F454522

General Info

Members Datasets Scaffolds Average Seq Length
494 221 988 177

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100501804|Ga0070683_1005018042
Length 205
Sequence MFELAIVGLFGILAFHNTKVHDDEFLGASRKIGDRMGKLWDIAHQGMRENRLLRAEKALLTILKIDERNAAAYNRLGILYAKQKEYRDAIDCFEIASSIVAYAKVHEKLGNEKQMFQSLEKAVELEHNKETLTLLHKAYLDRGMQAEADMLEQHLKKLIVPSGKPKRMVRPAKRVVVAARRLRNHNLRMGLDLALSQQSMVLKYP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
74 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
140 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
208 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
209 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
212 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
213 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
216 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
217 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
220 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
221 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.43
Nodule 0
Rhizoplane 0.81
Rhizosphere 77.94
Stem 0
Stem Tuber 0
Unclassified 6.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100501804 3300005329 Bacteria 1159
2 JGI24741J21665_1001188 3300001915 Bacteria 7689
3 JGI24741J21665_1006400 3300001915 Bacteria 2366
4 JGI24740J21852_10014450 3300001979 Bacteria 2911
5 JGI24737J22298_10000185 3300001990 Bacteria 20041
6 JGI24735J21928_10000234 3300002067 Bacteria 19508
7 JGI24742J22300_10000015 3300002244 Bacteria 27133
8 rootH2_10000244 3300003320 Bacteria 697651
9 rootH2_10113915 3300003320 Bacteria 2894
10 rootH2_10214305 3300003320 Bacteria 1320
11 rootL2_10093349 3300003322 Bacteria 5743
12 rootL2_10119730 3300003322 Bacteria 1114
13 rootH1_10284225 3300003323 Bacteria 1579
14 rootH1_10321069 3300003323 Bacteria 2582
15 Ga0065704_10155142 3300005289 Bacteria 1397
16 Ga0070658_10000012 3300005327 Bacteria 277871
17 Ga0070658_10000015 3300005327 Bacteria 230579
18 Ga0070658_10001050 3300005327 Bacteria 23600
19 Ga0070658_10037065 3300005327 Bacteria 3930
20 Ga0070676_10000882 3300005328 Bacteria 14791
21 Ga0070676_10010097 3300005328 Bacteria 5115
22 Ga0070683_100000450 3300005329 Bacteria 28685
23 Ga0070683_100000530 3300005329 Bacteria 26876
24 Ga0070683_101117099 3300005329 Bacteria 757
25 Ga0070680_100071423 3300005336 Bacteria 2852
26 Ga0070680_100232791 3300005336 Bacteria 1556
27 Ga0070682_100000552 3300005337 Bacteria 23228
28 Ga0070682_100068886 3300005337 Bacteria 2258
29 Ga0070682_100275095 3300005337 Bacteria 1225
30 Ga0070660_100000176 3300005339 Bacteria 42222
31 Ga0070660_100000333 3300005339 Bacteria 31211
32 Ga0070660_100099799 3300005339 Unclassified 2299
33 Ga0070660_100409928 3300005339 Bacteria 1121
34 Ga0070691_10042593 3300005341 Bacteria 2149
35 Ga0070668_100026689 3300005347 Bacteria 4384
36 Ga0070671_100000001 3300005355 Bacteria 1228151
37 Ga0070671_100037266 3300005355 Bacteria 4032
38 Ga0070671_100230574 3300005355 Unclassified 1571
39 Ga0070674_100034149 3300005356 Bacteria 3394
40 Ga0070673_100047762 3300005364 Bacteria 3333
41 Ga0070688_100327045 3300005365 Bacteria 1116
42 Ga0070659_100000215 3300005366 Bacteria 44375
