F454485
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 493 | 270 | 986 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0192145|Ga0496112_0192145_629_1696 |
| Length | 355 |
| Sequence | LVHDCVVLLWKLAKWVRGRLAARRAGSAGPEAARAVTEVGRPAVDRRTSPVDPDAVVSVRGLRKSYGGFEAVRGVDLDVQHGEVFAFLGPNGAGKTTTVEILEGYRPRNGGEVRVFGVDPAEAPRSWRDRLGVVLQDSQPESYLTVRQCLELYAGYFTAPRPIAETLELVGLADRMEAMTTELSGGQRRRLDVALALVGNPELVFLDEPTTGFDPSARRAAWEVIAGLRSLGKTIFLTTHYMDEAERLADRIAVIADGVIVAEGTPWTLGGRDRAASIISFSLPDGHSLETLPDAFRHEAQVEVSGRVTIRSERPMPALQALSAWALERRLDLADIDVHRPTLEDVYLSLIGQPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 131 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 137 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 138 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 153 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 154 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 155 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 215 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 216 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 263 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 264 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 268 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 269 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 270 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 12.78 |
| Rhizosphere | 85.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496112_0192145 | 3300048915 | Bacteria | 2003 |
| 2 | JGI25404J52841_10001178 | 3300003659 | Bacteria | 4464 |
| 3 | Ga0070683_100013919 | 3300005329 | Bacteria | 7027 |
| 4 | Ga0070683_100043328 | 3300005329 | Bacteria | 4148 |
| 5 | Ga0070683_100103216 | 3300005329 | Bacteria | 2686 |
| 6 | Ga0070677_10000004 | 3300005333 | Bacteria | 81101 |
| 7 | Ga0070680_100056117 | 3300005336 | Bacteria | 3219 |
| 8 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 9 | Ga0068868_100000285 | 3300005338 | Bacteria | 33993 |
| 10 | Ga0070689_100250616 | 3300005340 | Bacteria | 1461 |
| 11 | Ga0070691_10013209 | 3300005341 | Bacteria | 3784 |
| 12 | Ga0070661_100000023 | 3300005344 | Bacteria | 123104 |
| 13 | Ga0070675_100000101 | 3300005354 | Bacteria | 50140 |
| 14 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 15 | Ga0070674_100000029 | 3300005356 | Bacteria | 69489 |
| 16 | Ga0070673_100005926 | 3300005364 | Bacteria | 7897 |
| 17 | Ga0070703_10020521 | 3300005406 | Bacteria | 1923 |
| 18 | Ga0070714_100019159 | 3300005435 | Bacteria | 5570 |
| 19 | Ga0070714_100074136 | 3300005435 | Bacteria | 2950 |
| 20 | Ga0070713_100000009 | 3300005436 | Bacteria | 153056 |
| 21 | Ga0070713_100247322 | 3300005436 | Bacteria | 1625 |
| 22 | Ga0070713_100471207 | 3300005436 | Bacteria | 1182 |
| 23 | Ga0070701_10063552 | 3300005438 | Bacteria | 1953 |
| 24 | Ga0070711_100003340 | 3300005439 | Bacteria | 9338 |
| 25 | Ga0070700_100109911 | 3300005441 | Bacteria | 1831 |
| 26 | Ga0070708_100011753 | 3300005445 | Bacteria | 7123 |
| 27 | Ga0070708_100059392 | 3300005445 | Archaea | 3409 |
| 28 | Ga0070663_100003079 | 3300005455 | Bacteria | 9535 |
| 29 | Ga0070678_100002401 | 3300005456 | Bacteria | 10255 |
| 30 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 31 | Ga0070681_10008992 | 3300005458 | Bacteria | 9822 |
| 32 | Ga0070681_10151849 | 3300005458 | Bacteria | 2242 |
| 33 | Ga0070707_100000019 | 3300005468 | Bacteria | 132161 |
| 34 | Ga0070707_100053678 | 3300005468 | Archaea | 3864 |
| 35 | Ga0070707_100404541 | 3300005468 | Unclassified | 1325 |
| 36 | Ga0070699_100004955 | 3300005518 | Archaea | 11743 |
| 37 | Ga0070699_100251724 | 3300005518 | Bacteria | 1578 |
| 38 | Ga0070679_100001522 | 3300005530 | Bacteria | 20653 |
| 39 | Ga0070679_100082234 | 3300005530 | Bacteria | 3210 |
| 40 | Ga0070684_100025299 | 3300005535 | Bacteria | 4988 |
| 41 | Ga0070684_100042362 | 3300005535 | Bacteria | 3929 |
| 42 | Ga0070684_100111966 | 3300005535 | Bacteria | 2448 |
| 43 | Ga0070697_100003630 | 3300005536 | Bacteria | 11853 |
| 44 | Ga0070697_100011615 | 3300005536 | Bacteria | 6884 |
| 45 | Ga0068853_100103929 | 3300005539 | Bacteria | 2514 |
| 46 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 47 | Ga0070704_100142480 | 3300005549 | Bacteria | 1873 |
| 48 | Ga0068855_100061658 | 3300005563 | Bacteria | 4381 |
| 49 | Ga0068857_100215924 | 3300005577 | Bacteria | 1751 |
| 50 | Ga0068854_100000114 | 3300005578 | Bacteria | 55089 |
| 51 | Ga0068854_100030249 | 3300005578 | Bacteria | 3756 |
| 52 | Ga0068856_100000577 | 3300005614 | Bacteria | 40018 |
| 53 | Ga0068856_100267644 | 3300005614 | Bacteria | 1725 |
| 54 | Ga0068852_100000184 | 3300005616 | Bacteria | 42515 |
| 55 | Ga0068852_100039119 | 3300005616 | Bacteria | 3991 |
| 56 | Ga0068852_100133781 | 3300005616 | Bacteria | 2287 |
| 57 | Ga0068859_100009154 | 3300005617 | Bacteria | 10001 |
| 58 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 59 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 60 | Ga0068866_10000031 | 3300005718 | Bacteria | 56943 |
| 61 | Ga0068866_10134243 | 3300005718 | Bacteria | 1412 |
| 62 | Ga0068861_100190574 | 3300005719 | Bacteria | 1714 |
| 63 | Ga0068851_10136390 | 3300005834 | Bacteria | 1331 |
| 64 | Ga0068858_100099843 | 3300005842 | Bacteria | 2707 |
| 65 | Ga0068860_100022494 | 3300005843 | Bacteria | 6097 |
| 66 | Ga0068860_100638755 | 3300005843 | Bacteria | 1072 |
| 67 | Ga0068862_100016408 | 3300005844 | Bacteria | 6163 |
| 68 | Ga0081455_10002158 | 3300005937 | Bacteria | 23486 |
| 69 | Ga0081455_10045334 | 3300005937 | Bacteria | 3826 |
| 70 | Ga0081455_10122181 | 3300005937 | Bacteria | 2050 |
| 71 | Ga0081538_10029740 | 3300005981 | Bacteria | 3725 |
| 72 | Ga0081538_10089907 | 3300005981 | Bacteria | 1592 |
| 73 | Ga0081538_10144826 | 3300005981 | Bacteria | 1088 |
| 74 | Ga0081540_1000139 | 3300005983 | Bacteria | 76578 |
| 75 | Ga0081540_1000392 | 3300005983 | Bacteria | 43576 |
| 76 | Ga0081539_10000791 | 3300005985 | Bacteria | 61600 |
| 77 | Ga0081539_10002283 | 3300005985 | Bacteria | 27787 |
| 78 | Ga0081539_10002976 | 3300005985 | Bacteria | 22226 |
