F454492

General Info

Members Datasets Scaffolds Average Seq Length
493 205 986 210

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0021254|Ga0501070_0021254_1888_2643
Length 251
Sequence MTWINTRIRQTAVMHGVPVDPRGSSSRHPASNPIAHGPKEHPMQIRSDSFQNHARLPAEFAFGKPGDRDEPCVLSANRNPHLAWSGAPADTRSFALVCIDSDVPSRGDDVNQPGRTVPADLPRVDFAHWLMVDIPPACTTIAAGACSDGVTPHGKSDPAGPAGTRQGRNDYTGWFASDPGMAGDYLGYDGPCPPWNDALLHHYRFRVYALDVARLDLPRAFGWQELQAALRGHVLDEAEIVGTYSLNPAVK

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 2511231016 Pseudomonas sp. GM50 Isolate Nodule
198 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
199 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
200 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
201 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
202 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
203 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
204 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
205 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 3.65
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0.2
Rhizoplane 2.03
Rhizosphere 92.7
Stem 0
Stem Tuber 0.41
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0021254 3300049586 Bacteria 5446
2 JGI24741J21665_1000615 3300001915 Bacteria 10743
3 JGI24741J21665_1004217 3300001915 Bacteria 3234
4 JGI24741J21665_1009412 3300001915 Bacteria 1796
5 JGI24740J21852_10000222 3300001979 Bacteria 24091
6 JGI24740J21852_10006910 3300001979 Bacteria 4660
7 rootL2_10060175 3300003322 Bacteria 6746
8 Ga0070658_10082438 3300005327 Bacteria 2643
9 Ga0070658_10323857 3300005327 Bacteria 1316
10 Ga0070658_10368364 3300005327 Bacteria 1231
11 Ga0070658_11023469 3300005327 Bacteria 718
12 Ga0070683_100053356 3300005329 Bacteria 3746
13 Ga0070666_10157802 3300005335 Bacteria 1585
14 Ga0070680_100000301 3300005336 Bacteria 33020
15 Ga0070680_100008519 3300005336 Bacteria 7855
16 Ga0070680_100073429 3300005336 Bacteria 2813
17 Ga0070680_100474520 3300005336 Bacteria 1069
18 Ga0070682_100001936 3300005337 Bacteria 11552
19 Ga0070682_100075285 3300005337 Bacteria 2170
20 Ga0070682_100276918 3300005337 Bacteria 1221
21 Ga0070660_100013635 3300005339 Bacteria 5840
22 Ga0070660_100015985 3300005339 Bacteria 5435
23 Ga0070660_100016246 3300005339 Bacteria 5399
24 Ga0070660_100066523 3300005339 Bacteria 2806
25 Ga0070691_10000178 3300005341 Bacteria 20899
26 Ga0070691_10026631 3300005341 Bacteria 2696
27 Ga0070661_100029733 3300005344 Bacteria 3944
28 Ga0070661_100049910 3300005344 Bacteria 3063
29 Ga0070661_100057445 3300005344 Bacteria 2851
30 Ga0070692_10004465 3300005345 Bacteria 5850
31 Ga0070692_10010903 3300005345 Bacteria 4157
32 Ga0070692_10012765 3300005345 Bacteria 3900
33 Ga0070692_10014928 3300005345 Bacteria 3661
34 Ga0070668_100033077 3300005347 Bacteria 3935
35 Ga0070668_100203127 3300005347 Bacteria 1627
36 Ga0070671_100113579 3300005355 Bacteria 2276
37 Ga0070673_100295936 3300005364 Unclassified 1424
38 Ga0070659_100012411 3300005366 Bacteria 6318
39 Ga0070667_100000040 3300005367 Bacteria 170222
40 Ga0070667_100065297 3300005367 Bacteria 3090
41 Ga0070667_100102301 3300005367 Bacteria 2475
42 Ga0070714_100000311 3300005435 Bacteria 36885
43 Ga0070694_100069129 3300005444 Bacteria 2428
44 Ga0070694_100518293 3300005444 Bacteria 951
45 Ga0070663_100000152 3300005455 Bacteria 34096
46 Ga0070663_100007949 3300005455 Bacteria 6498
47 Ga0070663_100231100 3300005455 Bacteria 1456
48 Ga0070663_100294704 3300005455 Bacteria 1297
49 Ga0070663_100413167 3300005455 Bacteria 1105
50 Ga0070662_100900483 3300005457 Bacteria 755
51 Ga0070681_10000015 3300005458 Bacteria 130427
52 Ga0070681_10000062 3300005458 Bacteria 77779
53 Ga0070681_10000088 3300005458 Bacteria 69295
54 Ga0070681_10043510 3300005458 Bacteria 4499
55 Ga0070681_10438928 3300005458 Bacteria 1217
56 Ga0070679_100000061 3300005530 Bacteria 80570
57 Ga0070679_100000188 3300005530 Bacteria 49880
58 Ga0070679_100029155 3300005530 Bacteria 5444
59 Ga0070679_100543516 3300005530 Bacteria 1105
60 Ga0070684_100089705 3300005535 Bacteria 2732
61 Ga0070684_100195562 3300005535 Bacteria 1841
62 Ga0068853_100000897 3300005539 Bacteria 20716
63 Ga0068853_100004247 3300005539 Bacteria 11065
64 Ga0068853_100012119 3300005539 Bacteria 7013
65 Ga0068853_100016747 3300005539 Bacteria 6038
66 Ga0068853_100042220 3300005539 Bacteria 3898
67 Ga0068853_100241284 3300005539 Bacteria 1656
68 Ga0068853_100272304 3300005539 Bacteria 1559
69 Ga0070696_100000213 3300005546 Bacteria 34817
70 Ga0070696_100041487 3300005546 Bacteria 3180
71 Ga0070693_100001310 3300005547 Bacteria 11210
72 Ga0070693_100007118 3300005547 Bacteria 5454
