0003366 3300047322 Bacteria 15791
313 Ga0495680_0007700 3300047322 Bacteria 9831
314 Ga0495675_0000107 3300047444 Bacteria 59970
315 Ga0495675_0051399 3300047444 Bacteria 2617
316 Ga0495685_022930 3300047447 Bacteria 2148
317 Ga0495684_0084544 3300047471 Bacteria 2407
318 Ga0495602_0000208 3300048088 Bacteria 54818
319 Ga0495602_0000497 3300048088 Bacteria 36490
320 Ga0496100_0000002 3300048903 Bacteria 489057
321 Ga0496100_0000018 3300048903 Bacteria 162451
322 Ga0496100_0388084 3300048903 Bacteria 1061
323 Ga0496101_0000001 3300048904 Bacteria 489057
324 Ga0496101_0000062 3300048904 Bacteria 126595
325 Ga0496101_0018529 3300048904 Bacteria 4736
326 Ga0496101_0285093 3300048904 Bacteria 1291
327 Ga0496102_0000039 3300048905 Bacteria 198306
328 Ga0496102_0036045 3300048905 Bacteria 4455
329 Ga0496102_0056328 3300048905 Bacteria 3586
330 Ga0496103_0000008 3300048906 Bacteria 340474
331 Ga0496103_0049895 3300048906 Bacteria 2588
332 Ga0496104_0000009 3300048907 Bacteria 488055
333 Ga0496104_0000129 3300048907 Bacteria 69982
334 Ga0496104_0007265 3300048907 Bacteria 9776
335 Ga0496104_0141265 3300048907 Bacteria 2313
336 Ga0496104_0301916 3300048907 Bacteria 1513
337 Ga0496105_0000001 3300048908 Bacteria 1328178
338 Ga0496105_0000007 3300048908 Bacteria 339658
339 Ga0496105_0000846 3300048908 Bacteria 20846
340 Ga0496105_0074027 3300048908 Bacteria 2814
341 Ga0496105_0308836 3300048908 Bacteria 1270
342 Ga0496106_0000061 3300048909 Bacteria 86524
343 Ga0496106_0000081 3300048909 Bacteria 76468
344 Ga0496106_0000145 3300048909 Bacteria 52447
345 Ga0496106_0042207 3300048909 Bacteria 3420
346 Ga0496107_0000006 3300048910 Bacteria 258746
347 Ga0496107_0000013 3300048910 Bacteria 178284
348 Ga0496108_0000001 3300048911 Bacteria 919044
349 Ga0496108_0001921 3300048911 Bacteria 16645
350 Ga0496108_0040100 3300048911 Bacteria 3902
351 Ga0496108_0219360 3300048911 Bacteria 1652
352 Ga0496108_0299991 3300048911 Bacteria 1399
353 Ga0496109_0000003 3300048912 Bacteria 420862
354 Ga0496109_0000129 3300048912 Bacteria 77469
355 Ga0496109_0000168 3300048912 Bacteria 64462
356 Ga0496109_0002305 3300048912 Bacteria 15886
357 Ga0496109_0013512 3300048912 Bacteria 7085
358 Ga0496109_0155719 3300048912 Bacteria 2140
359 Ga0496110_0000062 3300048913 Bacteria 53333
360 Ga0496110_0007132 3300048913 Bacteria 8897
361 Ga0496110_0096386 3300048913 Bacteria 2651
362 Ga0496110_0272069 3300048913 Bacteria 1542
363 Ga0496111_0000010 3300048914 Bacteria 92600
364 Ga0496111_0019285 3300048914 Bacteria 4735
365 Ga0496112_0000003 3300048915 Bacteria 660147
366 Ga0496112_0001122 3300048915 Bacteria 19906
367 Ga0496112_0008237 3300048915 Bacteria 9326
368 Ga0496112_0026696 3300048915 Bacteria 5563
369 Ga0496113_0000014 3300048916 Bacteria 79850
370 Ga0496113_0004352 3300048916 Bacteria 8681
371 Ga0496113_0030382 3300048916 Bacteria 3911
372 Ga0496113_0100520 3300048916 Bacteria 2241
373 Ga0496114_0000014 3300048917 Bacteria 297902
374 Ga0496114_0080517 3300048917 Bacteria 2751
375 Ga0496114_0222822 3300048917 Bacteria 1656