| 79 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 80 | Ga0070716_100289077 | 3300006173 | Bacteria | 1135 |
| 81 | Ga0075434_100311289 | 3300006871 | Bacteria | 1595 |
| 82 | Ga0068865_100000160 | 3300006881 | Bacteria | 36781 |
| 83 | Ga0075436_100002125 | 3300006914 | Bacteria | 13667 |
| 84 | Ga0097620_100009154 | 3300006931 | Bacteria | 10001 |
| 85 | Ga0075435_100002843 | 3300007076 | Bacteria | 11586 |
| 86 | Ga0099794_10006908 | 3300007265 | Archaea | 4628 |
| 87 | Ga0105240_10543539 | 3300009093 | Bacteria | 1286 |
| 88 | Ga0111539_11085785 | 3300009094 | Bacteria | 930 |
| 89 | Ga0105245_10008155 | 3300009098 | Bacteria | 9161 |
| 90 | Ga0105247_10000393 | 3300009101 | Bacteria | 37140 |
| 91 | Ga0105243_10146104 | 3300009148 | Bacteria | 2023 |
| 92 | Ga0105241_10121290 | 3300009174 | Bacteria | 2105 |
| 93 | Ga0105242_10000893 | 3300009176 | Bacteria | 23179 |
| 94 | Ga0105242_10046076 | 3300009176 | Bacteria | 3537 |
| 95 | Ga0105248_10000249 | 3300009177 | Bacteria | 62662 |
| 96 | Ga0105248_10020610 | 3300009177 | Bacteria | 7306 |
| 97 | Ga0105248_10530594 | 3300009177 | Bacteria | 1327 |
| 98 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 99 | Ga0105238_10136363 | 3300009551 | Bacteria | 2432 |
| 100 | Ga0105249_10026806 | 3300009553 | Bacteria | 5197 |
| 101 | Ga0105249_10306849 | 3300009553 | Bacteria | 1594 |
| 102 | Ga0105249_10538302 | 3300009553 | Bacteria | 1217 |
| 103 | Ga0105239_10076029 | 3300010375 | Bacteria | 3693 |
| 104 | Ga0105239_10104990 | 3300010375 | Bacteria | 3128 |
| 105 | Ga0157371_10002351 | 3300013102 | Bacteria | 18095 |
| 106 | Ga0157370_10024759 | 3300013104 | Bacteria | 5943 |
| 107 | Ga0157369_10016377 | 3300013105 | Bacteria | 8340 |
| 108 | Ga0157374_10034846 | 3300013296 | Bacteria | 4602 |
| 109 | Ga0157378_10031324 | 3300013297 | Bacteria | 4699 |
| 110 | Ga0157378_10092729 | 3300013297 | Bacteria | 2748 |
| 111 | Ga0157372_10000129 | 3300013307 | Bacteria | 82491 |
| 112 | Ga0157372_10046424 | 3300013307 | Bacteria | 4822 |
| 113 | Ga0157375_10000112 | 3300013308 | Bacteria | 79146 |
| 114 | Ga0157375_10469068 | 3300013308 | Bacteria | 1424 |
| 115 | Ga0157380_10000093 | 3300014326 | Bacteria | 48915 |
| 116 | Ga0157380_10000408 | 3300014326 | Bacteria | 26076 |
| 117 | Ga0157380_10141471 | 3300014326 | Bacteria | 2068 |
| 118 | Ga0157379_10001717 | 3300014968 | Bacteria | 18137 |
| 119 | Ga0157379_10044467 | 3300014968 | Bacteria | 3965 |
| 120 | Ga0157379_10275441 | 3300014968 | Bacteria | 1531 |
| 121 | Ga0163161_10167243 | 3300017792 | Bacteria | 1680 |
| 122 | Ga0206353_10089411 | 3300020082 | Bacteria | 2756 |
| 123 | Ga0207656_10096329 | 3300025321 | Bacteria | 1351 |
| 124 | Ga0207682_10000031 | 3300025893 | Bacteria | 57806 |
| 125 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 126 | Ga0207642_10000919 | 3300025899 | Bacteria | 9217 |
| 127 | Ga0207710_10000195 | 3300025900 | Bacteria | 57216 |
| 128 | Ga0207685_10000036 | 3300025905 | Bacteria | 65666 |
| 129 | Ga0207643_10137897 | 3300025908 | Bacteria | 1455 |
| 130 | Ga0207707_10013823 | 3300025912 | Bacteria | 7038 |
| 131 | Ga0207707_10016625 | 3300025912 | Bacteria | 6414 |
| 132 | Ga0207707_10112429 | 3300025912 | Bacteria | 2381 |
| 133 | Ga0207695_10100322 | 3300025913 | Bacteria | 2891 |
| 134 | Ga0207663_10143876 | 3300025916 | Bacteria | 1664 |
| 135 | Ga0207649_10000063 | 3300025920 | Bacteria | 96360 |
| 136 | Ga0207652_10000349 | 3300025921 | Bacteria | 47896 |
| 137 | Ga0207652_10043823 | 3300025921 | Bacteria | 3811 |
| 138 | Ga0207652_10056664 | 3300025921 | Bacteria | 3374 |
| 139 | Ga0207646_10000001 | 3300025922 | Bacteria | 1242027 |
| 140 | Ga0207646_10000006 | 3300025922 | Bacteria | 510716 |
| 141 | Ga0207646_10010529 | 3300025922 | Archaea | 9026 |
| 142 | Ga0207646_10172851 | 3300025922 | Bacteria | 1951 |
| 143 | Ga0207646_10308907 | 3300025922 | Unclassified | 1429 |
| 144 | Ga0207646_10354406 | 3300025922 | Unclassified | 1326 |
| 145 | Ga0207681_10177338 | 3300025923 | Bacteria | 1620 |
| 146 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 147 | Ga0207694_10049610 | 3300025924 | Bacteria | 3249 |
| 148 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 149 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 150 | Ga0207687_10000177 | 3300025927 | Bacteria | 42164 |
| 151 | Ga0207687_10004028 | 3300025927 | Bacteria | 9845 |
| 152 | Ga0207687_10010603 | 3300025927 | Bacteria | 6023 |
| 153 | Ga0207700_10000025 | 3300025928 | Bacteria | 147429 |
| 154 | Ga0207700_10048817 | 3300025928 | Bacteria | 3145 |
| 155 | Ga0207664_10048957 | 3300025929 | Bacteria | 3326 |
| 156 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 157 | Ga0207686_10023096 | 3300025934 | Bacteria | 3588 |
| 158 | Ga0207686_10265341 | 3300025934 | Bacteria | 1261 |
| 159 | Ga0207709_10096394 | 3300025935 | Bacteria | 1946 |
| 160 | Ga0207670_10167372 | 3300025936 | Bacteria | 1645 |
| 161 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 162 | Ga0207669_10000012 | 3300025937 | Bacteria | 138242 |
| 163 | Ga0207704_10000236 | 3300025938 | Bacteria | 27317 |
| 164 | Ga0207704_10449357 | 3300025938 | Bacteria | 1028 |
| 165 | Ga0207665_10291061 | 3300025939 | Bacteria | 1218 |
| 166 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 167 | Ga0207711_10044815 | 3300025941 | Bacteria | 3778 |
| 168 | Ga0207711_10373744 | 3300025941 | Bacteria | 1322 |
| 169 | Ga0207661_10000095 | 3300025944 | Bacteria | 56458 |
| 170 | Ga0207661_10070678 | 3300025944 | Bacteria | 2850 |
| 171 | Ga0207661_10074244 | 3300025944 | Bacteria | 2787 |
| 172 | Ga0207667_10062752 | 3300025949 | Bacteria | 3884 |
| 173 | Ga0207651_10000460 | 3300025960 | Bacteria | 17106 |
| 174 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 175 | Ga0207712_10037840 | 3300025961 | Bacteria | 3295 |
| 176 | Ga0207668_10144035 | 3300025972 | Bacteria | 1836 |
| 177 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 178 | Ga0207640_10028740 | 3300025981 | Bacteria | 3404 |
| 179 | Ga0207640_10137065 | 3300025981 | Bacteria | 1778 |