73 Ga0070665_100015064 3300005548 Bacteria 7763
74 Ga0070665_100047560 3300005548 Bacteria 4305
75 Ga0070665_100071462 3300005548 Bacteria 3476
76 Ga0068855_100003252 3300005563 Bacteria 19872
77 Ga0068855_100003760 3300005563 Bacteria 18553
78 Ga0068855_100017314 3300005563 Bacteria 8670
79 Ga0068855_100095903 3300005563 Bacteria 3418
80 Ga0068855_100127132 3300005563 Bacteria 2913
81 Ga0068855_100338848 3300005563 Bacteria 1658
82 Ga0068855_100540530 3300005563 Bacteria 1262
83 Ga0070664_100010265 3300005564 Bacteria 7595
84 Ga0068857_100012518 3300005577 Bacteria 7387
85 Ga0068857_100028820 3300005577 Bacteria 4899
86 Ga0068857_100108119 3300005577 Bacteria 2499
87 Ga0068854_100001352 3300005578 Bacteria 14792
88 Ga0068854_100019485 3300005578 Bacteria 4573
89 Ga0068854_100063971 3300005578 Bacteria 2672
90 Ga0068854_100116105 3300005578 Bacteria 2025
91 Ga0068854_100424328 3300005578 Bacteria 1105
92 Ga0068856_100018258 3300005614 Bacteria 6800
93 Ga0068856_100107584 3300005614 Bacteria 2784
94 Ga0068856_100166290 3300005614 Bacteria 2217
95 Ga0068856_100380636 3300005614 Bacteria 1430
96 Ga0068856_100909253 3300005614 Bacteria 899
97 Ga0068852_100012685 3300005616 Bacteria 6411
98 Ga0068852_100062840 3300005616 Bacteria 3231
99 Ga0068852_100198781 3300005616 Bacteria 1896
100 Ga0068852_100223068 3300005616 Bacteria 1793
101 Ga0068859_100000979 3300005617 Bacteria 29249
102 Ga0068859_100773775 3300005617 Bacteria 1048
103 Ga0068851_10011316 3300005834 Bacteria 4182
104 Ga0068851_10147779 3300005834 Bacteria 1283
105 Ga0068851_10152801 3300005834 Bacteria 1263
106 Ga0068863_100044420 3300005841 Bacteria 4218
107 Ga0068863_100372586 3300005841 Bacteria 1393
108 Ga0068858_100297926 3300005842 Bacteria 1538
109 Ga0068858_100464023 3300005842 Bacteria 1221
110 Ga0068858_100496493 3300005842 Unclassified 1179
111 Ga0068860_100072217 3300005843 Bacteria 3279
112 Ga0068862_100000224 3300005844 Bacteria 62869
113 Ga0097621_100050721 3300006237 Bacteria 3375
114 Ga0097621_100473045 3300006237 Bacteria 1132
115 Ga0097620_100000979 3300006931 Bacteria 29249
116 Ga0097620_100773825 3300006931 Bacteria 1048
117 Ga0105240_10026029 3300009093 Bacteria 7683
118 Ga0105240_10031009 3300009093 Bacteria 6939
119 Ga0105240_10107714 3300009093 Bacteria 3378
120 Ga0105240_10124734 3300009093 Bacteria 3096
121 Ga0105240_10251999 3300009093 Bacteria 2041
122 Ga0105247_10220829 3300009101 Bacteria 1283
123 Ga0105243_10492351 3300009148 Bacteria 1160
124 Ga0105241_10042730 3300009174 Bacteria 3431
125 Ga0105241_10140516 3300009174 Bacteria 1965
126 Ga0105241_10144740 3300009174 Bacteria 1939
127 Ga0105241_10185116 3300009174 Bacteria 1730
128 Ga0105241_10266966 3300009174 Bacteria 1456
129 Ga0105248_10005513 3300009177 Bacteria 13896
130 Ga0105248_10134512 3300009177 Bacteria 2789
131 Ga0105237_10001863 3300009545 Bacteria 26949
132 Ga0105237_10074209 3300009545 Bacteria 3393
133 Ga0105237_10267037 3300009545 Bacteria 1714
134 Ga0105237_10573998 3300009545 Bacteria 1135
135 Ga0105238_10013703 3300009551 Bacteria 8189
136 Ga0105238_10022214 3300009551 Bacteria 6468
137 Ga0105249_10000193 3300009553 Bacteria 69963
138 Ga0105249_10022676 3300009553 Bacteria 5626
139 Ga0105239_10005286 3300010375 Bacteria 15176
140 Ga0105239_10039059 3300010375 Bacteria 5200
141 Ga0105239_10075807 3300010375 Bacteria 3698
142 Ga0105239_10383296 3300010375 Bacteria 1589
143 Ga0105239_10805383 3300010375 Unclassified 1076
144 Ga0157373_10036715 3300013100 Bacteria 3514
145 Ga0157373_10060193 3300013100 Bacteria 2690
146 Ga0157373_10094224 3300013100 Bacteria 2109
147 Ga0157371_10020103 3300013102 Bacteria 4915
148 Ga0157371_10020463 3300013102 Bacteria 4869
149 Ga0157371_10137229 3300013102 Bacteria 1742
150 Ga0157371_10416621 3300013102 Bacteria 984
151 Ga0157370_10012911 3300013104 Bacteria 8634
152 Ga0157370_10068309 3300013104 Bacteria 3359
153 Ga0157370_10074695 3300013104 Bacteria 3197
154 Ga0157370_10135940 3300013104 Bacteria 2291
155 Ga0157370_10800439 3300013104 Bacteria 858
156 Ga0157369_10087774 3300013105 Bacteria 3321
157 Ga0157369_10146436 3300013105 Bacteria 2497
158 Ga0157369_10228972 3300013105 Bacteria 1944
159 Ga0157369_10241982 3300013105 Bacteria 1884
160 Ga0157374_10178371 3300013296 Bacteria 2074
161 Ga0157372_10010645 3300013307 Bacteria 9784
162 Ga0157372_10052909 3300013307 Bacteria 4523
163 Ga0157372_10116984 3300013307 Bacteria 3057
164 Ga0157372_10167359 3300013307 Bacteria 2542
165 Ga0157372_10272940 3300013307 Bacteria 1965
166 Ga0157375_10083021 3300013308 Unclassified 3248
167 Ga0157379_10107009 3300014968 Bacteria 2510
168 Ga0157379_10114850 3300014968 Unclassified 2420