43 Ga0070659_100181171 3300005366 Bacteria 1729
44 Ga0070667_100000001 3300005367 Bacteria 1108638
45 Ga0070667_100005574 3300005367 Bacteria 10507
46 Ga0070667_100151543 3300005367 Bacteria 2037
47 Ga0070714_100000778 3300005435 Bacteria 22615
48 Ga0070713_100040616 3300005436 Bacteria 3783
49 Ga0070681_10004770 3300005458 Bacteria 12991
50 Ga0070681_10050052 3300005458 Bacteria 4170
51 Ga0070681_10138098 3300005458 Bacteria 2367
52 Ga0068867_100004725 3300005459 Bacteria 9584
53 Ga0068867_100200507 3300005459 Unclassified 1597
54 Ga0070685_10000188 3300005466 Bacteria 41401
55 Ga0070685_10014246 3300005466 Bacteria 4207
56 Ga0070679_100008696 3300005530 Bacteria 9571
57 Ga0070679_100017637 3300005530 Bacteria 6910
58 Ga0070679_100031269 3300005530 Bacteria 5257
59 Ga0070679_100032597 3300005530 Bacteria 5155
60 Ga0070679_100084466 3300005530 Bacteria 3163
61 Ga0070679_100184764 3300005530 Bacteria 2056
62 Ga0070679_100256220 3300005530 Bacteria 1705
63 Ga0070684_100001742 3300005535 Bacteria 15835
64 Ga0070684_100003346 3300005535 Bacteria 12008
65 Ga0070684_100410568 3300005535 Bacteria 1249
66 Ga0068853_100008264 3300005539 Bacteria 8353
67 Ga0068853_100123355 3300005539 Bacteria 2313
68 Ga0070672_100009435 3300005543 Bacteria 6726
69 Ga0070686_100001511 3300005544 Bacteria 13078
70 Ga0070693_100459765 3300005547 Unclassified 895
71 Ga0070665_100161219 3300005548 Bacteria 2245
72 Ga0068855_100000003 3300005563 Bacteria 589862
73 Ga0068855_100000168 3300005563 Bacteria 83242
74 Ga0068855_100011906 3300005563 Bacteria 10518
75 Ga0068855_100012043 3300005563 Bacteria 10456
76 Ga0068855_100033612 3300005563 Bacteria 6118
77 Ga0068855_100107772 3300005563 Bacteria 3201
78 Ga0068855_100246702 3300005563 Bacteria 1993
79 Ga0068855_100468052 3300005563 Bacteria 1373
80 Ga0068855_100920505 3300005563 Bacteria 923
81 Ga0068857_100000124 3300005577 Bacteria 46368
82 Ga0068857_100534058 3300005577 Bacteria 1103
83 Ga0068857_100680780 3300005577 Bacteria 976
84 Ga0068857_100716774 3300005577 Bacteria 951
85 Ga0068856_100000001 3300005614 Bacteria 565602
86 Ga0068856_100001486 3300005614 Bacteria 24509
87 Ga0068856_100001797 3300005614 Bacteria 22390
88 Ga0068856_100163461 3300005614 Bacteria 2237
89 Ga0068856_100679559 3300005614 Bacteria 1050
90 Ga0068856_101246932 3300005614 Unclassified 759
91 Ga0068859_100503974 3300005617 Unclassified 1306
92 Ga0068859_101050491 3300005617 Bacteria 895
93 Ga0068864_101294601 3300005618 Bacteria 729
94 Ga0068861_100176777 3300005719 Bacteria 1773
95 Ga0068863_100181958 3300005841 Bacteria 2018
96 Ga0068863_100783608 3300005841 Bacteria 950
97 Ga0068858_100027723 3300005842 Bacteria 5263
98 Ga0068860_100019817 3300005843 Bacteria 6522
99 Ga0068860_100024444 3300005843 Bacteria 5837
100 Ga0068862_100602205 3300005844 Bacteria 1055
101 Ga0081455_10000003 3300005937 Bacteria 367763
102 Ga0081539_10001876 3300005985 Bacteria 32944
103 Ga0081539_10091021 3300005985 Unclassified 1576
104 Ga0081539_10094162 3300005985 Unclassified 1541
105 Ga0075365_10008886 3300006038 Bacteria 5734
106 Ga0075365_10024125 3300006038 Bacteria 3833
107 Ga0075365_10172961 3300006038 Unclassified 1508
108 Ga0075368_10000084 3300006042 Bacteria 23187