| 180 | Ga0207677_10000331 | 3300026023 | Bacteria | 34043 |
| 181 | Ga0207703_10000040 | 3300026035 | Bacteria | 168191 |
| 182 | Ga0207703_10081201 | 3300026035 | Bacteria | 2702 |
| 183 | Ga0207703_10117759 | 3300026035 | Bacteria | 2276 |
| 184 | Ga0207639_10007405 | 3300026041 | Bacteria | 7482 |
| 185 | Ga0207678_10007745 | 3300026067 | Bacteria | 9489 |
| 186 | Ga0207708_10131923 | 3300026075 | Bacteria | 1954 |
| 187 | Ga0207708_10203293 | 3300026075 | Bacteria | 1581 |
| 188 | Ga0207702_10000060 | 3300026078 | Bacteria | 125473 |
| 189 | Ga0207702_10003607 | 3300026078 | Bacteria | 14060 |
| 190 | Ga0207702_10244217 | 3300026078 | Bacteria | 1683 |
| 191 | Ga0207702_10256597 | 3300026078 | Bacteria | 1644 |
| 192 | Ga0207641_10025406 | 3300026088 | Bacteria | 4884 |
| 193 | Ga0207648_10081248 | 3300026089 | Bacteria | 2827 |
| 194 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 195 | Ga0207676_10122445 | 3300026095 | Bacteria | 2196 |
| 196 | Ga0207674_10028955 | 3300026116 | Bacteria | 5838 |
| 197 | Ga0207674_10099830 | 3300026116 | Bacteria | 2885 |
| 198 | Ga0207675_100218471 | 3300026118 | Bacteria | 1836 |
| 199 | Ga0207675_100509528 | 3300026118 | Bacteria | 1199 |
| 200 | Ga0207683_10003745 | 3300026121 | Bacteria | 13186 |
| 201 | Ga0207683_10127556 | 3300026121 | Bacteria | 2287 |
| 202 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 203 | Ga0207698_10031252 | 3300026142 | Bacteria | 3841 |
| 204 | Ga0207698_10070948 | 3300026142 | Bacteria | 2762 |
| 205 | Ga0209588_1000724 | 3300027671 | Bacteria | 8330 |
| 206 | Ga0209588_1002617 | 3300027671 | Bacteria | 4899 |
| 207 | Ga0268265_10072570 | 3300028380 | Bacteria | 2685 |
| 208 | Ga0268264_10031067 | 3300028381 | Bacteria | 4379 |
| 209 | Ga0265337_1000231 | 3300028556 | Bacteria | 30088 |
| 210 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 211 | Ga0265319_1000025 | 3300028563 | Bacteria | 142639 |
| 212 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 213 | Ga0265336_10009094 | 3300028666 | Bacteria | 3448 |
| 214 | Ga0265338_10000473 | 3300028800 | Bacteria | 71777 |
| 215 | Ga0265338_10000764 | 3300028800 | Bacteria | 54866 |
| 216 | Ga0265338_10325401 | 3300028800 | Bacteria | 1112 |
| 217 | Ga0265324_10001009 | 3300029957 | Bacteria | 17266 |
| 218 | Ga0265328_10009838 | 3300031239 | Bacteria | 3872 |
| 219 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 220 | Ga0265325_10001007 | 3300031241 | Bacteria | 20278 |
| 221 | Ga0265329_10006540 | 3300031242 | Bacteria | 4613 |
| 222 | Ga0265339_10000855 | 3300031249 | Bacteria | 23413 |
| 223 | Ga0265339_10119610 | 3300031249 | Bacteria | 1355 |
| 224 | Ga0265331_10016502 | 3300031250 | Bacteria | 3875 |
| 225 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 226 | Ga0265316_10037070 | 3300031344 | Bacteria | 3940 |
| 227 | Ga0265313_10001275 | 3300031595 | Bacteria | 23871 |
| 228 | Ga0265314_10000062 | 3300031711 | Bacteria | 159496 |
| 229 | Ga0265314_10011335 | 3300031711 | Bacteria | 7368 |
| 230 | Ga0307409_100030889 | 3300031995 | Bacteria | 3857 |
| 231 | Ga0373937_0064484 | 3300036401 | Bacteria | 3370 |
| 232 | Ga0373937_0539446 | 3300036401 | Bacteria | 1108 |
| 233 | Ga0395899_0198897 | 3300037312 | Bacteria | 1399 |
| 234 | Ga0395900_0254734 | 3300037418 | Bacteria | 1755 |
| 235 | Ga0395898_0071994 | 3300037466 | Bacteria | 3340 |
| 236 | Ga0395898_0262701 | 3300037466 | Bacteria | 1647 |
| 237 | Ga0436364_0955823 | 3300037853 | Bacteria | 15001 |
| 238 | Ga0395901_0022836 | 3300038443 | Bacteria | 6414 |
| 239 | Ga0395901_0398136 | 3300038443 | Bacteria | 1415 |
| 240 | Ga0439434_0025262 | 3300042435 | Bacteria | 1792 |
| 241 | Ga0466966_0063617 | 3300044684 | Bacteria | 2324 |
| 242 | Ga0466966_0082841 | 3300044684 | Bacteria | 1996 |
| 243 | Ga0466963_0000001 | 3300044694 | Bacteria | 110556 |
| 244 | Ga0466963_0000739 | 3300044694 | Bacteria | 16098 |
| 245 | Ga0466971_0024517 | 3300044719 | Bacteria | 2691 |
| 246 | Ga0466957_0015669 | 3300044842 | Bacteria | 4428 |
| 247 | Ga0466957_0078135 | 3300044842 | Bacteria | 2057 |
| 248 | Ga0466960_0069729 | 3300044901 | Bacteria | 1747 |
| 249 | Ga0466958_0050321 | 3300045836 | Bacteria | 2523 |
| 250 | Ga0466967_0000065 | 3300045976 | Bacteria | 39018 |
| 251 | Ga0466967_0008096 | 3300045976 | Bacteria | 7666 |
| 252 | Ga0466967_0251359 | 3300045976 | Bacteria | 1689 |
| 253 | Ga0466967_0436365 | 3300045976 | Bacteria | 1278 |
| 254 | Ga0466967_0437856 | 3300045976 | Bacteria | 1276 |
| 255 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 256 | Ga0495592_0177405 | 3300046454 | Bacteria | 1454 |
| 257 | Ga0495603_0000030 | 3300046455 | Bacteria | 60760 |
| 258 | Ga0495603_0006771 | 3300046455 | Bacteria | 6875 |
| 259 | Ga0495629_0000272 | 3300046459 | Bacteria | 44883 |
| 260 | Ga0495629_0043316 | 3300046459 | Bacteria | 3160 |
| 261 | Ga0495638_0079564 | 3300046460 | Bacteria | 1993 |
| 262 | Ga0495641_0000044 | 3300046461 | Bacteria | 77415 |
| 263 | Ga0495582_0000011 | 3300046473 | Bacteria | 113352 |
| 264 | Ga0495662_0000458 | 3300046476 | Bacteria | 18383 |
| 265 | Ga0495662_0006939 | 3300046476 | Bacteria | 5628 |
| 266 | Ga0495594_0000003 | 3300046499 | Bacteria | 199267 |
| 267 | Ga0495608_0000068 | 3300046511 | Bacteria | 79694 |
| 268 | Ga0495608_0001071 | 3300046511 | Bacteria | 19292 |
| 269 | Ga0495608_0009335 | 3300046511 | Bacteria | 6859 |
| 270 | Ga0495608_0062435 | 3300046511 | Bacteria | 2448 |
| 271 | Ga0495618_0000594 | 3300046514 | Bacteria | 25841 |
| 272 | Ga0495620_0000144 | 3300046515 | Bacteria | 58204 |
| 273 | Ga0495620_0082178 | 3300046515 | Bacteria | 1302 |
| 274 | Ga0495628_0001219 | 3300046516 | Bacteria | 23555 |
| 275 | Ga0495628_0002850 | 3300046516 | Bacteria | 15497 |
| 276 | Ga0495628_0040965 | 3300046516 | Bacteria | 3698 |
| 277 | Ga0495630_0000056 | 3300046517 | Bacteria | 91477 |
| 278 | Ga0495630_0000408 | 3300046517 | Bacteria | 33471 |
| 279 | Ga0495630_0000541 | 3300046517 | Bacteria | 27642 |
| 280 | Ga0495644_0000642 | 3300046523 | Bacteria | 14607 |