169 Ga0157376_10207632 3300014969 Bacteria 1806
170 Ga0157376_10365276 3300014969 Bacteria 1385
171 Ga0157376_10521714 3300014969 Bacteria 1171
172 Ga0182006_1013713 3300015261 Bacteria 3507
173 Ga0197907_10094875 3300020069 Bacteria 3683
174 Ga0206356_10143582 3300020070 Bacteria 3330
175 Ga0206356_10647139 3300020070 Bacteria 7465
176 Ga0206356_11433262 3300020070 Bacteria 3890
177 Ga0206351_10166290 3300020077 Bacteria 2089
178 Ga0206352_10430462 3300020078 Bacteria 2174
179 Ga0206352_10438213 3300020078 Bacteria 1940
180 Ga0206350_10220779 3300020080 Bacteria 2775
181 Ga0206350_10233428 3300020080 Bacteria 2453
182 Ga0206354_10039073 3300020081 Bacteria 2676
183 Ga0206354_10072506 3300020081 Bacteria 1664
184 Ga0206354_10107429 3300020081 Bacteria 7299
185 Ga0206354_10287451 3300020081 Bacteria 3560
186 Ga0206353_10251616 3300020082 Bacteria 2024
187 Ga0206353_10516896 3300020082 Bacteria 6987
188 Ga0206353_10819831 3300020082 Bacteria 3830
189 Ga0154015_1153483 3300020610 Bacteria 3409
190 Ga0154015_1494868 3300020610 Bacteria 2610
191 Ga0209026_1003406 3300025250 Bacteria 5234
192 Ga0209051_1022830 3300025303 Bacteria 2621
193 Ga0207656_10027123 3300025321 Bacteria 2341
194 Ga0207656_10039032 3300025321 Bacteria 2006
195 Ga0207656_10121485 3300025321 Bacteria 1216
196 Ga0207692_10273968 3300025898 Bacteria 1019
197 Ga0207680_10038056 3300025903 Unclassified 2782
198 Ga0207647_10000197 3300025904 Bacteria 49345
199 Ga0207647_10006761 3300025904 Bacteria 8321
200 Ga0207647_10008395 3300025904 Bacteria 7407
201 Ga0207645_10069130 3300025907 Bacteria 2259
202 Ga0207705_10000097 3300025909 Bacteria 105579
203 Ga0207705_10001380 3300025909 Bacteria 19386
204 Ga0207705_10017993 3300025909 Bacteria 5053
205 Ga0207705_10080378 3300025909 Bacteria 2375
206 Ga0207705_10129337 3300025909 Bacteria 1878
207 Ga0207654_10269960 3300025911 Bacteria 1147
208 Ga0207707_10000065 3300025912 Bacteria 106546
209 Ga0207707_10000084 3300025912 Bacteria 95228
210 Ga0207707_10000144 3300025912 Bacteria 73715
211 Ga0207707_10000161 3300025912 Bacteria 70295
212 Ga0207707_10000949 3300025912 Bacteria 27923
213 Ga0207707_10002991 3300025912 Bacteria 15036
214 Ga0207707_10017928 3300025912 Bacteria 6173
215 Ga0207695_10000820 3300025913 Bacteria 57515
216 Ga0207695_10003204 3300025913 Bacteria 23317
217 Ga0207695_10008721 3300025913 Bacteria 12643
218 Ga0207695_10011037 3300025913 Bacteria 10977
219 Ga0207695_10060774 3300025913 Bacteria 3909
220 Ga0207695_10180949 3300025913 Bacteria 2029
221 Ga0207671_10004436 3300025914 Bacteria 13422
222 Ga0207671_10129322 3300025914 Bacteria 1937
223 Ga0207671_10273158 3300025914 Bacteria 1332
224 Ga0207671_10482396 3300025914 Bacteria 988
225 Ga0207660_10000368 3300025917 Bacteria 29401
226 Ga0207660_10000561 3300025917 Bacteria 24996
227 Ga0207660_10004075 3300025917 Bacteria 9524
228 Ga0207660_10004119 3300025917 Bacteria 9466
229 Ga0207657_10001354 3300025919 Bacteria 26098
230 Ga0207657_10011996 3300025919 Bacteria 8572
231 Ga0207657_10012298 3300025919 Bacteria 8457
232 Ga0207657_10023702 3300025919 Bacteria 5708
233 Ga0207657_10024718 3300025919 Bacteria 5554
234 Ga0207649_10013832 3300025920 Bacteria 4512
235 Ga0207649_10133707 3300025920 Bacteria 1688
236 Ga0207649_10135327 3300025920 Bacteria 1679
237 Ga0207649_10530492 3300025920 Bacteria 898
238 Ga0207652_10000076 3300025921 Bacteria 107686
239 Ga0207652_10000082 3300025921 Bacteria 103057
240 Ga0207652_10000339 3300025921 Bacteria 48658
241 Ga0207652_10020202 3300025921 Bacteria 5483
242 Ga0207652_10294938 3300025921 Bacteria 1463
243 Ga0207694_10051317 3300025924 Bacteria 3197
244 Ga0207664_10000030 3300025929 Bacteria 179903
245 Ga0207690_10000122 3300025932 Bacteria 64448
246 Ga0207690_10044039 3300025932 Bacteria 2940
247 Ga0207690_10082044 3300025932 Bacteria 2254
248 Ga0207690_10155093 3300025932 Bacteria 1701
249 Ga0207706_10012323 3300025933 Bacteria 7788
250 Ga0207686_10001330 3300025934 Bacteria 14081
251 Ga0207704_10052761 3300025938 Unclassified 2466
252 Ga0207704_10060583 3300025938 Unclassified 2342
253 Ga0207691_10568751 3300025940 Bacteria 961
254 Ga0207711_10000300 3300025941 Bacteria 53102
255 Ga0207689_10019723 3300025942 Bacteria 5681
256 Ga0207661_10012498 3300025944 Bacteria 6169
257 Ga0207661_10042441 3300025944 Bacteria 3585
258 Ga0207661_10234133 3300025944 Bacteria 1627
259 Ga0207661_10530025 3300025944 Unclassified 1078
260 Ga0207679_10171390 3300025945 Bacteria 1787
261 Ga0207667_10000310 3300025949 Bacteria 67687
262 Ga0207667_10003803 3300025949 Bacteria 18572
263 Ga0207667_10009034 3300025949 Bacteria 11787
264 Ga0207667_10010439 3300025949 Bacteria 10853