376 Ga0496114_0460344 3300048917 Bacteria 1126
377 Ga0496115_0000003 3300048918 Bacteria 354994
378 Ga0496115_0000125 3300048918 Bacteria 69936
379 Ga0496115_0000278 3300048918 Bacteria 44969
380 Ga0496115_0012965 3300048918 Bacteria 6288
381 Ga0496115_0549403 3300048918 Bacteria 923
382 Ga0496116_0000680 3300048919 Bacteria 44185
383 Ga0496118_0179807 3300048921 Bacteria 1279
384 Ga0496119_0001947 3300048922 Bacteria 23515
385 Ga0496124_0289424 3300048927 Bacteria 1190
386 Ga0496126_0035687 3300048929 Bacteria 4657
387 Ga0501031_0000822 3300049568 Bacteria 18682
388 Ga0501032_0004405 3300049569 Bacteria 10630
389 Ga0501033_0000862 3300049570 Bacteria 27744
390 Ga0501034_0077206 3300049571 Bacteria 3336
391 Ga0501036_0000938 3300049572 Bacteria 21916
392 Ga0501036_0198485 3300049572 Bacteria 1688
393 Ga0501037_0003441 3300049573 Bacteria 11505
394 Ga0501038_0000933 3300049574 Bacteria 26040
395 Ga0501038_0028459 3300049574 Bacteria 4965
396 Ga0501039_0003186 3300049575 Bacteria 12272
397 Ga0501040_0003033 3300049576 Bacteria 10888
398 Ga0501040_0067954 3300049576 Bacteria 2457
399 Ga0501041_0001177 3300049577 Bacteria 14243
400 Ga0501041_0250291 3300049577 Bacteria 1114
401 Ga0501041_0267738 3300049577 Bacteria 1075
402 Ga0501042_0000761 3300049578 Bacteria 17537
403 Ga0501042_0017127 3300049578 Bacteria 4993
404 Ga0501042_0100091 3300049578 Bacteria 2084
405 Ga0501042_0126448 3300049578 Bacteria 1841
406 Ga0501043_0002346 3300049579 Bacteria 16049
407 Ga0501043_0201227 3300049579 Bacteria 1546
408 Ga0501046_0008844 3300049580 Bacteria 8746
409 Ga0501046_0042414 3300049580 Bacteria 3628
410 Ga0501046_0123105 3300049580 Bacteria 1972
411 Ga0501047_0000244 3300049581 Bacteria 64596
412 Ga0501047_0064173 3300049581 Bacteria 3542
413 Ga0501047_0111335 3300049581 Bacteria 2620
414 Ga0501048_0000223 3300049582 Bacteria 37247
415 Ga0501048_0117158 3300049582 Bacteria 1881
416 Ga0501048_0184093 3300049582 Bacteria 1481
417 Ga0501067_0029461 3300049583 Bacteria 3042
418 Ga0501067_0040207 3300049583 Bacteria 2597
419 Ga0501067_0104916 3300049583 Bacteria 1570
420 Ga0501068_0000806 3300049584 Bacteria 16281
421 Ga0501068_0026835 3300049584 Bacteria 3397
422 Ga0501068_0037089 3300049584 Bacteria 2918
423 Ga0501069_0000303 3300049585 Bacteria 22395
424 Ga0501069_0000775 3300049585 Bacteria 14978
425 Ga0501069_0063788 3300049585 Bacteria 2058
426 Ga0501069_0153265 3300049585 Bacteria 1325
427 Ga0501070_0004059 3300049586 Bacteria 12581
428 Ga0501070_0028555 3300049586 Bacteria 4679
429 Ga0501070_0304401 3300049586 Bacteria 1298
430 Ga0501071_0000001 3300049587 Bacteria 123952
431 Ga0501071_0021501 3300049587 Bacteria 4494
432 Ga0501071_0087841 3300049587 Bacteria 2281
433 Ga0501072_0000550 3300049588 Bacteria 26960
434 Ga0501072_0154891 3300049588 Bacteria 1827
435 Ga0501074_0001650 3300049590 Bacteria 15137
436 Ga0501074_0103587 3300049590 Bacteria 2037
437 Ga0501074_0152410 3300049590 Bacteria 1652
438 Ga0501075_0001018 3300049591 Bacteria 17943
439 Ga0501075_0001259 3300049591 Bacteria 16393