| 281 | Ga0495652_0000019 | 3300046529 | Bacteria | 190248 |
| 282 | Ga0495587_0002971 | 3300046536 | Bacteria | 11337 |
| 283 | Ga0495587_0043155 | 3300046536 | Bacteria | 2687 |
| 284 | Ga0495645_0019069 | 3300046543 | Bacteria | 4938 |
| 285 | Ga0495622_0000180 | 3300046557 | Bacteria | 51095 |
| 286 | Ga0495633_0042722 | 3300046558 | Bacteria | 2152 |
| 287 | Ga0495667_0000032 | 3300046559 | Bacteria | 143493 |
| 288 | Ga0495634_0000247 | 3300046642 | Bacteria | 50931 |
| 289 | Ga0495634_0024941 | 3300046642 | Bacteria | 4191 |
| 290 | Ga0495625_0000696 | 3300046660 | Bacteria | 47763 |
| 291 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 292 | Ga0495588_0000165 | 3300046674 | Bacteria | 85841 |
| 293 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 294 | Ga0495657_0041818 | 3300046675 | Bacteria | 3134 |
| 295 | Ga0495657_0085327 | 3300046675 | Bacteria | 2035 |
| 296 | Ga0495623_0216623 | 3300046679 | Bacteria | 1093 |
| 297 | Ga0495647_0000008 | 3300046681 | Bacteria | 101193 |
| 298 | Ga0495658_0000005 | 3300046683 | Bacteria | 149839 |
| 299 | Ga0495658_0019458 | 3300046683 | Bacteria | 3544 |
| 300 | Ga0495613_0000113 | 3300046689 | Bacteria | 79559 |
| 301 | Ga0495613_0000203 | 3300046689 | Bacteria | 58232 |
| 302 | Ga0495624_0000008 | 3300046690 | Bacteria | 145035 |
| 303 | Ga0495624_0009779 | 3300046690 | Bacteria | 6636 |
| 304 | Ga0495649_0000554 | 3300046694 | Bacteria | 31688 |
| 305 | Ga0495600_0000787 | 3300046809 | Bacteria | 16744 |
| 306 | Ga0495600_0030738 | 3300046809 | Bacteria | 3478 |
| 307 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 308 | Ga0495604_0030624 | 3300047317 | Bacteria | 4272 |
| 309 | Ga0495676_0000299 | 3300047321 | Bacteria | 40098 |
| 310 | Ga0495676_0002794 | 3300047321 | Bacteria | 15713 |
| 311 | Ga0495676_0042134 | 3300047321 | Bacteria | 3751 |
| 312 | Ga0495680_0003366 | 3300047322 | Bacteria | 15791 |
| 313 | Ga0495680_0007700 | 3300047322 | Bacteria | 9831 |
| 314 | Ga0495675_0000107 | 3300047444 | Bacteria | 59970 |
| 315 | Ga0495675_0051399 | 3300047444 | Bacteria | 2617 |
| 316 | Ga0495685_022930 | 3300047447 | Bacteria | 2148 |
| 317 | Ga0495684_0084544 | 3300047471 | Bacteria | 2407 |
| 318 | Ga0495602_0000208 | 3300048088 | Bacteria | 54818 |
| 319 | Ga0495602_0000497 | 3300048088 | Bacteria | 36490 |
| 320 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 321 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 322 | Ga0496100_0388084 | 3300048903 | Bacteria | 1061 |
| 323 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 324 | Ga0496101_0000062 | 3300048904 | Bacteria | 126595 |
| 325 | Ga0496101_0018529 | 3300048904 | Bacteria | 4736 |
| 326 | Ga0496101_0285093 | 3300048904 | Bacteria | 1291 |
| 327 | Ga0496102_0000039 | 3300048905 | Bacteria | 198306 |
| 328 | Ga0496102_0036045 | 3300048905 | Bacteria | 4455 |
| 329 | Ga0496102_0056328 | 3300048905 | Bacteria | 3586 |
| 330 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 331 | Ga0496103_0049895 | 3300048906 | Bacteria | 2588 |
| 332 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 333 | Ga0496104_0000129 | 3300048907 | Bacteria | 69982 |
| 334 | Ga0496104_0007265 | 3300048907 | Bacteria | 9776 |
| 335 | Ga0496104_0141265 | 3300048907 | Bacteria | 2313 |
| 336 | Ga0496104_0301916 | 3300048907 | Bacteria | 1513 |
| 337 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 338 | Ga0496105_0000007 | 3300048908 | Bacteria | 339658 |
| 339 | Ga0496105_0000846 | 3300048908 | Bacteria | 20846 |
| 340 | Ga0496105_0074027 | 3300048908 | Bacteria | 2814 |
| 341 | Ga0496105_0308836 | 3300048908 | Bacteria | 1270 |
| 342 | Ga0496106_0000061 | 3300048909 | Bacteria | 86524 |
| 343 | Ga0496106_0000081 | 3300048909 | Bacteria | 76468 |
| 344 | Ga0496106_0000145 | 3300048909 | Bacteria | 52447 |
| 345 | Ga0496106_0042207 | 3300048909 | Bacteria | 3420 |
| 346 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 347 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 348 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 349 | Ga0496108_0001921 | 3300048911 | Bacteria | 16645 |
| 350 | Ga0496108_0040100 | 3300048911 | Bacteria | 3902 |
| 351 | Ga0496108_0219360 | 3300048911 | Bacteria | 1652 |
| 352 | Ga0496108_0299991 | 3300048911 | Bacteria | 1399 |
| 353 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 354 | Ga0496109_0000129 | 3300048912 | Bacteria | 77469 |
| 355 | Ga0496109_0000168 | 3300048912 | Bacteria | 64462 |
| 356 | Ga0496109_0002305 | 3300048912 | Bacteria | 15886 |
| 357 | Ga0496109_0013512 | 3300048912 | Bacteria | 7085 |
| 358 | Ga0496109_0155719 | 3300048912 | Bacteria | 2140 |
| 359 | Ga0496110_0000062 | 3300048913 | Bacteria | 53333 |
| 360 | Ga0496110_0007132 | 3300048913 | Bacteria | 8897 |
| 361 | Ga0496110_0096386 | 3300048913 | Bacteria | 2651 |
| 362 | Ga0496110_0272069 | 3300048913 | Bacteria | 1542 |
| 363 | Ga0496111_0000010 | 3300048914 | Bacteria | 92600 |
| 364 | Ga0496111_0019285 | 3300048914 | Bacteria | 4735 |
| 365 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 366 | Ga0496112_0001122 | 3300048915 | Bacteria | 19906 |
| 367 | Ga0496112_0008237 | 3300048915 | Bacteria | 9326 |
| 368 | Ga0496112_0026696 | 3300048915 | Bacteria | 5563 |
| 369 | Ga0496113_0000014 | 3300048916 | Bacteria | 79850 |
| 370 | Ga0496113_0004352 | 3300048916 | Bacteria | 8681 |
| 371 | Ga0496113_0030382 | 3300048916 | Bacteria | 3911 |
| 372 | Ga0496113_0100520 | 3300048916 | Bacteria | 2241 |
| 373 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 374 | Ga0496114_0080517 | 3300048917 | Bacteria | 2751 |
| 375 | Ga0496114_0222822 | 3300048917 | Bacteria | 1656 |
| 376 | Ga0496114_0460344 | 3300048917 | Bacteria | 1126 |
| 377 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 378 | Ga0496115_0000125 | 3300048918 | Bacteria | 69936 |
| 379 | Ga0496115_0000278 | 3300048918 | Bacteria | 44969 |
| 380 | Ga0496115_0012965 | 3300048918 | Bacteria | 6288 |
| 381 | Ga0496115_0549403 | 3300048918 | Bacteria | 923 |
| 382 | Ga0496116_0000680 | 3300048919 | Bacteria | 44185 |
| 383 | Ga0496118_0179807 | 3300048921 | Bacteria | 1279 |