109 Ga0075368_10065567 3300006042 Unclassified 1459
110 Ga0075363_100000006 3300006048 Bacteria 47292
111 Ga0075363_100027265 3300006048 Bacteria 2927
112 Ga0075363_100340222 3300006048 Bacteria 875
113 Ga0075364_10001729 3300006051 Bacteria 12015
114 Ga0075364_10047520 3300006051 Bacteria 2796
115 Ga0075364_10224810 3300006051 Bacteria 1274
116 Ga0075432_10174275 3300006058 Bacteria 838
117 Ga0075362_10000049 3300006177 Bacteria 39227
118 Ga0075367_10000014 3300006178 Bacteria 37444
119 Ga0075367_10000021 3300006178 Bacteria 33969
120 Ga0075367_10013718 3300006178 Bacteria 4367
121 Ga0075369_10000003 3300006186 Bacteria 205269
122 Ga0075369_10000057 3300006186 Bacteria 28832
123 Ga0075369_10271458 3300006186 Unclassified 789
124 Ga0075366_10000001 3300006195 Bacteria 569172
125 Ga0075366_10000065 3300006195 Bacteria 39633
126 Ga0075366_10000328 3300006195 Bacteria 21743
127 Ga0075366_10003857 3300006195 Bacteria 7986
128 Ga0075366_10026508 3300006195 Bacteria 3396
129 Ga0097621_100001442 3300006237 Bacteria 16323
130 Ga0097621_100256367 3300006237 Bacteria 1533
131 Ga0075370_10016950 3300006353 Bacteria 3929
132 Ga0075370_10020872 3300006353 Bacteria 3585
133 Ga0068871_100000039 3300006358 Bacteria 69204
134 Ga0075428_100079130 3300006844 Bacteria 3588
135 Ga0075430_100029985 3300006846 Bacteria 4619
136 Ga0097620_100503997 3300006931 Unclassified 1306
137 Ga0097620_101050473 3300006931 Bacteria 895
138 Ga0105240_10000003 3300009093 Bacteria 1183681
139 Ga0105240_10005815 3300009093 Bacteria 18300
140 Ga0105240_10030540 3300009093 Bacteria 7002
141 Ga0105240_11410233 3300009093 Bacteria 732
142 Ga0111539_10010927 3300009094 Bacteria 11427
143 Ga0105245_10000001 3300009098 Bacteria 939270
144 Ga0105245_10000002 3300009098 Bacteria 634374
145 Ga0105245_10000050 3300009098 Bacteria 128014
146 Ga0105245_10090078 3300009098 Bacteria 2821
147 Ga0105245_10090608 3300009098 Bacteria 2813
148 Ga0105245_10144651 3300009098 Unclassified 2242
149 Ga0105245_10681895 3300009098 Bacteria 1060
150 Ga0105247_10094466 3300009101 Bacteria 1902
151 Ga0105247_10450690 3300009101 Bacteria 928
152 Ga0105243_10000001 3300009148 Bacteria 1156578
153 Ga0105243_10005438 3300009148 Bacteria 9938
154 Ga0105241_10000003 3300009174 Bacteria 839043
155 Ga0105241_10000102 3300009174 Bacteria 62230
156 Ga0105242_10000011 3300009176 Bacteria 149791
157 Ga0105242_10045459 3300009176 Bacteria 3559
158 Ga0105242_10101085 3300009176 Bacteria 2443
159 Ga0105242_10124320 3300009176 Bacteria 2219
160 Ga0105242_10180905 3300009176 Bacteria 1860
161 Ga0105248_10146982 3300009177 Bacteria 2660
162 Ga0105248_10431702 3300009177 Unclassified 1484
163 Ga0105248_10817026 3300009177 Bacteria 1052
164 Ga0105237_10063347 3300009545 Bacteria 3695
165 Ga0105237_10237771 3300009545 Bacteria 1823
166 Ga0105237_10429893 3300009545 Bacteria 1326
167 Ga0105238_10001974 3300009551 Bacteria 20667
168 Ga0105238_10041760 3300009551 Bacteria 4645
169 Ga0105238_10175481 3300009551 Bacteria 2120
170 Ga0105238_10530371 3300009551 Bacteria 1180
171 Ga0105238_10789710 3300009551 Bacteria 965
172 Ga0105033_100875 3300009986 Bacteria 2366
173 Ga0105028_100114 3300009993 Bacteria 8330