265 Ga0207667_10017298 3300025949 Bacteria 8120
266 Ga0207667_10022369 3300025949 Bacteria 6987
267 Ga0207667_10025118 3300025949 Bacteria 6528
268 Ga0207667_10032730 3300025949 Bacteria 5597
269 Ga0207667_10144147 3300025949 Bacteria 2452
270 Ga0207667_10250078 3300025949 Unclassified 1813
271 Ga0207667_10599229 3300025949 Bacteria 1111
272 Ga0207712_10046925 3300025961 Bacteria 2997
273 Ga0207668_10033571 3300025972 Bacteria 3400
274 Ga0207640_10000068 3300025981 Bacteria 84422
275 Ga0207640_10037420 3300025981 Bacteria 3053
276 Ga0207640_10046257 3300025981 Bacteria 2799
277 Ga0207640_10117679 3300025981 Bacteria 1897
278 Ga0207658_10000289 3300025986 Bacteria 52614
279 Ga0207658_10748003 3300025986 Bacteria 885
280 Ga0207677_10134925 3300026023 Unclassified 1880
281 Ga0207639_10004110 3300026041 Bacteria 9812
282 Ga0207639_10004170 3300026041 Bacteria 9730
283 Ga0207639_10011650 3300026041 Bacteria 6111
284 Ga0207639_10025097 3300026041 Bacteria 4320
285 Ga0207639_10031547 3300026041 Bacteria 3895
286 Ga0207639_10040946 3300026041 Bacteria 3462
287 Ga0207678_10000886 3300026067 Bacteria 27527
288 Ga0207678_10009462 3300026067 Bacteria 8572
289 Ga0207678_10009669 3300026067 Bacteria 8481
290 Ga0207678_10014594 3300026067 Bacteria 6914
291 Ga0207678_10025483 3300026067 Bacteria 5162
292 Ga0207678_10316514 3300026067 Bacteria 1342
293 Ga0207702_10005080 3300026078 Bacteria 11561
294 Ga0207702_10150115 3300026078 Bacteria 2119
295 Ga0207702_10277804 3300026078 Bacteria 1582
296 Ga0207641_10050550 3300026088 Bacteria 3517
297 Ga0207641_10093058 3300026088 Bacteria 2641
298 Ga0207648_10029212 3300026089 Bacteria 4889
299 Ga0207674_10001405 3300026116 Bacteria 31074
300 Ga0207674_10036080 3300026116 Bacteria 5156
301 Ga0207674_10087208 3300026116 Bacteria 3115
302 Ga0207674_10090460 3300026116 Bacteria 3052
303 Ga0207674_10206511 3300026116 Bacteria 1913
304 Ga0207698_10001187 3300026142 Bacteria 15193
305 Ga0207698_10002461 3300026142 Bacteria 10979
306 Ga0207698_10144578 3300026142 Bacteria 2054
307 Ga0207698_10220011 3300026142 Bacteria 1715
308 Ga0207698_10244391 3300026142 Bacteria 1638
309 Ga0207698_10289829 3300026142 Unclassified 1518
310 Ga0207698_10403999 3300026142 Bacteria 1306
311 Ga0268266_10011433 3300028379 Bacteria 7720
312 Ga0268266_10073164 3300028379 Unclassified 2974
313 Ga0268266_10123182 3300028379 Bacteria 2309
314 Ga0268266_10237902 3300028379 Bacteria 1679
315 Ga0268265_10000054 3300028380 Bacteria 165504
316 Ga0268264_10239377 3300028381 Bacteria 1680
317 Ga0268264_10546776 3300028381 Bacteria 1135
318 Ga0395899_0023204 3300037312 Bacteria 4703
319 Ga0395900_0011530 3300037418 Bacteria 9047
320 Ga0395898_0027888 3300037466 Bacteria 5662
321 Ga0395898_0037918 3300037466 Bacteria 4778
322 Ga0395901_0037786 3300038443 Bacteria 4993
323 Ga0451791_1352661 3300041451 Bacteria 1880
324 Ga0451793_1599871 3300041452 Bacteria 5016
325 Ga0451795_1372122 3300041456 Bacteria 930
326 Ga0451802_0122820 3300041460 Bacteria 905
327 Ga0451802_0357610 3300041460 Bacteria 4967
328 Ga0451807_0385942 3300041486 Bacteria 5866
329 Ga0451833_0619325 3300041491 Unclassified 3587
330 Ga0451843_0599071 3300041509 Bacteria 1664
331 Ga0451853_1501317 3300041512 Bacteria 4709
332 Ga0451853_2978688 3300041512 Bacteria 4039
333 Ga0451853_3087106 3300041512 Bacteria 1424
334 Ga0439455_0094200 3300042012 Bacteria 823
335 Ga0451577_0047101 3300042876 Bacteria 3855
336 Ga0451577_0061413 3300042876 Bacteria 3351
337 Ga0466969_0015615 3300044656 Bacteria 3978
338 Ga0466972_0002522 3300044658 Bacteria 9056
339 Ga0466982_0000006 3300044672 Bacteria 333931
340 Ga0466965_0102393 3300044683 Bacteria 1465
341 Ga0466966_0000477 3300044684 Bacteria 25796
342 Ga0466963_0388014 3300044694 Bacteria 984
343 Ga0466971_0001620 3300044719 Bacteria 9502
344 Ga0466968_0004412 3300044735 Bacteria 5256
345 Ga0466970_0002639 3300044765 Bacteria 8646
346 Ga0466970_0022857 3300044765 Bacteria 3262
347 Ga0466957_0125277 3300044842 Bacteria 1641
348 Ga0466960_0031608 3300044901 Bacteria 2444
349 Ga0466959_0164309 3300045049 Bacteria 1559
350 Ga0451576_0000621 3300045051 Bacteria 74139
351 Ga0466958_0027954 3300045836 Bacteria 3341
352 Ga0495617_049488 3300046452 Bacteria 1398
353 Ga0495630_0032162 3300046517 Bacteria 3908
354 Ga0495666_0047048 3300046526 Bacteria 2078
355 Ga0495642_0000077 3300046528 Bacteria 57843
356 Ga0495654_0011412 3300046530 Bacteria 4809
357 Ga0495597_0000092 3300046542 Bacteria 79435
358 Ga0495670_0005461 3300046691 Bacteria 6240
359 Ga0495671_0007285 3300046692 Bacteria 6315
360 Ga0495671_0010746 3300046692 Bacteria 5060
361 Ga0495671_0018295 3300046692 Bacteria 3720