| 384 | Ga0496119_0001947 | 3300048922 | Bacteria | 23515 |
| 385 | Ga0496124_0289424 | 3300048927 | Bacteria | 1190 |
| 386 | Ga0496126_0035687 | 3300048929 | Bacteria | 4657 |
| 387 | Ga0501031_0000822 | 3300049568 | Bacteria | 18682 |
| 388 | Ga0501032_0004405 | 3300049569 | Bacteria | 10630 |
| 389 | Ga0501033_0000862 | 3300049570 | Bacteria | 27744 |
| 390 | Ga0501034_0077206 | 3300049571 | Bacteria | 3336 |
| 391 | Ga0501036_0000938 | 3300049572 | Bacteria | 21916 |
| 392 | Ga0501036_0198485 | 3300049572 | Bacteria | 1688 |
| 393 | Ga0501037_0003441 | 3300049573 | Bacteria | 11505 |
| 394 | Ga0501038_0000933 | 3300049574 | Bacteria | 26040 |
| 395 | Ga0501038_0028459 | 3300049574 | Bacteria | 4965 |
| 396 | Ga0501039_0003186 | 3300049575 | Bacteria | 12272 |
| 397 | Ga0501040_0003033 | 3300049576 | Bacteria | 10888 |
| 398 | Ga0501040_0067954 | 3300049576 | Bacteria | 2457 |
| 399 | Ga0501041_0001177 | 3300049577 | Bacteria | 14243 |
| 400 | Ga0501041_0250291 | 3300049577 | Bacteria | 1114 |
| 401 | Ga0501041_0267738 | 3300049577 | Bacteria | 1075 |
| 402 | Ga0501042_0000761 | 3300049578 | Bacteria | 17537 |
| 403 | Ga0501042_0017127 | 3300049578 | Bacteria | 4993 |
| 404 | Ga0501042_0100091 | 3300049578 | Bacteria | 2084 |
| 405 | Ga0501042_0126448 | 3300049578 | Bacteria | 1841 |
| 406 | Ga0501043_0002346 | 3300049579 | Bacteria | 16049 |
| 407 | Ga0501043_0201227 | 3300049579 | Bacteria | 1546 |
| 408 | Ga0501046_0008844 | 3300049580 | Bacteria | 8746 |
| 409 | Ga0501046_0042414 | 3300049580 | Bacteria | 3628 |
| 410 | Ga0501046_0123105 | 3300049580 | Bacteria | 1972 |
| 411 | Ga0501047_0000244 | 3300049581 | Bacteria | 64596 |
| 412 | Ga0501047_0064173 | 3300049581 | Bacteria | 3542 |
| 413 | Ga0501047_0111335 | 3300049581 | Bacteria | 2620 |
| 414 | Ga0501048_0000223 | 3300049582 | Bacteria | 37247 |
| 415 | Ga0501048_0117158 | 3300049582 | Bacteria | 1881 |
| 416 | Ga0501048_0184093 | 3300049582 | Bacteria | 1481 |
| 417 | Ga0501067_0029461 | 3300049583 | Bacteria | 3042 |
| 418 | Ga0501067_0040207 | 3300049583 | Bacteria | 2597 |
| 419 | Ga0501067_0104916 | 3300049583 | Bacteria | 1570 |
| 420 | Ga0501068_0000806 | 3300049584 | Bacteria | 16281 |
| 421 | Ga0501068_0026835 | 3300049584 | Bacteria | 3397 |
| 422 | Ga0501068_0037089 | 3300049584 | Bacteria | 2918 |
| 423 | Ga0501069_0000303 | 3300049585 | Bacteria | 22395 |
| 424 | Ga0501069_0000775 | 3300049585 | Bacteria | 14978 |
| 425 | Ga0501069_0063788 | 3300049585 | Bacteria | 2058 |
| 426 | Ga0501069_0153265 | 3300049585 | Bacteria | 1325 |
| 427 | Ga0501070_0004059 | 3300049586 | Bacteria | 12581 |
| 428 | Ga0501070_0028555 | 3300049586 | Bacteria | 4679 |
| 429 | Ga0501070_0304401 | 3300049586 | Bacteria | 1298 |
| 430 | Ga0501071_0000001 | 3300049587 | Bacteria | 123952 |
| 431 | Ga0501071_0021501 | 3300049587 | Bacteria | 4494 |
| 432 | Ga0501071_0087841 | 3300049587 | Bacteria | 2281 |
| 433 | Ga0501072_0000550 | 3300049588 | Bacteria | 26960 |
| 434 | Ga0501072_0154891 | 3300049588 | Bacteria | 1827 |
| 435 | Ga0501074_0001650 | 3300049590 | Bacteria | 15137 |
| 436 | Ga0501074_0103587 | 3300049590 | Bacteria | 2037 |
| 437 | Ga0501074_0152410 | 3300049590 | Bacteria | 1652 |
| 438 | Ga0501075_0001018 | 3300049591 | Bacteria | 17943 |
| 439 | Ga0501075_0001259 | 3300049591 | Bacteria | 16393 |
| 440 | Ga0501075_0031578 | 3300049591 | Bacteria | 3932 |
| 441 | Ga0501075_0049579 | 3300049591 | Bacteria | 3156 |
| 442 | Ga0501075_0317504 | 3300049591 | Bacteria | 1187 |
| 443 | Ga0501076_0000523 | 3300049592 | Bacteria | 24385 |
| 444 | Ga0501076_0045432 | 3300049592 | Bacteria | 3468 |
| 445 | Ga0501076_0054888 | 3300049592 | Bacteria | 3158 |
| 446 | Ga0501077_0000028 | 3300049593 | Bacteria | 74757 |
| 447 | Ga0501079_0000387 | 3300049741 | Bacteria | 28343 |
| 448 | Ga0501079_0158491 | 3300049741 | Bacteria | 1764 |
| 449 | Ga0501080_0001311 | 3300049742 | Bacteria | 20737 |
| 450 | Ga0501080_0071423 | 3300049742 | Bacteria | 3229 |
| 451 | Ga0501081_0000043 | 3300049743 | Bacteria | 47758 |
| 452 | Ga0501081_0060551 | 3300049743 | Bacteria | 2623 |
| 453 | Ga0501081_0089150 | 3300049743 | Bacteria | 2168 |
| 454 | Ga0501083_0000412 | 3300049744 | Bacteria | 27299 |
| 455 | Ga0501083_0090765 | 3300049744 | Bacteria | 2018 |
| 456 | Ga0501083_0098999 | 3300049744 | Bacteria | 1923 |
| 457 | Ga0501083_0390346 | 3300049744 | Bacteria | 905 |
| 458 | Ga0501035_0001272 | 3300049822 | Bacteria | 26065 |
| 459 | Ga0501044_0380074 | 3300049823 | Bacteria | 1327 |
| 460 | Ga0501045_0007778 | 3300049824 | Bacteria | 7454 |
| 461 | Ga0501045_0025998 | 3300049824 | Bacteria | 4209 |
| 462 | Ga0501045_0419990 | 3300049824 | Bacteria | 995 |
| 463 | nmdc:mga05p37_65799_c1 | 3300050507 | Bacteria | 4460 |
| 464 | nmdc:mga08y16_446432_c1 | 3300050511 | Bacteria | 1319 |
| 465 | nmdc:mga0n895_424927_c1 | 3300050512 | Bacteria | 1343 |
| 466 | nmdc:mga0rr50_369481_c1 | 3300050513 | Bacteria | 1208 |
| 467 | nmdc:mga0rr50_4219_c1 | 3300050513 | Bacteria | 8403 |
| 468 | nmdc:mga08x19_158854_c1 | 3300050514 | Bacteria | 1534 |
| 469 | nmdc:mga08x19_97794_c1 | 3300050514 | Bacteria | 1944 |
| 470 | nmdc:mga0a205_24_c2 | 3300050515 | Bacteria | 81894 |
| 471 | nmdc:mga0a205_554492_c1 | 3300050515 | Bacteria | 1004 |
| 472 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 473 | Ga0495601_0000326 | 3300053077 | Bacteria | 25282 |
| 474 | Ga0495612_0009748 | 3300053078 | Bacteria | 3890 |
| 475 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 476 | Ga0495655_0006554 | 3300053083 | Bacteria | 2121 |
| 477 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 478 | Ga0495595_0000172 | 3300053084 | Bacteria | 25608 |
| 479 | Ga0495595_0010201 | 3300053084 | Bacteria | 3901 |
| 480 | Ga0495619_0000031 | 3300053085 | Bacteria | 145508 |
| 481 | Ga0495619_0000106 | 3300053085 | Bacteria | 62413 |
| 482 | Ga0495619_0019190 | 3300053085 | Bacteria | 4345 |
| 483 | Ga0500566_0136933 | 3300053094 | Bacteria | 1303 |
| 484 | Ga0500614_000324 | 3300053123 | Bacteria | 12378 |