174 Ga0105239_10007973 3300010375 Bacteria 12097
175 Ga0105239_10014629 3300010375 Bacteria 8702
176 Ga0105239_10034305 3300010375 Bacteria 5572
177 Ga0105239_10089477 3300010375 Bacteria 3395
178 Ga0105239_10566030 3300010375 Bacteria 1295
179 Ga0105246_10742442 3300011119 Bacteria 865
180 Ga0157373_10000351 3300013100 Bacteria 37083
181 Ga0157373_10024817 3300013100 Bacteria 4339
182 Ga0157371_10000176 3300013102 Bacteria 93047
183 Ga0157370_10047737 3300013104 Bacteria 4103
184 Ga0157370_10349464 3300013104 Bacteria 1363
185 Ga0157369_10006673 3300013105 Bacteria 13332
186 Ga0157369_10144177 3300013105 Bacteria 2518
187 Ga0157369_10408593 3300013105 Bacteria 1408
188 Ga0157369_10864423 3300013105 Bacteria 928
189 Ga0157374_10000031 3300013296 Bacteria 204840
190 Ga0157374_10000115 3300013296 Bacteria 73739
191 Ga0157374_10001076 3300013296 Bacteria 23646
192 Ga0157374_10002651 3300013296 Bacteria 15074
193 Ga0157374_10040136 3300013296 Bacteria 4309
194 Ga0157378_10008523 3300013297 Bacteria 8924
195 Ga0157378_10876700 3300013297 Unclassified 927
196 Ga0163162_10027062 3300013306 Bacteria 5671
197 Ga0157372_10000670 3300013307 Bacteria 37704
198 Ga0157372_10066791 3300013307 Bacteria 4041
199 Ga0157372_10645479 3300013307 Bacteria 1233
200 Ga0157372_10999532 3300013307 Bacteria 969
201 Ga0163163_10010765 3300014325 Bacteria 8251
202 Ga0163163_10036801 3300014325 Bacteria 4756
203 Ga0157380_10319994 3300014326 Bacteria 1438
204 Ga0157377_10001723 3300014745 Bacteria 9535
205 Ga0157377_10008731 3300014745 Bacteria 4952
206 Ga0157379_10054160 3300014968 Bacteria 3585
207 Ga0157376_10000001 3300014969 Bacteria 842910
208 Ga0207645_10000476 3300025907 Bacteria 33063
209 Ga0207645_10005988 3300025907 Bacteria 8752
210 Ga0207705_10000011 3300025909 Bacteria 517768
211 Ga0207705_10000038 3300025909 Bacteria 193812
212 Ga0207705_10038379 3300025909 Bacteria 3429
213 Ga0207705_10099049 3300025909 Bacteria 2143
214 Ga0207654_10000002 3300025911 Bacteria 1460142
215 Ga0207707_10004217 3300025912 Bacteria 12723
216 Ga0207707_10084457 3300025912 Bacteria 2773
217 Ga0207707_10615201 3300025912 Bacteria 918
218 Ga0207695_10000005 3300025913 Bacteria 1196715
219 Ga0207695_10006811 3300025913 Bacteria 14729
220 Ga0207695_10629115 3300025913 Bacteria 954
221 Ga0207671_10186456 3300025914 Bacteria 1616
222 Ga0207660_10029433 3300025917 Bacteria 3767
223 Ga0207660_10146884 3300025917 Bacteria 1808
224 Ga0207662_10289365 3300025918 Bacteria 1086
225 Ga0207657_10000804 3300025919 Bacteria 33189
226 Ga0207657_10004485 3300025919 Bacteria 14756
227 Ga0207657_10368677 3300025919 Bacteria 1131
228 Ga0207657_10442534 3300025919 Bacteria 1020
229 Ga0207652_10008932 3300025921 Bacteria 8075
230 Ga0207652_10037066 3300025921 Bacteria 4126
231 Ga0207652_10041132 3300025921 Bacteria 3927
232 Ga0207652_10064053 3300025921 Bacteria 3181
233 Ga0207652_10078500 3300025921 Bacteria 2883
234 Ga0207652_10153877 3300025921 Bacteria 2060
235 Ga0207652_10346876 3300025921 Bacteria 1340
236 Ga0207652_10454269 3300025921 Bacteria 1155
237 Ga0207694_10005473 3300025924 Bacteria 9758
238 Ga0207694_10045113 3300025924 Unclassified 3404
239 Ga0207694_10415660 3300025924 Bacteria 1120