362 Ga0495649_0039369 3300046694 Bacteria 2592
363 Ga0495672_0001174 3300047320 Bacteria 26554
364 Ga0495672_0003612 3300047320 Bacteria 13117
365 Ga0495673_0000350 3300047469 Bacteria 57843
366 Ga0495673_0001784 3300047469 Bacteria 16340
367 Ga0495686_0001204 3300047472 Bacteria 29860
368 Ga0495626_0000119 3300048091 Bacteria 102920
369 Ga0496114_0014635 3300048917 Bacteria 6303
370 Ga0496114_0195130 3300048917 Bacteria 1772
371 Ga0496115_0028975 3300048918 Bacteria 4345
372 Ga0496118_0067228 3300048921 Bacteria 2611
373 Ga0496122_0000037 3300048925 Bacteria 304495
374 Ga0496122_0008995 3300048925 Bacteria 10614
375 Ga0496123_0000870 3300048926 Bacteria 48048
376 Ga0496125_0003359 3300048928 Bacteria 19489
377 Ga0496126_0062077 3300048929 Bacteria 3354
378 Ga0501031_0008999 3300049568 Bacteria 6497
379 Ga0501032_0001914 3300049569 Bacteria 16411
380 Ga0501032_0009729 3300049569 Bacteria 6958
381 Ga0501033_0000829 3300049570 Bacteria 28236
382 Ga0501033_0031029 3300049570 Bacteria 4017
383 Ga0501033_0192183 3300049570 Bacteria 1460
384 Ga0501034_0011901 3300049571 Bacteria 8999
385 Ga0501034_0015535 3300049571 Bacteria 7821
386 Ga0501034_0163331 3300049571 Bacteria 2197
387 Ga0501034_0391961 3300049571 Bacteria 1313
388 Ga0501036_0004321 3300049572 Bacteria 11472
389 Ga0501036_0007458 3300049572 Bacteria 8915
390 Ga0501037_0003610 3300049573 Bacteria 11216
391 Ga0501037_0003874 3300049573 Bacteria 10852
392 Ga0501037_0014384 3300049573 Bacteria 5825
393 Ga0501037_0015717 3300049573 Bacteria 5569
394 Ga0501038_0002541 3300049574 Bacteria 16998
395 Ga0501038_0002630 3300049574 Bacteria 16790
396 Ga0501038_0148311 3300049574 Bacteria 1914
397 Ga0501039_0010284 3300049575 Bacteria 7135
398 Ga0501039_0030151 3300049575 Bacteria 4181
399 Ga0501040_0121471 3300049576 Bacteria 1833
400 Ga0501042_0129339 3300049578 Bacteria 1819
401 Ga0501043_0007129 3300049579 Bacteria 8893
402 Ga0501043_0046759 3300049579 Bacteria 3403
403 Ga0501046_0002816 3300049580 Bacteria 16197
404 Ga0501046_0007359 3300049580 Bacteria 9683
405 Ga0501046_0057226 3300049580 Bacteria 3059
406 Ga0501047_0014016 3300049581 Bacteria 7618
407 Ga0501047_0020484 3300049581 Bacteria 6349
408 Ga0501047_0030256 3300049581 Bacteria 5220
409 Ga0501047_0359375 3300049581 Bacteria 1292
410 Ga0501047_0411093 3300049581 Bacteria 1185
411 Ga0501048_0035553 3300049582 Bacteria 3586
412 Ga0501067_0063993 3300049583 Bacteria 2037
413 Ga0501067_0124406 3300049583 Bacteria 1435
414 Ga0501068_0023707 3300049584 Bacteria 3598
415 Ga0501069_0000180 3300049585 Bacteria 28489
416 Ga0501069_0004452 3300049585 Bacteria 7236
417 Ga0501069_0025043 3300049585 Bacteria 3259
418 Ga0501069_0031113 3300049585 Bacteria 2934
419 Ga0501069_0073206 3300049585 Bacteria 1921
420 Ga0501070_0002090 3300049586 Bacteria 17529
421 Ga0501070_0008312 3300049586 Bacteria 8768
422 Ga0501070_0025998 3300049586 Bacteria 4911
423 Ga0501070_0027859 3300049586 Bacteria 4739
424 Ga0501070_0031575 3300049586 Bacteria 4437
425 Ga0501070_0047209 3300049586 Bacteria 3580
426 Ga0501070_0082220 3300049586 Bacteria 2665
427 Ga0501070_0092319 3300049586 Bacteria 2505
428 Ga0501070_0162717 3300049586 Bacteria 1839
429 Ga0501070_0347605 3300049586 Bacteria 1204
430 Ga0501070_0438158 3300049586 Bacteria 1054
431 Ga0501071_0029357 3300049587 Bacteria 3880
432 Ga0501071_0061905 3300049587 Bacteria 2711
433 Ga0501071_0090174 3300049587 Bacteria 2251
434 Ga0501073_0009080 3300049589 Bacteria 7337
435 Ga0501073_0013534 3300049589 Bacteria 5932
436 Ga0501073_0032228 3300049589 Bacteria 3737
437 Ga0501073_0032764 3300049589 Bacteria 3703
438 Ga0501073_0243898 3300049589 Bacteria 1240
439 Ga0501074_0006123 3300049590 Bacteria 8688
440 Ga0501074_0010164 3300049590 Bacteria 6832
441 Ga0501074_0013105 3300049590 Bacteria 6027
442 Ga0501074_0054566 3300049590 Bacteria 2881
443 Ga0501074_0235303 3300049590 Bacteria 1303
444 Ga0501074_0435251 3300049590 Bacteria 930
445 Ga0501074_0475541 3300049590 Bacteria 886
446 Ga0501076_0219266 3300049592 Bacteria 1555
447 Ga0501077_0012062 3300049593 Bacteria 5410
448 Ga0501079_0028545 3300049741 Bacteria 4282
449 Ga0501079_0324259 3300049741 Bacteria 1206
450 Ga0501079_0524442 3300049741 Bacteria 931
451 Ga0501080_0023759 3300049742 Bacteria 5680
452 Ga0501080_0045535 3300049742 Bacteria 4084
453 Ga0501080_0064379 3300049742 Bacteria 3410
454 Ga0501080_0071929 3300049742 Bacteria 3217
455 Ga0501080_0103940 3300049742 Bacteria 2634
456 Ga0501080_0216626 3300049742 Bacteria 1753
457 Ga0501080_0234682 3300049742 Bacteria 1676
458 Ga0501083_0341975 3300049744 Bacteria 973
459 Ga0501035_0005799 3300049822 Bacteria 11641
460 Ga0501035_0012950 3300049822 Bacteria 7698