440 Ga0501075_0031578 3300049591 Bacteria 3932
441 Ga0501075_0049579 3300049591 Bacteria 3156
442 Ga0501075_0317504 3300049591 Bacteria 1187
443 Ga0501076_0000523 3300049592 Bacteria 24385
444 Ga0501076_0045432 3300049592 Bacteria 3468
445 Ga0501076_0054888 3300049592 Bacteria 3158
446 Ga0501077_0000028 3300049593 Bacteria 74757
447 Ga0501079_0000387 3300049741 Bacteria 28343
448 Ga0501079_0158491 3300049741 Bacteria 1764
449 Ga0501080_0001311 3300049742 Bacteria 20737
450 Ga0501080_0071423 3300049742 Bacteria 3229
451 Ga0501081_0000043 3300049743 Bacteria 47758
452 Ga0501081_0060551 3300049743 Bacteria 2623
453 Ga0501081_0089150 3300049743 Bacteria 2168
454 Ga0501083_0000412 3300049744 Bacteria 27299
455 Ga0501083_0090765 3300049744 Bacteria 2018
456 Ga0501083_0098999 3300049744 Bacteria 1923
457 Ga0501083_0390346 3300049744 Bacteria 905
458 Ga0501035_0001272 3300049822 Bacteria 26065
459 Ga0501044_0380074 3300049823 Bacteria 1327
460 Ga0501045_0007778 3300049824 Bacteria 7454
461 Ga0501045_0025998 3300049824 Bacteria 4209
462 Ga0501045_0419990 3300049824 Bacteria 995
463 nmdc:mga05p37_65799_c1 3300050507 Bacteria 4460
464 nmdc:mga08y16_446432_c1 3300050511 Bacteria 1319
465 nmdc:mga0n895_424927_c1 3300050512 Bacteria 1343
466 nmdc:mga0rr50_369481_c1 3300050513 Bacteria 1208
467 nmdc:mga0rr50_4219_c1 3300050513 Bacteria 8403
468 nmdc:mga08x19_158854_c1 3300050514 Bacteria 1534
469 nmdc:mga08x19_97794_c1 3300050514 Bacteria 1944
470 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
471 nmdc:mga0a205_554492_c1 3300050515 Bacteria 1004
472 Ga0495601_0000013 3300053077 Bacteria 226476
473 Ga0495601_0000326 3300053077 Bacteria 25282
474 Ga0495612_0009748 3300053078 Bacteria 3890
475 Ga0495655_0000001 3300053083 Bacteria 419518
476 Ga0495655_0006554 3300053083 Bacteria 2121
477 Ga0495595_0000003 3300053084 Bacteria 266465
478 Ga0495595_0000172 3300053084 Bacteria 25608
479 Ga0495595_0010201 3300053084 Bacteria 3901
480 Ga0495619_0000031 3300053085 Bacteria 145508
481 Ga0495619_0000106 3300053085 Bacteria 62413
482 Ga0495619_0019190 3300053085 Bacteria 4345
483 Ga0500566_0136933 3300053094 Bacteria 1303
484 Ga0500614_000324 3300053123 Bacteria 12378
485 Ga0500628_000010 3300053129 Bacteria 122210
486 Ga0501084_0000118 3300054114 Bacteria 60290
487 Ga0501084_0018321 3300054114 Bacteria 5830
488 Ga0501082_0000720 3300060353 Bacteria 29137
489 Ga0501082_0236309 3300060353 Bacteria 1590
490 Ga0530510_0000507 3300061734 Bacteria 24742
491 2819428459 2818991318 Bacteria 5266538
492 2819664790 2818991458 Bacteria 4794049
493 2873321648 2873314349 Bacteria 8512634
494 Ga0496112_0192145
495 JGI25404J52841_10001178
496 Ga0070683_100013919
497 Ga0070683_100043328
498 Ga0070683_100103216
499 Ga0070677_10000004
500 Ga0070680_100056117
501 Ga0070682_100000013
502 Ga0068868_100000285
503 Ga0070689_100250616
504 Ga0070691_10013209
505 Ga0070661_100000023
506 Ga0070675_100000101
507 Ga0070674_100000008
508 Ga0070674_100000029
509 Ga0070673_100005926
510 Ga0070703_10020521
511 Ga0070714_100019159