240 Ga0207687_10000001 3300025927 Bacteria 1130810
241 Ga0207687_10000030 3300025927 Bacteria 155548
242 Ga0207687_10000324 3300025927 Bacteria 32503
243 Ga0207687_10033871 3300025927 Bacteria 3466
244 Ga0207687_10155023 3300025927 Unclassified 1751
245 Ga0207687_10678015 3300025927 Unclassified 873
246 Ga0207700_10062964 3300025928 Unclassified 2819
247 Ga0207664_10000295 3300025929 Bacteria 37239
248 Ga0207644_10000001 3300025931 Bacteria 1243214
249 Ga0207644_10064082 3300025931 Bacteria 2670
250 Ga0207690_10005984 3300025932 Bacteria 7209
251 Ga0207690_10359045 3300025932 Bacteria 1154
252 Ga0207686_10000001 3300025934 Bacteria 1169580
253 Ga0207686_10012616 3300025934 Bacteria 4650
254 Ga0207686_10109499 3300025934 Bacteria 1860
255 Ga0207709_10000002 3300025935 Bacteria 1171536
256 Ga0207669_10018236 3300025937 Bacteria 3622
257 Ga0207691_10020500 3300025940 Bacteria 6250
258 Ga0207661_10000021 3300025944 Bacteria 205381
259 Ga0207661_10003681 3300025944 Bacteria 10682
260 Ga0207661_10508352 3300025944 Bacteria 1101
261 Ga0207667_10000008 3300025949 Bacteria 625138
262 Ga0207667_10000339 3300025949 Bacteria 64087
263 Ga0207667_10001896 3300025949 Bacteria 26256
264 Ga0207667_10014149 3300025949 Bacteria 9107
265 Ga0207667_10086914 3300025949 Bacteria 3235
266 Ga0207667_10154176 3300025949 Bacteria 2364
267 Ga0207667_10296893 3300025949 Bacteria 1651
268 Ga0207667_10411718 3300025949 Bacteria 1376
269 Ga0207651_10036080 3300025960 Bacteria 3223
270 Ga0207712_10093145 3300025961 Bacteria 2223
271 Ga0207640_10233359 3300025981 Bacteria 1417
272 Ga0207658_10000003 3300025986 Bacteria 1151934
273 Ga0207658_10013268 3300025986 Bacteria 5627
274 Ga0207658_10123346 3300025986 Bacteria 2069
275 Ga0207703_10043569 3300026035 Bacteria 3603
276 Ga0207639_10090032 3300026041 Bacteria 2453
277 Ga0207702_10000001 3300026078 Bacteria 895738
278 Ga0207702_10001013 3300026078 Bacteria 28866
279 Ga0207702_10001268 3300026078 Bacteria 25374
280 Ga0207702_10078232 3300026078 Bacteria 2863
281 Ga0207641_10165562 3300026088 Bacteria 2013
282 Ga0207648_10038887 3300026089 Bacteria 4185
283 Ga0207674_10000001 3300026116 Bacteria 616581
284 Ga0207674_10005495 3300026116 Bacteria 15048
285 Ga0207674_10715090 3300026116 Bacteria 967
286 Ga0207675_100371456 3300026118 Bacteria 1405
287 Ga0209998_10005862 3300027717 Bacteria 2556
288 Ga0209813_10000009 3300027866 Bacteria 102315
289 Ga0207428_10105819 3300027907 Bacteria 2169
290 Ga0207428_10687388 3300027907 Bacteria 732
291 Ga0268266_10001018 3300028379 Bacteria 35297
292 Ga0268266_10072437 3300028379 Bacteria 2988
293 Ga0268266_10176036 3300028379 Bacteria 1945
294 Ga0268265_10417748 3300028380 Bacteria 1244
295 Ga0268264_10015129 3300028381 Bacteria 6328
296 Ga0268264_10026011 3300028381 Bacteria 4779
297 Ga0265337_1000001 3300028556 Bacteria 140973
298 Ga0265337_1000227 3300028556 Bacteria 30136
299 Ga0265337_1000244 3300028556 Bacteria 29586
300 Ga0265337_1011945 3300028556 Bacteria 2972
301 Ga0265337_1045952 3300028556 Unclassified 1241
302 Ga0265326_10001303 3300028558 Bacteria 8851
303 Ga0265326_10002354 3300028558 Bacteria 6383
304 Ga0265326_10004330 3300028558 Bacteria 4557