461 Ga0501035_0020050 3300049822 Bacteria 6141
462 Ga0501035_0022587 3300049822 Bacteria 5778
463 Ga0501035_0087590 3300049822 Bacteria 2744
464 Ga0501035_0102127 3300049822 Bacteria 2516
465 Ga0501035_0188965 3300049822 Bacteria 1771
466 Ga0501035_0201891 3300049822 Bacteria 1704
467 Ga0501044_0005848 3300049823 Bacteria 13622
468 Ga0501044_0018874 3300049823 Bacteria 7384
469 Ga0501044_0024076 3300049823 Bacteria 6469
470 Ga0501044_0048251 3300049823 Bacteria 4399
471 Ga0501044_0072132 3300049823 Bacteria 3511
472 Ga0501044_0087987 3300049823 Bacteria 3136
473 Ga0501044_0089728 3300049823 Bacteria 3102
474 Ga0501044_0219516 3300049823 Bacteria 1852
475 Ga0501044_0366520 3300049823 Bacteria 1358
476 Ga0500643_001211 3300053087 Bacteria 15404
477 Ga0500651_0042925 3300053093 Bacteria 2849
478 Ga0500597_000073 3300053120 Bacteria 20548
479 Ga0500628_014365 3300053129 Bacteria 1494
480 Ga0500620_002893 3300053155 Bacteria 3569
481 Ga0501084_0042898 3300054114 Bacteria 3784
482 Ga0501084_0330278 3300054114 Bacteria 1288
483 Ga0501082_0373708 3300060353 Bacteria 1243
484 Ga0466962_0002158 3300061719 Bacteria 9295
485 2511328499 2511231016 Bacteria 6704427
486 2538424968 2537561728 Bacteria 5149301
487 2624479871 2623620443 Bacteria 6427864
488 2643828576 2643221562 Bacteria 4048635
489 2871275175 2871272651 Bacteria 5042015
490 2871285123 2871282230 Bacteria 4917173
491 2895397946 2895395659 Bacteria 3983269
492 2939613646 2939611941 Bacteria 3892017
493 8002393381 8002392321 Bacteria 4159911
494 Ga0501070_0021254
495 JGI24741J21665_1000615
496 JGI24741J21665_1004217
497 JGI24741J21665_1009412
498 JGI24740J21852_10000222
499 JGI24740J21852_10006910
500 rootL2_10060175
501 Ga0070658_10082438
502 Ga0070658_10323857
503 Ga0070658_10368364
504 Ga0070658_11023469
505 Ga0070683_100053356
506 Ga0070666_10157802
507 Ga0070680_100000301
508 Ga0070680_100008519
509 Ga0070680_100073429
510 Ga0070680_100474520
511 Ga0070682_100001936
512 Ga0070682_100075285
513 Ga0070682_100276918
514 Ga0070660_100013635
515 Ga0070660_100015985
516 Ga0070660_100016246
517 Ga0070660_100066523
518 Ga0070691_10000178
519 Ga0070691_10026631
520 Ga0070661_100029733
521 Ga0070661_100049910
522 Ga0070661_100057445
523 Ga0070692_10004465
524 Ga0070692_10010903
525 Ga0070692_10012765
526 Ga0070692_10014928
527 Ga0070668_100033077
528 Ga0070668_100203127
529 Ga0070671_100113579
530 Ga0070673_100295936
531 Ga0070659_100012411
532 Ga0070667_100000040
533 Ga0070667_100065297
534 Ga0070667_100102301
535 Ga0070714_100000311
536 Ga0070694_100069129
537 Ga0070694_100518293
538 Ga0070663_100000152
539 Ga0070663_100007949
540 Ga0070663_100231100
541 Ga0070663_100294704
542 Ga0070663_100413167
543 Ga0070662_100900483
544 Ga0070681_10000015
545 Ga0070681_10000062
546 Ga0070681_10000088
547 Ga0070681_10043510
548 Ga0070681_10438928
549 Ga0070679_100000061
550 Ga0070679_100000188
551 Ga0070679_100029155
552 Ga0070679_100543516
553 Ga0070684_100089705
554 Ga0070684_100195562
555 Ga0068853_100000897
556 Ga0068853_100004247
557 Ga0068853_100012119
558 Ga0068853_100016747
559 Ga0068853_100042220
560 Ga0068853_100241284
561 Ga0068853_100272304
562 Ga0070696_100000213
563 Ga0070696_100041487
564 Ga0070693_100001310
565 Ga0070693_100007118
566 Ga0070665_100015064
567 Ga0070665_100047560
568 Ga0070665_100071462
569 Ga0068855_100003252
570 Ga0068855_100003760
571 Ga0068855_100017314
572 Ga0068855_100095903
573 Ga0068855_100127132
574 Ga0068855_100338848
575 Ga0068855_100540530
576 Ga0070664_100010265
577 Ga0068857_100012518
578 Ga0068857_100028820
579 Ga0068857_100108119
580 Ga0068854_100001352
581 Ga0068854_100019485
582 Ga0068854_100063971
583 Ga0068854_100116105
584 Ga0068854_100424328
585 Ga0068856_100018258
586 Ga0068856_100107584
587 Ga0068856_100166290
588 Ga0068856_100380636
589 Ga0068856_100909253
590 Ga0068852_100012685
591 Ga0068852_100062840
592 Ga0068852_100198781
593 Ga0068852_100223068
594 Ga0068859_100000979
595 Ga0068859_100773775
596 Ga0068851_10011316
597 Ga0068851_10147779
598 Ga0068851_10152801
599 Ga0068863_100044420
600 Ga0068863_100372586
601 Ga0068858_100297926
602 Ga0068858_100464023
603 Ga0068858_100496493
604 Ga0068860_100072217
605 Ga0068862_100000224
606 Ga0097621_100050721
607 Ga0097621_100473045
608 Ga0097620_100000979
609 Ga0097620_100773825
610 Ga0105240_10026029
611 Ga0105240_10031009
612 Ga0105240_10107714
613 Ga0105240_10124734
614 Ga0105240_10251999
615 Ga0105247_10220829
616 Ga0105243_10492351
617 Ga0105241_10042730
618 Ga0105241_10140516
619 Ga0105241_10144740
620 Ga0105241_10185116
621 Ga0105241_10266966
622 Ga0105248_10005513
623 Ga0105248_10134512
624 Ga0105237_10001863