512 Ga0070714_100074136
513 Ga0070713_100000009
514 Ga0070713_100247322
515 Ga0070713_100471207
516 Ga0070701_10063552
517 Ga0070711_100003340
518 Ga0070700_100109911
519 Ga0070708_100011753
520 Ga0070708_100059392
521 Ga0070663_100003079
522 Ga0070678_100002401
523 Ga0070662_100000004
524 Ga0070681_10008992
525 Ga0070681_10151849
526 Ga0070707_100000019
527 Ga0070707_100053678
528 Ga0070707_100404541
529 Ga0070699_100004955
530 Ga0070699_100251724
531 Ga0070679_100001522
532 Ga0070679_100082234
533 Ga0070684_100025299
534 Ga0070684_100042362
535 Ga0070684_100111966
536 Ga0070697_100003630
537 Ga0070697_100011615
538 Ga0068853_100103929
539 Ga0070665_100000106
540 Ga0070704_100142480
541 Ga0068855_100061658
542 Ga0068857_100215924
543 Ga0068854_100000114
544 Ga0068854_100030249
545 Ga0068856_100000577
546 Ga0068856_100267644
547 Ga0068852_100000184
548 Ga0068852_100039119
549 Ga0068852_100133781
550 Ga0068859_100009154
551 Ga0068864_100000045
552 Ga0068866_10000001
553 Ga0068866_10000031
554 Ga0068866_10134243
555 Ga0068861_100190574
556 Ga0068851_10136390
557 Ga0068858_100099843
558 Ga0068860_100022494
559 Ga0068860_100638755
560 Ga0068862_100016408
561 Ga0081455_10002158
562 Ga0081455_10045334
563 Ga0081455_10122181
564 Ga0081538_10029740
565 Ga0081538_10089907
566 Ga0081538_10144826
567 Ga0081540_1000139
568 Ga0081540_1000392
569 Ga0081539_10000791
570 Ga0081539_10002283
571 Ga0081539_10002976
572 Ga0070715_10000001
573 Ga0070716_100289077
574 Ga0075434_100311289
575 Ga0068865_100000160
576 Ga0075436_100002125
577 Ga0097620_100009154
578 Ga0075435_100002843
579 Ga0099794_10006908
580 Ga0105240_10543539
581 Ga0111539_11085785
582 Ga0105245_10008155
583 Ga0105247_10000393
584 Ga0105243_10146104
585 Ga0105241_10121290
586 Ga0105242_10000893
587 Ga0105242_10046076
588 Ga0105248_10000249
589 Ga0105248_10020610
590 Ga0105248_10530594
591 Ga0105238_10000011
592 Ga0105238_10136363
593 Ga0105249_10026806
594 Ga0105249_10306849
595 Ga0105249_10538302
596 Ga0105239_10076029
597 Ga0105239_10104990
598 Ga0157371_10002351
599 Ga0157370_10024759
600 Ga0157369_10016377
601 Ga0157374_10034846
602 Ga0157378_10031324
603 Ga0157378_10092729
604 Ga0157372_10000129
605 Ga0157372_10046424
606 Ga0157375_10000112
607 Ga0157375_10469068
608 Ga0157380_10000093
609 Ga0157380_10000408
610 Ga0157380_10141471
611 Ga0157379_10001717
612 Ga0157379_10044467
613 Ga0157379_10275441
614 Ga0163161_10167243
615 Ga0206353_10089411
616 Ga0207656_10096329
617 Ga0207682_10000031
618 Ga0207642_10000002
619 Ga0207642_10000919
620 Ga0207710_10000195
621 Ga0207685_10000036
622 Ga0207643_10137897
623 Ga0207707_10013823
624 Ga0207707_10016625
625 Ga0207707_10112429
626 Ga0207695_10100322
627 Ga0207663_10143876
628 Ga0207649_10000063
629 Ga0207652_10000349
630 Ga0207652_10043823
631 Ga0207652_10056664
632 Ga0207646_10000001
633 Ga0207646_10000006
634 Ga0207646_10010529
635 Ga0207646_10172851
636 Ga0207646_10308907
637 Ga0207646_10354406
638 Ga0207681_10177338
639 Ga0207694_10000004
640 Ga0207694_10049610
641 Ga0207659_10000010