305 Ga0265326_10005562 3300028558 Bacteria 3968
306 Ga0265326_10052295 3300028558 Bacteria 1156
307 Ga0265319_1003037 3300028563 Bacteria 8897
308 Ga0265319_1006533 3300028563 Bacteria 5386
309 Ga0265334_10000114 3300028573 Bacteria 52821
310 Ga0265334_10007615 3300028573 Bacteria 4640
311 Ga0265334_10024662 3300028573 Bacteria 2437
312 Ga0265334_10035358 3300028573 Bacteria 1978
313 Ga0265334_10036982 3300028573 Bacteria 1926
314 Ga0265318_10012683 3300028577 Bacteria 3577
315 Ga0265318_10038983 3300028577 Bacteria 1815
316 Ga0265323_10006102 3300028653 Bacteria 5085
317 Ga0265322_10001067 3300028654 Bacteria 9503
318 Ga0265322_10002979 3300028654 Bacteria 5152
319 Ga0265336_10001619 3300028666 Bacteria 10032
320 Ga0265336_10001710 3300028666 Bacteria 9655
321 Ga0265336_10004675 3300028666 Bacteria 5138
322 Ga0265336_10005246 3300028666 Bacteria 4802
323 Ga0265338_10000052 3300028800 Bacteria 209239
324 Ga0265338_10000054 3300028800 Bacteria 207383
325 Ga0265338_10000130 3300028800 Bacteria 137739
326 Ga0265338_10000178 3300028800 Bacteria 118345
327 Ga0265338_10000217 3300028800 Bacteria 106453
328 Ga0265338_10000366 3300028800 Bacteria 81024
329 Ga0265338_10000543 3300028800 Bacteria 66162
330 Ga0265338_10001885 3300028800 Bacteria 32838
331 Ga0265338_10002761 3300028800 Bacteria 25703
332 Ga0265338_10004179 3300028800 Bacteria 19701
333 Ga0265338_10008051 3300028800 Bacteria 12892
334 Ga0265338_10008859 3300028800 Bacteria 12132
335 Ga0265338_10009726 3300028800 Bacteria 11405
336 Ga0265338_10014018 3300028800 Bacteria 8979
337 Ga0265338_10023254 3300028800 Bacteria 6379
338 Ga0265338_10137349 3300028800 Bacteria 1920
339 Ga0265338_10165530 3300028800 Bacteria 1702
340 Ga0265338_10177640 3300028800 Bacteria 1626
341 Ga0265338_10240718 3300028800 Unclassified 1340
342 Ga0265324_10007303 3300029957 Bacteria 4497
343 Ga0265324_10027338 3300029957 Bacteria 2015
344 Ga0265324_10027904 3300029957 Bacteria 1992
345 Ga0265324_10050228 3300029957 Unclassified 1433
346 Ga0265324_10070602 3300029957 Bacteria 1190
347 Ga0314311_1124955 3300030733 Bacteria 1393
348 Ga0316179_1039616 3300030734 Bacteria 993
349 Ga0265330_10015478 3300031235 Bacteria 3528
350 Ga0265332_10006168 3300031238 Bacteria 5465
351 Ga0265328_10001186 3300031239 Bacteria 12058
352 Ga0265320_10021484 3300031240 Bacteria 3469
353 Ga0265320_10033803 3300031240 Archaea 2608
354 Ga0265325_10051757 3300031241 Bacteria 2110
355 Ga0265329_10002548 3300031242 Bacteria 8224
356 Ga0265340_10000533 3300031247 Bacteria 21017
357 Ga0265340_10003085 3300031247 Bacteria 9459
358 Ga0265339_10012639 3300031249 Bacteria 5143
359 Ga0265339_10147770 3300031249 Bacteria 1191
360 Ga0265339_10172300 3300031249 Bacteria 1082
361 Ga0265339_10281735 3300031249 Unclassified 796
362 Ga0265331_10088401 3300031250 Unclassified 1433
363 Ga0265327_10000017 3300031251 Bacteria 445264
364 Ga0265327_10003601 3300031251 Bacteria 14609
365 Ga0265327_10048169 3300031251 Bacteria 2243
366 Ga0265327_10088684 3300031251 Bacteria 1512
367 Ga0265316_10093550 3300031344 Bacteria 2290
368 Ga0265316_10116696 3300031344 Bacteria 2018
369 Ga0265316_10196779 3300031344 Bacteria 1495