625 Ga0105237_10074209
626 Ga0105237_10267037
627 Ga0105237_10573998
628 Ga0105238_10013703
629 Ga0105238_10022214
630 Ga0105249_10000193
631 Ga0105249_10022676
632 Ga0105239_10005286
633 Ga0105239_10039059
634 Ga0105239_10075807
635 Ga0105239_10383296
636 Ga0105239_10805383
637 Ga0157373_10036715
638 Ga0157373_10060193
639 Ga0157373_10094224
640 Ga0157371_10020103
641 Ga0157371_10020463
642 Ga0157371_10137229
643 Ga0157371_10416621
644 Ga0157370_10012911
645 Ga0157370_10068309
646 Ga0157370_10074695
647 Ga0157370_10135940
648 Ga0157370_10800439
649 Ga0157369_10087774
650 Ga0157369_10146436
651 Ga0157369_10228972
652 Ga0157369_10241982
653 Ga0157374_10178371
654 Ga0157372_10010645
655 Ga0157372_10052909
656 Ga0157372_10116984
657 Ga0157372_10167359
658 Ga0157372_10272940
659 Ga0157375_10083021
660 Ga0157379_10107009
661 Ga0157379_10114850
662 Ga0157376_10207632
663 Ga0157376_10365276
664 Ga0157376_10521714
665 Ga0182006_1013713
666 Ga0197907_10094875
667 Ga0206356_10143582
668 Ga0206356_10647139
669 Ga0206356_11433262
670 Ga0206351_10166290
671 Ga0206352_10430462
672 Ga0206352_10438213
673 Ga0206350_10220779
674 Ga0206350_10233428
675 Ga0206354_10039073
676 Ga0206354_10072506
677 Ga0206354_10107429
678 Ga0206354_10287451
679 Ga0206353_10251616
680 Ga0206353_10516896
681 Ga0206353_10819831
682 Ga0154015_1153483
683 Ga0154015_1494868
684 Ga0209026_1003406
685 Ga0209051_1022830
686 Ga0207656_10027123
687 Ga0207656_10039032
688 Ga0207656_10121485
689 Ga0207692_10273968
690 Ga0207680_10038056
691 Ga0207647_10000197
692 Ga0207647_10006761
693 Ga0207647_10008395
694 Ga0207645_10069130
695 Ga0207705_10000097
696 Ga0207705_10001380
697 Ga0207705_10017993
698 Ga0207705_10080378
699 Ga0207705_10129337
700 Ga0207654_10269960
701 Ga0207707_10000065
702 Ga0207707_10000084
703 Ga0207707_10000144
704 Ga0207707_10000161
705 Ga0207707_10000949
706 Ga0207707_10002991
707 Ga0207707_10017928
708 Ga0207695_10000820
709 Ga0207695_10003204
710 Ga0207695_10008721
711 Ga0207695_10011037
712 Ga0207695_10060774
713 Ga0207695_10180949
714 Ga0207671_10004436
715 Ga0207671_10129322
716 Ga0207671_10273158
717 Ga0207671_10482396
718 Ga0207660_10000368
719 Ga0207660_10000561
720 Ga0207660_10004075
721 Ga0207660_10004119
722 Ga0207657_10001354
723 Ga0207657_10011996
724 Ga0207657_10012298
725 Ga0207657_10023702
726 Ga0207657_10024718
727 Ga0207649_10013832
728 Ga0207649_10133707
729 Ga0207649_10135327
730 Ga0207649_10530492
731 Ga0207652_10000076
732 Ga0207652_10000082
733 Ga0207652_10000339
734 Ga0207652_10020202
735 Ga0207652_10294938
736 Ga0207694_10051317
737 Ga0207664_10000030
738 Ga0207690_10000122
739 Ga0207690_10044039
740 Ga0207690_10082044
741 Ga0207690_10155093
742 Ga0207706_10012323
743 Ga0207686_10001330
744 Ga0207704_10052761
745 Ga0207704_10060583
746 Ga0207691_10568751
747 Ga0207711_10000300
748 Ga0207689_10019723
749 Ga0207661_10012498
750 Ga0207661_10042441
751 Ga0207661_10234133
752 Ga0207661_10530025
753 Ga0207679_10171390
754 Ga0207667_10000310
755 Ga0207667_10003803
756 Ga0207667_10009034
757 Ga0207667_10010439
758 Ga0207667_10017298
759 Ga0207667_10022369
760 Ga0207667_10025118
761 Ga0207667_10032730
762 Ga0207667_10144147
763 Ga0207667_10250078
764 Ga0207667_10599229
765 Ga0207712_10046925
766 Ga0207668_10033571
767 Ga0207640_10000068
768 Ga0207640_10037420
769 Ga0207640_10046257
770 Ga0207640_10117679
771 Ga0207658_10000289
772 Ga0207658_10748003
773 Ga0207677_10134925
774 Ga0207639_10004110
775 Ga0207639_10004170
776 Ga0207639_10011650
777 Ga0207639_10025097
778 Ga0207639_10031547
779 Ga0207639_10040946
780 Ga0207678_10000886
781 Ga0207678_10009462
782 Ga0207678_10009669
783 Ga0207678_10014594
784 Ga0207678_10025483
785 Ga0207678_10316514
786 Ga0207702_10005080
787 Ga0207702_10150115
788 Ga0207702_10277804
789 Ga0207641_10050550
790 Ga0207641_10093058
791 Ga0207648_10029212
792 Ga0207674_10001405
793 Ga0207674_10036080
794 Ga0207674_10087208
795 Ga0207674_10090460
796 Ga0207674_10206511
797 Ga0207698_10001187
798 Ga0207698_10002461
799 Ga0207698_10144578
800 Ga0207698_10220011
801 Ga0207698_10244391
802 Ga0207698_10289829
803 Ga0207698_10403999
804 Ga0268266_10011433
805 Ga0268266_10073164
806 Ga0268266_10123182
807 Ga0268266_10237902
808 Ga0268265_10000054
809 Ga0268264_10239377
810 Ga0268264_10546776
811 Ga0395899_0023204
812 Ga0395900_0011530
813 Ga0395898_0027888
814 Ga0395898_0037918
815 Ga0395901_0037786
816 Ga0451791_1352661
817 Ga0451793_1599871
818 Ga0451795_1372122
819 Ga0451802_0122820
820 Ga0451802_0357610
821 Ga0451807_0385942
822 Ga0451833_0619325
823 Ga0451843_0599071
824 Ga0451853_1501317
825 Ga0451853_2978688
826 Ga0451853_3087106
827 Ga0439455_0094200