| 485 | Ga0500628_000010 | 3300053129 | Bacteria | 122210 |
| 486 | Ga0501084_0000118 | 3300054114 | Bacteria | 60290 |
| 487 | Ga0501084_0018321 | 3300054114 | Bacteria | 5830 |
| 488 | Ga0501082_0000720 | 3300060353 | Bacteria | 29137 |
| 489 | Ga0501082_0236309 | 3300060353 | Bacteria | 1590 |
| 490 | Ga0530510_0000507 | 3300061734 | Bacteria | 24742 |
| 491 | 2819428459 | 2818991318 | Bacteria | 5266538 |
| 492 | 2819664790 | 2818991458 | Bacteria | 4794049 |
| 493 | 2873321648 | 2873314349 | Bacteria | 8512634 |
| 494 | Ga0496112_0192145 | |||
| 495 | JGI25404J52841_10001178 | |||
| 496 | Ga0070683_100013919 | |||
| 497 | Ga0070683_100043328 | |||
| 498 | Ga0070683_100103216 | |||
| 499 | Ga0070677_10000004 | |||
| 500 | Ga0070680_100056117 | |||
| 501 | Ga0070682_100000013 | |||
| 502 | Ga0068868_100000285 | |||
| 503 | Ga0070689_100250616 | |||
| 504 | Ga0070691_10013209 | |||
| 505 | Ga0070661_100000023 | |||
| 506 | Ga0070675_100000101 | |||
| 507 | Ga0070674_100000008 | |||
| 508 | Ga0070674_100000029 | |||
| 509 | Ga0070673_100005926 | |||
| 510 | Ga0070703_10020521 | |||
| 511 | Ga0070714_100019159 | |||
| 512 | Ga0070714_100074136 | |||
| 513 | Ga0070713_100000009 | |||
| 514 | Ga0070713_100247322 | |||
| 515 | Ga0070713_100471207 | |||
| 516 | Ga0070701_10063552 | |||
| 517 | Ga0070711_100003340 | |||
| 518 | Ga0070700_100109911 | |||
| 519 | Ga0070708_100011753 | |||
| 520 | Ga0070708_100059392 | |||
| 521 | Ga0070663_100003079 | |||
| 522 | Ga0070678_100002401 | |||
| 523 | Ga0070662_100000004 | |||
| 524 | Ga0070681_10008992 | |||
| 525 | Ga0070681_10151849 | |||
| 526 | Ga0070707_100000019 | |||
| 527 | Ga0070707_100053678 | |||
| 528 | Ga0070707_100404541 | |||
| 529 | Ga0070699_100004955 | |||
| 530 | Ga0070699_100251724 | |||
| 531 | Ga0070679_100001522 | |||
| 532 | Ga0070679_100082234 | |||
| 533 | Ga0070684_100025299 | |||
| 534 | Ga0070684_100042362 | |||
| 535 | Ga0070684_100111966 | |||
| 536 | Ga0070697_100003630 | |||
| 537 | Ga0070697_100011615 | |||
| 538 | Ga0068853_100103929 | |||
| 539 | Ga0070665_100000106 | |||
| 540 | Ga0070704_100142480 | |||
| 541 | Ga0068855_100061658 | |||
| 542 | Ga0068857_100215924 | |||
| 543 | Ga0068854_100000114 | |||
| 544 | Ga0068854_100030249 | |||
| 545 | Ga0068856_100000577 | |||
| 546 | Ga0068856_100267644 | |||
| 547 | Ga0068852_100000184 | |||
| 548 | Ga0068852_100039119 | |||
| 549 | Ga0068852_100133781 | |||
| 550 | Ga0068859_100009154 | |||
| 551 | Ga0068864_100000045 | |||
| 552 | Ga0068866_10000001 | |||
| 553 | Ga0068866_10000031 | |||
| 554 | Ga0068866_10134243 | |||
| 555 | Ga0068861_100190574 | |||
| 556 | Ga0068851_10136390 | |||
| 557 | Ga0068858_100099843 | |||
| 558 | Ga0068860_100022494 | |||
| 559 | Ga0068860_100638755 | |||
| 560 | Ga0068862_100016408 | |||
| 561 | Ga0081455_10002158 | |||
| 562 | Ga0081455_10045334 | |||
| 563 | Ga0081455_10122181 | |||
| 564 | Ga0081538_10029740 | |||
| 565 | Ga0081538_10089907 | |||
| 566 | Ga0081538_10144826 | |||
| 567 | Ga0081540_1000139 | |||
| 568 | Ga0081540_1000392 | |||
| 569 | Ga0081539_10000791 | |||
| 570 | Ga0081539_10002283 | |||
| 571 | Ga0081539_10002976 | |||
| 572 | Ga0070715_10000001 | |||
| 573 | Ga0070716_100289077 | |||
| 574 | Ga0075434_100311289 | |||
| 575 | Ga0068865_100000160 | |||
| 576 | Ga0075436_100002125 | |||
| 577 | Ga0097620_100009154 | |||
| 578 | Ga0075435_100002843 | |||
| 579 | Ga0099794_10006908 | |||
| 580 | Ga0105240_10543539 | |||
| 581 | Ga0111539_11085785 | |||
| 582 | Ga0105245_10008155 | |||
| 583 | Ga0105247_10000393 | |||
| 584 | Ga0105243_10146104 | |||
| 585 | Ga0105241_10121290 | |||
| 586 | Ga0105242_10000893 | |||
| 587 | Ga0105242_10046076 | |||
| 588 | Ga0105248_10000249 | |||
| 589 | Ga0105248_10020610 | |||
| 590 | Ga0105248_10530594 | |||
| 591 | Ga0105238_10000011 | |||
| 592 | Ga0105238_10136363 | |||
| 593 | Ga0105249_10026806 | |||
| 594 | Ga0105249_10306849 | |||
| 595 | Ga0105249_10538302 | |||
| 596 | Ga0105239_10076029 | |||
| 597 | Ga0105239_10104990 | |||
| 598 | Ga0157371_10002351 | |||
| 599 | Ga0157370_10024759 | |||
| 600 | Ga0157369_10016377 | |||
| 601 | Ga0157374_10034846 | |||
| 602 | Ga0157378_10031324 | |||
| 603 | Ga0157378_10092729 | |||
| 604 | Ga0157372_10000129 | |||
| 605 | Ga0157372_10046424 | |||
| 606 | Ga0157375_10000112 | |||
| 607 | Ga0157375_10469068 | |||
| 608 | Ga0157380_10000093 | |||
| 609 | Ga0157380_10000408 | |||
| 610 | Ga0157380_10141471 | |||
| 611 | Ga0157379_10001717 | |||
| 612 | Ga0157379_10044467 | |||
| 613 | Ga0157379_10275441 | |||
| 614 | Ga0163161_10167243 | |||
| 615 | Ga0206353_10089411 | |||
| 616 | Ga0207656_10096329 | |||
| 617 | Ga0207682_10000031 | |||
| 618 | Ga0207642_10000002 | |||
| 619 | Ga0207642_10000919 | |||
| 620 | Ga0207710_10000195 | |||
| 621 | Ga0207685_10000036 | |||
| 622 | Ga0207643_10137897 | |||
| 623 | Ga0207707_10013823 | |||
| 624 | Ga0207707_10016625 | |||
| 625 | Ga0207707_10112429 | |||
| 626 | Ga0207695_10100322 | |||
| 627 | Ga0207663_10143876 | |||
| 628 | Ga0207649_10000063 | |||
| 629 | Ga0207652_10000349 | |||
| 630 | Ga0207652_10043823 | |||
| 631 | Ga0207652_10056664 | |||
| 632 | Ga0207646_10000001 | |||
| 633 | Ga0207646_10000006 | |||
| 634 | Ga0207646_10010529 | |||
| 635 | Ga0207646_10172851 | |||
| 636 | Ga0207646_10308907 | |||
| 637 | Ga0207646_10354406 | |||
| 638 | Ga0207681_10177338 | |||
| 639 | Ga0207694_10000004 | |||
| 640 | Ga0207694_10049610 | |||
| 641 | Ga0207659_10000010 | |||
| 642 | Ga0207687_10000018 | |||
| 643 | Ga0207687_10000177 | |||
| 644 | Ga0207687_10004028 | |||
| 645 | Ga0207687_10010603 | |||
| 646 | Ga0207700_10000025 | |||
| 647 | Ga0207700_10048817 | |||
| 648 | Ga0207664_10048957 | |||
| 649 | Ga0207706_10000012 | |||
| 650 | Ga0207686_10023096 | |||
| 651 | Ga0207686_10265341 | |||
| 652 | Ga0207709_10096394 | |||
| 653 | Ga0207670_10167372 | |||
| 654 | Ga0207669_10000004 | |||
| 655 | Ga0207669_10000012 | |||
| 656 | Ga0207704_10000236 | |||
| 657 | Ga0207704_10449357 | |||
| 658 | Ga0207665_10291061 | |||
| 659 | Ga0207711_10000020 | |||