642 Ga0207687_10000018
643 Ga0207687_10000177
644 Ga0207687_10004028
645 Ga0207687_10010603
646 Ga0207700_10000025
647 Ga0207700_10048817
648 Ga0207664_10048957
649 Ga0207706_10000012
650 Ga0207686_10023096
651 Ga0207686_10265341
652 Ga0207709_10096394
653 Ga0207670_10167372
654 Ga0207669_10000004
655 Ga0207669_10000012
656 Ga0207704_10000236
657 Ga0207704_10449357
658 Ga0207665_10291061
659 Ga0207711_10000020
660 Ga0207711_10044815
661 Ga0207711_10373744
662 Ga0207661_10000095
663 Ga0207661_10070678
664 Ga0207661_10074244
665 Ga0207667_10062752
666 Ga0207651_10000460
667 Ga0207712_10000007
668 Ga0207712_10037840
669 Ga0207668_10144035
670 Ga0207640_10000015
671 Ga0207640_10028740
672 Ga0207640_10137065
673 Ga0207677_10000331
674 Ga0207703_10000040
675 Ga0207703_10081201
676 Ga0207703_10117759
677 Ga0207639_10007405
678 Ga0207678_10007745
679 Ga0207708_10131923
680 Ga0207708_10203293
681 Ga0207702_10000060
682 Ga0207702_10003607
683 Ga0207702_10244217
684 Ga0207702_10256597
685 Ga0207641_10025406
686 Ga0207648_10081248
687 Ga0207676_10000016
688 Ga0207676_10122445
689 Ga0207674_10028955
690 Ga0207674_10099830
691 Ga0207675_100218471
692 Ga0207675_100509528
693 Ga0207683_10003745
694 Ga0207683_10127556
695 Ga0207698_10000012
696 Ga0207698_10031252
697 Ga0207698_10070948
698 Ga0209588_1000724
699 Ga0209588_1002617
700 Ga0268265_10072570
701 Ga0268264_10031067
702 Ga0265337_1000231
703 Ga0265326_10000007
704 Ga0265319_1000025
705 Ga0265322_10000001
706 Ga0265336_10009094
707 Ga0265338_10000473
708 Ga0265338_10000764
709 Ga0265338_10325401
710 Ga0265324_10001009
711 Ga0265328_10009838
712 Ga0265320_10000002
713 Ga0265325_10001007
714 Ga0265329_10006540
715 Ga0265339_10000855
716 Ga0265339_10119610
717 Ga0265331_10016502
718 Ga0265327_10000011
719 Ga0265316_10037070
720 Ga0265313_10001275
721 Ga0265314_10000062
722 Ga0265314_10011335
723 Ga0307409_100030889
724 Ga0373937_0064484
725 Ga0373937_0539446
726 Ga0395899_0198897
727 Ga0395900_0254734
728 Ga0395898_0071994
729 Ga0395898_0262701
730 Ga0436364_0955823
731 Ga0395901_0022836
732 Ga0395901_0398136
733 Ga0439434_0025262
734 Ga0466966_0063617
735 Ga0466966_0082841
736 Ga0466963_0000001
737 Ga0466963_0000739
738 Ga0466971_0024517
739 Ga0466957_0015669
740 Ga0466957_0078135
741 Ga0466960_0069729
742 Ga0466958_0050321
743 Ga0466967_0000065
744 Ga0466967_0008096
745 Ga0466967_0251359
746 Ga0466967_0436365
747 Ga0466967_0437856
748 Ga0495592_0000036
749 Ga0495592_0177405
750 Ga0495603_0000030
751 Ga0495603_0006771
752 Ga0495629_0000272
753 Ga0495629_0043316
754 Ga0495638_0079564
755 Ga0495641_0000044
756 Ga0495582_0000011
757 Ga0495662_0000458
758 Ga0495662_0006939
759 Ga0495594_0000003
760 Ga0495608_0000068
761 Ga0495608_0001071
762 Ga0495608_0009335
763 Ga0495608_0062435
764 Ga0495618_0000594
765 Ga0495620_0000144
766 Ga0495620_0082178
767 Ga0495628_0001219
768 Ga0495628_0002850
769 Ga0495628_0040965
770 Ga0495630_0000056
771 Ga0495630_0000408
772 Ga0495630_0000541
773 Ga0495644_0000642
774 Ga0495652_0000019
775 Ga0495587_0002971
776 Ga0495587_0043155