828 Ga0451577_0047101
829 Ga0451577_0061413
830 Ga0466969_0015615
831 Ga0466972_0002522
832 Ga0466982_0000006
833 Ga0466965_0102393
834 Ga0466966_0000477
835 Ga0466963_0388014
836 Ga0466971_0001620
837 Ga0466968_0004412
838 Ga0466970_0002639
839 Ga0466970_0022857
840 Ga0466957_0125277
841 Ga0466960_0031608
842 Ga0466959_0164309
843 Ga0451576_0000621
844 Ga0466958_0027954
845 Ga0495617_049488
846 Ga0495630_0032162
847 Ga0495666_0047048
848 Ga0495642_0000077
849 Ga0495654_0011412
850 Ga0495597_0000092
851 Ga0495670_0005461
852 Ga0495671_0007285
853 Ga0495671_0010746
854 Ga0495671_0018295
855 Ga0495649_0039369
856 Ga0495672_0001174
857 Ga0495672_0003612
858 Ga0495673_0000350
859 Ga0495673_0001784
860 Ga0495686_0001204
861 Ga0495626_0000119
862 Ga0496114_0014635
863 Ga0496114_0195130
864 Ga0496115_0028975
865 Ga0496118_0067228
866 Ga0496122_0000037
867 Ga0496122_0008995
868 Ga0496123_0000870
869 Ga0496125_0003359
870 Ga0496126_0062077
871 Ga0501031_0008999
872 Ga0501032_0001914
873 Ga0501032_0009729
874 Ga0501033_0000829
875 Ga0501033_0031029
876 Ga0501033_0192183
877 Ga0501034_0011901
878 Ga0501034_0015535
879 Ga0501034_0163331
880 Ga0501034_0391961
881 Ga0501036_0004321
882 Ga0501036_0007458
883 Ga0501037_0003610
884 Ga0501037_0003874
885 Ga0501037_0014384
886 Ga0501037_0015717
887 Ga0501038_0002541
888 Ga0501038_0002630
889 Ga0501038_0148311
890 Ga0501039_0010284
891 Ga0501039_0030151
892 Ga0501040_0121471
893 Ga0501042_0129339
894 Ga0501043_0007129
895 Ga0501043_0046759
896 Ga0501046_0002816
897 Ga0501046_0007359
898 Ga0501046_0057226
899 Ga0501047_0014016
900 Ga0501047_0020484
901 Ga0501047_0030256
902 Ga0501047_0359375
903 Ga0501047_0411093
904 Ga0501048_0035553
905 Ga0501067_0063993
906 Ga0501067_0124406
907 Ga0501068_0023707
908 Ga0501069_0000180
909 Ga0501069_0004452
910 Ga0501069_0025043
911 Ga0501069_0031113
912 Ga0501069_0073206
913 Ga0501070_0002090
914 Ga0501070_0008312
915 Ga0501070_0025998
916 Ga0501070_0027859
917 Ga0501070_0031575
918 Ga0501070_0047209
919 Ga0501070_0082220
920 Ga0501070_0092319
921 Ga0501070_0162717
922 Ga0501070_0347605
923 Ga0501070_0438158
924 Ga0501071_0029357
925 Ga0501071_0061905
926 Ga0501071_0090174
927 Ga0501073_0009080
928 Ga0501073_0013534
929 Ga0501073_0032228
930 Ga0501073_0032764
931 Ga0501073_0243898
932 Ga0501074_0006123
933 Ga0501074_0010164
934 Ga0501074_0013105
935 Ga0501074_0054566
936 Ga0501074_0235303
937 Ga0501074_0435251
938 Ga0501074_0475541
939 Ga0501076_0219266
940 Ga0501077_0012062
941 Ga0501079_0028545
942 Ga0501079_0324259
943 Ga0501079_0524442
944 Ga0501080_0023759
945 Ga0501080_0045535
946 Ga0501080_0064379
947 Ga0501080_0071929
948 Ga0501080_0103940
949 Ga0501080_0216626
950 Ga0501080_0234682
951 Ga0501083_0341975
952 Ga0501035_0005799
953 Ga0501035_0012950
954 Ga0501035_0020050
955 Ga0501035_0022587
956 Ga0501035_0087590
957 Ga0501035_0102127
958 Ga0501035_0188965
959 Ga0501035_0201891
960 Ga0501044_0005848
961 Ga0501044_0018874
962 Ga0501044_0024076
963 Ga0501044_0048251
964 Ga0501044_0072132
965 Ga0501044_0087987
966 Ga0501044_0089728
967 Ga0501044_0219516
968 Ga0501044_0366520
969 Ga0500643_001211
970 Ga0500651_0042925
971 Ga0500597_000073
972 Ga0500628_014365
973 Ga0500620_002893
974 Ga0501084_0042898
975 Ga0501084_0330278
976 Ga0501082_0373708
977 Ga0466962_0002158
978 2511328499
979 2538424968
980 2624479871
981 2643828576
982 2871275175
983 2871285123
984 2895397946
985 2939613646
986 8002393381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

55

244

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8989 2 203
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.8983 2 203
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.8914 2 203
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8827 2 203
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.8801 2 203
ID Description Score Start End Superfamily
af_Q9M042_1_161_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9032 2 200 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8882 2 203 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8878 1 200 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.882 2 203 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8712 1 200 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A370WZA2-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9906 1 206
AF-A0A410UK98-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9888 1 206
AF-A0A354Z851-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9884 71 207
AF-A0A7X7SQ68-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9874 1 208
AF-A0A2S7D3Q3-F1-model_v4 Phosphatidylethanolamine-binding protein 0.9874 1 208

Map