| 660 | Ga0207711_10044815 | |||
| 661 | Ga0207711_10373744 | |||
| 662 | Ga0207661_10000095 | |||
| 663 | Ga0207661_10070678 | |||
| 664 | Ga0207661_10074244 | |||
| 665 | Ga0207667_10062752 | |||
| 666 | Ga0207651_10000460 | |||
| 667 | Ga0207712_10000007 | |||
| 668 | Ga0207712_10037840 | |||
| 669 | Ga0207668_10144035 | |||
| 670 | Ga0207640_10000015 | |||
| 671 | Ga0207640_10028740 | |||
| 672 | Ga0207640_10137065 | |||
| 673 | Ga0207677_10000331 | |||
| 674 | Ga0207703_10000040 | |||
| 675 | Ga0207703_10081201 | |||
| 676 | Ga0207703_10117759 | |||
| 677 | Ga0207639_10007405 | |||
| 678 | Ga0207678_10007745 | |||
| 679 | Ga0207708_10131923 | |||
| 680 | Ga0207708_10203293 | |||
| 681 | Ga0207702_10000060 | |||
| 682 | Ga0207702_10003607 | |||
| 683 | Ga0207702_10244217 | |||
| 684 | Ga0207702_10256597 | |||
| 685 | Ga0207641_10025406 | |||
| 686 | Ga0207648_10081248 | |||
| 687 | Ga0207676_10000016 | |||
| 688 | Ga0207676_10122445 | |||
| 689 | Ga0207674_10028955 | |||
| 690 | Ga0207674_10099830 | |||
| 691 | Ga0207675_100218471 | |||
| 692 | Ga0207675_100509528 | |||
| 693 | Ga0207683_10003745 | |||
| 694 | Ga0207683_10127556 | |||
| 695 | Ga0207698_10000012 | |||
| 696 | Ga0207698_10031252 | |||
| 697 | Ga0207698_10070948 | |||
| 698 | Ga0209588_1000724 | |||
| 699 | Ga0209588_1002617 | |||
| 700 | Ga0268265_10072570 | |||
| 701 | Ga0268264_10031067 | |||
| 702 | Ga0265337_1000231 | |||
| 703 | Ga0265326_10000007 | |||
| 704 | Ga0265319_1000025 | |||
| 705 | Ga0265322_10000001 | |||
| 706 | Ga0265336_10009094 | |||
| 707 | Ga0265338_10000473 | |||
| 708 | Ga0265338_10000764 | |||
| 709 | Ga0265338_10325401 | |||
| 710 | Ga0265324_10001009 | |||
| 711 | Ga0265328_10009838 | |||
| 712 | Ga0265320_10000002 | |||
| 713 | Ga0265325_10001007 | |||
| 714 | Ga0265329_10006540 | |||
| 715 | Ga0265339_10000855 | |||
| 716 | Ga0265339_10119610 | |||
| 717 | Ga0265331_10016502 | |||
| 718 | Ga0265327_10000011 | |||
| 719 | Ga0265316_10037070 | |||
| 720 | Ga0265313_10001275 | |||
| 721 | Ga0265314_10000062 | |||
| 722 | Ga0265314_10011335 | |||
| 723 | Ga0307409_100030889 | |||
| 724 | Ga0373937_0064484 | |||
| 725 | Ga0373937_0539446 | |||
| 726 | Ga0395899_0198897 | |||
| 727 | Ga0395900_0254734 | |||
| 728 | Ga0395898_0071994 | |||
| 729 | Ga0395898_0262701 | |||
| 730 | Ga0436364_0955823 | |||
| 731 | Ga0395901_0022836 | |||
| 732 | Ga0395901_0398136 | |||
| 733 | Ga0439434_0025262 | |||
| 734 | Ga0466966_0063617 | |||
| 735 | Ga0466966_0082841 | |||
| 736 | Ga0466963_0000001 | |||
| 737 | Ga0466963_0000739 | |||
| 738 | Ga0466971_0024517 | |||
| 739 | Ga0466957_0015669 | |||
| 740 | Ga0466957_0078135 | |||
| 741 | Ga0466960_0069729 | |||
| 742 | Ga0466958_0050321 | |||
| 743 | Ga0466967_0000065 | |||
| 744 | Ga0466967_0008096 | |||
| 745 | Ga0466967_0251359 | |||
| 746 | Ga0466967_0436365 | |||
| 747 | Ga0466967_0437856 | |||
| 748 | Ga0495592_0000036 | |||
| 749 | Ga0495592_0177405 | |||
| 750 | Ga0495603_0000030 | |||
| 751 | Ga0495603_0006771 | |||
| 752 | Ga0495629_0000272 | |||
| 753 | Ga0495629_0043316 | |||
| 754 | Ga0495638_0079564 | |||
| 755 | Ga0495641_0000044 | |||
| 756 | Ga0495582_0000011 | |||
| 757 | Ga0495662_0000458 | |||
| 758 | Ga0495662_0006939 | |||
| 759 | Ga0495594_0000003 | |||
| 760 | Ga0495608_0000068 | |||
| 761 | Ga0495608_0001071 | |||
| 762 | Ga0495608_0009335 | |||
| 763 | Ga0495608_0062435 | |||
| 764 | Ga0495618_0000594 | |||
| 765 | Ga0495620_0000144 | |||
| 766 | Ga0495620_0082178 | |||
| 767 | Ga0495628_0001219 | |||
| 768 | Ga0495628_0002850 | |||
| 769 | Ga0495628_0040965 | |||
| 770 | Ga0495630_0000056 | |||
| 771 | Ga0495630_0000408 | |||
| 772 | Ga0495630_0000541 | |||
| 773 | Ga0495644_0000642 | |||
| 774 | Ga0495652_0000019 | |||
| 775 | Ga0495587_0002971 | |||
| 776 | Ga0495587_0043155 | |||
| 777 | Ga0495645_0019069 | |||
| 778 | Ga0495622_0000180 | |||
| 779 | Ga0495633_0042722 | |||
| 780 | Ga0495667_0000032 | |||
| 781 | Ga0495634_0000247 | |||
| 782 | Ga0495634_0024941 | |||
| 783 | Ga0495625_0000696 | |||
| 784 | Ga0495635_0000016 | |||
| 785 | Ga0495588_0000165 | |||
| 786 | Ga0495657_0000004 | |||
| 787 | Ga0495657_0041818 | |||
| 788 | Ga0495657_0085327 | |||
| 789 | Ga0495623_0216623 | |||
| 790 | Ga0495647_0000008 | |||
| 791 | Ga0495658_0000005 | |||
| 792 | Ga0495658_0019458 | |||
| 793 | Ga0495613_0000113 | |||
| 794 | Ga0495613_0000203 | |||
| 795 | Ga0495624_0000008 | |||
| 796 | Ga0495624_0009779 | |||
| 797 | Ga0495649_0000554 | |||
| 798 | Ga0495600_0000787 | |||
| 799 | Ga0495600_0030738 | |||
| 800 | Ga0495604_0000019 | |||
| 801 | Ga0495604_0030624 | |||
| 802 | Ga0495676_0000299 | |||
| 803 | Ga0495676_0002794 | |||
| 804 | Ga0495676_0042134 | |||
| 805 | Ga0495680_0003366 | |||
| 806 | Ga0495680_0007700 | |||
| 807 | Ga0495675_0000107 | |||
| 808 | Ga0495675_0051399 | |||
| 809 | Ga0495685_022930 | |||
| 810 | Ga0495684_0084544 | |||
| 811 | Ga0495602_0000208 | |||
| 812 | Ga0495602_0000497 | |||
| 813 | Ga0496100_0000002 | |||
| 814 | Ga0496100_0000018 | |||
| 815 | Ga0496100_0388084 | |||
| 816 | Ga0496101_0000001 | |||
| 817 | Ga0496101_0000062 | |||
| 818 | Ga0496101_0018529 | |||
| 819 | Ga0496101_0285093 | |||
| 820 | Ga0496102_0000039 | |||
| 821 | Ga0496102_0036045 | |||
| 822 | Ga0496102_0056328 | |||
| 823 | Ga0496103_0000008 | |||
| 824 | Ga0496103_0049895 | |||
| 825 | Ga0496104_0000009 | |||
| 826 | Ga0496104_0000129 | |||
| 827 | Ga0496104_0007265 | |||
| 828 | Ga0496104_0141265 | |||
| 829 | Ga0496104_0301916 | |||
| 830 | Ga0496105_0000001 | |||
| 831 | Ga0496105_0000007 | |||
| 832 | Ga0496105_0000846 | |||
| 833 | Ga0496105_0074027 | |||
| 834 | Ga0496105_0308836 | |||
| 835 | Ga0496106_0000061 | |||
| 836 | Ga0496106_0000081 | |||
| 837 | Ga0496106_0000145 | |||
| 838 | Ga0496106_0042207 | |||
| 839 | Ga0496107_0000006 | |||
| 840 | Ga0496107_0000013 | |||
| 841 | Ga0496108_0000001 | |||
| 842 | Ga0496108_0001921 | |||
| 843 | Ga0496108_0040100 | |||
| 844 | Ga0496108_0219360 | |||
| 845 | Ga0496108_0299991 | |||
| 846 | Ga0496109_0000003 | |||
| 847 | Ga0496109_0000129 | |||