777 Ga0495645_0019069
778 Ga0495622_0000180
779 Ga0495633_0042722
780 Ga0495667_0000032
781 Ga0495634_0000247
782 Ga0495634_0024941
783 Ga0495625_0000696
784 Ga0495635_0000016
785 Ga0495588_0000165
786 Ga0495657_0000004
787 Ga0495657_0041818
788 Ga0495657_0085327
789 Ga0495623_0216623
790 Ga0495647_0000008
791 Ga0495658_0000005
792 Ga0495658_0019458
793 Ga0495613_0000113
794 Ga0495613_0000203
795 Ga0495624_0000008
796 Ga0495624_0009779
797 Ga0495649_0000554
798 Ga0495600_0000787
799 Ga0495600_0030738
800 Ga0495604_0000019
801 Ga0495604_0030624
802 Ga0495676_0000299
803 Ga0495676_0002794
804 Ga0495676_0042134
805 Ga0495680_0003366
806 Ga0495680_0007700
807 Ga0495675_0000107
808 Ga0495675_0051399
809 Ga0495685_022930
810 Ga0495684_0084544
811 Ga0495602_0000208
812 Ga0495602_0000497
813 Ga0496100_0000002
814 Ga0496100_0000018
815 Ga0496100_0388084
816 Ga0496101_0000001
817 Ga0496101_0000062
818 Ga0496101_0018529
819 Ga0496101_0285093
820 Ga0496102_0000039
821 Ga0496102_0036045
822 Ga0496102_0056328
823 Ga0496103_0000008
824 Ga0496103_0049895
825 Ga0496104_0000009
826 Ga0496104_0000129
827 Ga0496104_0007265
828 Ga0496104_0141265
829 Ga0496104_0301916
830 Ga0496105_0000001
831 Ga0496105_0000007
832 Ga0496105_0000846
833 Ga0496105_0074027
834 Ga0496105_0308836
835 Ga0496106_0000061
836 Ga0496106_0000081
837 Ga0496106_0000145
838 Ga0496106_0042207
839 Ga0496107_0000006
840 Ga0496107_0000013
841 Ga0496108_0000001
842 Ga0496108_0001921
843 Ga0496108_0040100
844 Ga0496108_0219360
845 Ga0496108_0299991
846 Ga0496109_0000003
847 Ga0496109_0000129
848 Ga0496109_0000168
849 Ga0496109_0002305
850 Ga0496109_0013512
851 Ga0496109_0155719
852 Ga0496110_0000062
853 Ga0496110_0007132
854 Ga0496110_0096386
855 Ga0496110_0272069
856 Ga0496111_0000010
857 Ga0496111_0019285
858 Ga0496112_0000003
859 Ga0496112_0001122
860 Ga0496112_0008237
861 Ga0496112_0026696
862 Ga0496113_0000014
863 Ga0496113_0004352
864 Ga0496113_0030382
865 Ga0496113_0100520
866 Ga0496114_0000014
867 Ga0496114_0080517
868 Ga0496114_0222822
869 Ga0496114_0460344
870 Ga0496115_0000003
871 Ga0496115_0000125
872 Ga0496115_0000278
873 Ga0496115_0012965
874 Ga0496115_0549403
875 Ga0496116_0000680
876 Ga0496118_0179807
877 Ga0496119_0001947
878 Ga0496124_0289424
879 Ga0496126_0035687
880 Ga0501031_0000822
881 Ga0501032_0004405
882 Ga0501033_0000862
883 Ga0501034_0077206
884 Ga0501036_0000938
885 Ga0501036_0198485
886 Ga0501037_0003441
887 Ga0501038_0000933
888 Ga0501038_0028459
889 Ga0501039_0003186
890 Ga0501040_0003033
891 Ga0501040_0067954
892 Ga0501041_0001177
893 Ga0501041_0250291
894 Ga0501041_0267738
895 Ga0501042_0000761
896 Ga0501042_0017127
897 Ga0501042_0100091
898 Ga0501042_0126448
899 Ga0501043_0002346
900 Ga0501043_0201227
901 Ga0501046_0008844
902 Ga0501046_0042414
903 Ga0501046_0123105
904 Ga0501047_0000244
905 Ga0501047_0064173
906 Ga0501047_0111335
907 Ga0501048_0000223
908 Ga0501048_0117158
909 Ga0501048_0184093
910 Ga0501067_0029461
911 Ga0501067_0040207
912 Ga0501067_0104916
913 Ga0501068_0000806
914 Ga0501068_0026835