370 Ga0265316_10324432 3300031344 Bacteria 1118
371 Ga0265313_10005077 3300031595 Bacteria 9805
372 Ga0265313_10027131 3300031595 Bacteria 3004
373 Ga0265313_10096886 3300031595 Unclassified 1315
374 Ga0395899_0060550 3300037312 Bacteria 2789
375 Ga0395900_0005264 3300037418 Bacteria 13568
376 Ga0395900_0013904 3300037418 Bacteria 8213
377 Ga0395900_0024724 3300037418 Bacteria 6148
378 Ga0395900_0135595 3300037418 Bacteria 2522
379 Ga0395900_0210321 3300037418 Bacteria 1964
380 Ga0395900_0691981 3300037418 Bacteria 953
381 Ga0395900_0803736 3300037418 Unclassified 868
382 Ga0395898_0026341 3300037466 Bacteria 5853
383 Ga0395898_0032580 3300037466 Bacteria 5203
384 Ga0395905_0002458 3300037471 Bacteria 20515
385 Ga0395905_0054570 3300037471 Bacteria 3739
386 Ga0395905_0236115 3300037471 Bacteria 1709
387 Ga0395901_0001243 3300038443 Bacteria 27219
388 Ga0395901_0011912 3300038443 Bacteria 8818
389 Ga0395901_0025642 3300038443 Bacteria 6052
390 Ga0395901_0034662 3300038443 Bacteria 5214
391 Ga0395901_0244531 3300038443 Bacteria 1870
392 Ga0451807_0568926 3300041486 Bacteria 1900
393 Ga0451807_1609328 3300041486 Bacteria 1568
394 Ga0466960_0165873 3300044901 Bacteria 1189
395 Ga0466967_0788336 3300045976 Bacteria 943
396 Ga0495629_0127134 3300046459 Bacteria 1776
397 Ga0495583_0023272 3300046506 Bacteria 3138
398 Ga0495587_0266336 3300046536 Unclassified 962
399 Ga0495622_0000035 3300046557 Bacteria 122963
400 Ga0495588_0000116 3300046674 Bacteria 135919
401 Ga0495658_0003943 3300046683 Bacteria 7324
402 Ga0495670_0290995 3300046691 Unclassified 874
403 Ga0495649_0000182 3300046694 Bacteria 54760
404 Ga0495600_0018152 3300046809 Bacteria 4479
405 Ga0495672_0000016 3300047320 Bacteria 500601
406 Ga0495672_0184998 3300047320 Bacteria 1052
407 Ga0496100_0031806 3300048903 Bacteria 3284
408 Ga0496104_0171917 3300048907 Bacteria 2078
409 Ga0496126_0052098 3300048929 Bacteria 3722
410 Ga0496126_0206683 3300048929 Bacteria 1655
411 Ga0501034_0031918 3300049571 Bacteria 5351
412 Ga0501034_0147875 3300049571 Bacteria 2326
413 Ga0501036_0078057 3300049572 Bacteria 2801
414 Ga0501046_0081082 3300049580 Bacteria 2506
415 Ga0501047_0002015 3300049581 Bacteria 19485
416 Ga0501048_0085046 3300049582 Bacteria 2231
417 Ga0501080_0001402 3300049742 Bacteria 20194
418 Ga0501083_0021836 3300049744 Bacteria 4446
419 Ga0501083_0067142 3300049744 Bacteria 2388
420 Ga0501083_0116968 3300049744 Bacteria 1750
421 Ga0501035_0001229 3300049822 Bacteria 26660
422 Ga0501044_0205545 3300049823 Bacteria 1926
423 nmdc:mga03683_66_c2 3300050489 Bacteria 39227
424 nmdc:mga03n38_19_c1 3300050490 Bacteria 41192
425 nmdc:mga03n38_51064_c1 3300050490 Bacteria 1845
426 nmdc:mga00v17_132785_c1 3300050491 Bacteria 1592
427 nmdc:mga00v17_29277_c1 3300050491 Unclassified 3231
428 nmdc:mga00v17_3209_c1 3300050491 Bacteria 8427
429 nmdc:mga00v17_520172_c1 3300050491 Bacteria 771
430 nmdc:mga0yw44_13879_c1 3300050492 Bacteria 4257
431 nmdc:mga0yw44_152448_c1 3300050492 Unclassified 1508
432 nmdc:mga0yw44_171079_c1 3300050492 Bacteria 1426
433 nmdc:mga0yw44_234101_c1 3300050492 Bacteria 1219
434 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
435 nmdc:mga0k408_14_c3 3300050493 Bacteria 36052