| 848 | Ga0496109_0000168 | |||
| 849 | Ga0496109_0002305 | |||
| 850 | Ga0496109_0013512 | |||
| 851 | Ga0496109_0155719 | |||
| 852 | Ga0496110_0000062 | |||
| 853 | Ga0496110_0007132 | |||
| 854 | Ga0496110_0096386 | |||
| 855 | Ga0496110_0272069 | |||
| 856 | Ga0496111_0000010 | |||
| 857 | Ga0496111_0019285 | |||
| 858 | Ga0496112_0000003 | |||
| 859 | Ga0496112_0001122 | |||
| 860 | Ga0496112_0008237 | |||
| 861 | Ga0496112_0026696 | |||
| 862 | Ga0496113_0000014 | |||
| 863 | Ga0496113_0004352 | |||
| 864 | Ga0496113_0030382 | |||
| 865 | Ga0496113_0100520 | |||
| 866 | Ga0496114_0000014 | |||
| 867 | Ga0496114_0080517 | |||
| 868 | Ga0496114_0222822 | |||
| 869 | Ga0496114_0460344 | |||
| 870 | Ga0496115_0000003 | |||
| 871 | Ga0496115_0000125 | |||
| 872 | Ga0496115_0000278 | |||
| 873 | Ga0496115_0012965 | |||
| 874 | Ga0496115_0549403 | |||
| 875 | Ga0496116_0000680 | |||
| 876 | Ga0496118_0179807 | |||
| 877 | Ga0496119_0001947 | |||
| 878 | Ga0496124_0289424 | |||
| 879 | Ga0496126_0035687 | |||
| 880 | Ga0501031_0000822 | |||
| 881 | Ga0501032_0004405 | |||
| 882 | Ga0501033_0000862 | |||
| 883 | Ga0501034_0077206 | |||
| 884 | Ga0501036_0000938 | |||
| 885 | Ga0501036_0198485 | |||
| 886 | Ga0501037_0003441 | |||
| 887 | Ga0501038_0000933 | |||
| 888 | Ga0501038_0028459 | |||
| 889 | Ga0501039_0003186 | |||
| 890 | Ga0501040_0003033 | |||
| 891 | Ga0501040_0067954 | |||
| 892 | Ga0501041_0001177 | |||
| 893 | Ga0501041_0250291 | |||
| 894 | Ga0501041_0267738 | |||
| 895 | Ga0501042_0000761 | |||
| 896 | Ga0501042_0017127 | |||
| 897 | Ga0501042_0100091 | |||
| 898 | Ga0501042_0126448 | |||
| 899 | Ga0501043_0002346 | |||
| 900 | Ga0501043_0201227 | |||
| 901 | Ga0501046_0008844 | |||
| 902 | Ga0501046_0042414 | |||
| 903 | Ga0501046_0123105 | |||
| 904 | Ga0501047_0000244 | |||
| 905 | Ga0501047_0064173 | |||
| 906 | Ga0501047_0111335 | |||
| 907 | Ga0501048_0000223 | |||
| 908 | Ga0501048_0117158 | |||
| 909 | Ga0501048_0184093 | |||
| 910 | Ga0501067_0029461 | |||
| 911 | Ga0501067_0040207 | |||
| 912 | Ga0501067_0104916 | |||
| 913 | Ga0501068_0000806 | |||
| 914 | Ga0501068_0026835 | |||
| 915 | Ga0501068_0037089 | |||
| 916 | Ga0501069_0000303 | |||
| 917 | Ga0501069_0000775 | |||
| 918 | Ga0501069_0063788 | |||
| 919 | Ga0501069_0153265 | |||
| 920 | Ga0501070_0004059 | |||
| 921 | Ga0501070_0028555 | |||
| 922 | Ga0501070_0304401 | |||
| 923 | Ga0501071_0000001 | |||
| 924 | Ga0501071_0021501 | |||
| 925 | Ga0501071_0087841 | |||
| 926 | Ga0501072_0000550 | |||
| 927 | Ga0501072_0154891 | |||
| 928 | Ga0501074_0001650 | |||
| 929 | Ga0501074_0103587 | |||
| 930 | Ga0501074_0152410 | |||
| 931 | Ga0501075_0001018 | |||
| 932 | Ga0501075_0001259 | |||
| 933 | Ga0501075_0031578 | |||
| 934 | Ga0501075_0049579 | |||
| 935 | Ga0501075_0317504 | |||
| 936 | Ga0501076_0000523 | |||
| 937 | Ga0501076_0045432 | |||
| 938 | Ga0501076_0054888 | |||
| 939 | Ga0501077_0000028 | |||
| 940 | Ga0501079_0000387 | |||
| 941 | Ga0501079_0158491 | |||
| 942 | Ga0501080_0001311 | |||
| 943 | Ga0501080_0071423 | |||
| 944 | Ga0501081_0000043 | |||
| 945 | Ga0501081_0060551 | |||
| 946 | Ga0501081_0089150 | |||
| 947 | Ga0501083_0000412 | |||
| 948 | Ga0501083_0090765 | |||
| 949 | Ga0501083_0098999 | |||
| 950 | Ga0501083_0390346 | |||
| 951 | Ga0501035_0001272 | |||
| 952 | Ga0501044_0380074 | |||
| 953 | Ga0501045_0007778 | |||
| 954 | Ga0501045_0025998 | |||
| 955 | Ga0501045_0419990 | |||
| 956 | nmdc:mga05p37_65799_c1 | |||
| 957 | nmdc:mga08y16_446432_c1 | |||
| 958 | nmdc:mga0n895_424927_c1 | |||
| 959 | nmdc:mga0rr50_369481_c1 | |||
| 960 | nmdc:mga0rr50_4219_c1 | |||
| 961 | nmdc:mga08x19_158854_c1 | |||
| 962 | nmdc:mga08x19_97794_c1 | |||
| 963 | nmdc:mga0a205_24_c2 | |||
| 964 | nmdc:mga0a205_554492_c1 | |||
| 965 | Ga0495601_0000013 | |||
| 966 | Ga0495601_0000326 | |||
| 967 | Ga0495612_0009748 | |||
| 968 | Ga0495655_0000001 | |||
| 969 | Ga0495655_0006554 | |||
| 970 | Ga0495595_0000003 | |||
| 971 | Ga0495595_0000172 | |||
| 972 | Ga0495595_0010201 | |||
| 973 | Ga0495619_0000031 | |||
| 974 | Ga0495619_0000106 | |||
| 975 | Ga0495619_0019190 | |||
| 976 | Ga0500566_0136933 | |||
| 977 | Ga0500614_000324 | |||
| 978 | Ga0500628_000010 | |||
| 979 | Ga0501084_0000118 | |||
| 980 | Ga0501084_0018321 | |||
| 981 | Ga0501082_0000720 | |||
| 982 | Ga0501082_0236309 | |||
| 983 | Ga0530510_0000507 | |||
| 984 | 2819428459 | |||
| 985 | 2819664790 | |||
| 986 | 2873321648 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9209 | 1 | 202 |
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9204 | 2 | 205 |
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9186 | 8 | 202 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9028 | 2 | 202 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9018 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQL9_1_244_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9444 | 1 | 205 | 3.40.50.300 |
| af_Q8T6J0_514_774_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9425 | 8 | 204 | 3.40.50.300 |
| af_A0A1D6KPM2_510_779_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9363 | 8 | 202 | 3.40.50.300 |
| af_O53149_2_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9361 | 1 | 205 | 3.40.50.300 |
| af_A0A0R0KIK5_1390_1640_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9358 | 8 | 204 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9B0A6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9682 | 73 | 205 |
GO:0005524
GO:0016887 |
| AF-A0A348B4H2-F1-model_v4 | ABC transporter domain-containing protein | 0.963 | 21 | 204 |
GO:0005524
GO:0016887 |
| AF-A0A7J8BN72-F1-model_v4 | ATP binding cassette subfamily A member 7 | 0.9534 | 5 | 202 |
GO:0005524
GO:0016020 GO:0016887 GO:0033344 GO:0033700 GO:0034188 GO:0043231 GO:0090554 GO:0090556 GO:0140359 |
| AF-A0A7X8XW61-F1-model_v4 | ABC transporter ATP-binding protein | 0.9515 | 1 | 205 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A536FTK2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9507 | 1 | 202 |
GO:0005524
GO:0016887 |