915 Ga0501068_0037089
916 Ga0501069_0000303
917 Ga0501069_0000775
918 Ga0501069_0063788
919 Ga0501069_0153265
920 Ga0501070_0004059
921 Ga0501070_0028555
922 Ga0501070_0304401
923 Ga0501071_0000001
924 Ga0501071_0021501
925 Ga0501071_0087841
926 Ga0501072_0000550
927 Ga0501072_0154891
928 Ga0501074_0001650
929 Ga0501074_0103587
930 Ga0501074_0152410
931 Ga0501075_0001018
932 Ga0501075_0001259
933 Ga0501075_0031578
934 Ga0501075_0049579
935 Ga0501075_0317504
936 Ga0501076_0000523
937 Ga0501076_0045432
938 Ga0501076_0054888
939 Ga0501077_0000028
940 Ga0501079_0000387
941 Ga0501079_0158491
942 Ga0501080_0001311
943 Ga0501080_0071423
944 Ga0501081_0000043
945 Ga0501081_0060551
946 Ga0501081_0089150
947 Ga0501083_0000412
948 Ga0501083_0090765
949 Ga0501083_0098999
950 Ga0501083_0390346
951 Ga0501035_0001272
952 Ga0501044_0380074
953 Ga0501045_0007778
954 Ga0501045_0025998
955 Ga0501045_0419990
956 nmdc:mga05p37_65799_c1
957 nmdc:mga08y16_446432_c1
958 nmdc:mga0n895_424927_c1
959 nmdc:mga0rr50_369481_c1
960 nmdc:mga0rr50_4219_c1
961 nmdc:mga08x19_158854_c1
962 nmdc:mga08x19_97794_c1
963 nmdc:mga0a205_24_c2
964 nmdc:mga0a205_554492_c1
965 Ga0495601_0000013
966 Ga0495601_0000326
967 Ga0495612_0009748
968 Ga0495655_0000001
969 Ga0495655_0006554
970 Ga0495595_0000003
971 Ga0495595_0000172
972 Ga0495595_0010201
973 Ga0495619_0000031
974 Ga0495619_0000106
975 Ga0495619_0019190
976 Ga0500566_0136933
977 Ga0500614_000324
978 Ga0500628_000010
979 Ga0501084_0000118
980 Ga0501084_0018321
981 Ga0501082_0000720
982 Ga0501082_0236309
983 Ga0530510_0000507
984 2819428459
985 2819664790
986 2873321648

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

72

211

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9209 1 202
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9204 2 205
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9186 8 202
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9028 2 202
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9018 1 205
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9444 1 205 3.40.50.300
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9425 8 204 3.40.50.300
af_A0A1D6KPM2_510_779_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9363 8 202 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9361 1 205 3.40.50.300
af_A0A0R0KIK5_1390_1640_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9358 8 204 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9B0A6-F1-model_v4 ABC transporter ATP-binding protein 0.9682 73 205 GO:0005524
GO:0016887
AF-A0A348B4H2-F1-model_v4 ABC transporter domain-containing protein 0.963 21 204 GO:0005524
GO:0016887
AF-A0A7J8BN72-F1-model_v4 ATP binding cassette subfamily A member 7 0.9534 5 202 GO:0005524
GO:0016020
GO:0016887
GO:0033344
GO:0033700
GO:0034188
GO:0043231
GO:0090554
GO:0090556
GO:0140359
AF-A0A7X8XW61-F1-model_v4 ABC transporter ATP-binding protein 0.9515 1 205 GO:0005524
GO:0005886
GO:0016887
AF-A0A536FTK2-F1-model_v4 ABC transporter ATP-binding protein 0.9507 1 202 GO:0005524
GO:0016887

Map