436 nmdc:mga0k408_173896_c1 3300050493 Bacteria 1284
437 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
438 nmdc:mga0k408_34_c1 3300050493 Bacteria 65613
439 nmdc:mga0k408_3681_c1 3300050493 Bacteria 8115
440 nmdc:mga0k408_76453_c1 3300050493 Bacteria 1957
441 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
442 nmdc:mga06z11_16368_c1 3300050494 Bacteria 3338
443 nmdc:mga06z11_53_c2 3300050494 Bacteria 47411
444 nmdc:mga04h51_10_c1 3300050495 Bacteria 102434
445 nmdc:mga04h51_18703_c1 3300050495 Unclassified 2044
446 nmdc:mga07m45_38190_c1 3300050496 Unclassified 2679
447 nmdc:mga0qj67_24820_c1 3300050509 Bacteria 4625
448 nmdc:mga08y16_7379_c1 3300050511 Bacteria 11522
449 nmdc:mga0sz30_168180_c1 3300050516 Unclassified 972
450 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
451 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
452 Ga0500610_0000001 3300053079 Bacteria 185468
453 Ga0500610_0054682 3300053079 Bacteria 2082
454 Ga0500610_0294417 3300053079 Bacteria 720
455 Ga0500643_000010 3300053087 Bacteria 408084
456 Ga0500643_000011 3300053087 Bacteria 385630
457 Ga0500643_000038 3300053087 Bacteria 178974
458 Ga0500643_009866 3300053087 Bacteria 3610
459 Ga0500644_0000199 3300053088 Bacteria 36622
460 Ga0500644_0000281 3300053088 Bacteria 28221
461 Ga0500644_0001096 3300053088 Bacteria 7988
462 Ga0500644_0030547 3300053088 Bacteria 1706
463 Ga0500646_0000426 3300053090 Bacteria 12557
464 Ga0500583_0000067 3300053092 Bacteria 64775
465 Ga0500583_0003044 3300053092 Bacteria 5183
466 Ga0500583_0103354 3300053092 Bacteria 1398
467 Ga0500651_0000416 3300053093 Bacteria 22899
468 Ga0500651_0002377 3300053093 Bacteria 9906
469 Ga0500566_0000001 3300053094 Bacteria 1101031
470 Ga0500650_0000001 3300053098 Bacteria 818797
471 Ga0500555_000001 3300053103 Bacteria 1353713
472 Ga0500555_000002 3300053103 Bacteria 1314346
473 Ga0500556_0000246 3300053104 Bacteria 43933
474 Ga0500562_000002 3300053108 Bacteria 977234
475 Ga0500562_013841 3300053108 Bacteria 2063
476 Ga0500562_047339 3300053108 Bacteria 1147
477 Ga0500593_000001 3300053117 Bacteria 784404
478 Ga0500594_0000001 3300053118 Bacteria 1178472
479 Ga0500614_000001 3300053123 Bacteria 1274484
480 Ga0500614_000411 3300053123 Bacteria 11177
481 Ga0500621_094898 3300053126 Bacteria 1183
482 Ga0500628_000006 3300053129 Bacteria 154858
483 Ga0500642_0070078 3300053130 Bacteria 1593
484 Ga0500652_000054 3300053131 Bacteria 52348
485 Ga0500655_000374 3300053133 Bacteria 9718
486 Ga0500561_0000001 3300053137 Bacteria 957685
487 Ga0500577_0020650 3300053142 Bacteria 2158
488 Ga0500579_001169 3300053143 Bacteria 15311
489 Ga0500589_000008 3300053147 Bacteria 137145
490 Ga0500603_010587 3300053150 Bacteria 2085
491 Ga0500616_0000005 3300053153 Bacteria 961725
492 Ga0500649_000014 3300053722 Bacteria 56198
493 Ga0500570_000045 3300053724 Bacteria 31120
494 Ga0500611_002701 3300053727 Bacteria 2164
495 Ga0070683_100501804
496 JGI24741J21665_1001188
497 JGI24741J21665_1006400
498 JGI24740J21852_10014450
499 JGI24737J22298_10000185
500 JGI24735J21928_10000234
501 JGI24742J22300_10000015
502 rootH2_10000244
503 rootH2_10113915
504 rootH2_10214305
505 rootL2_10093349
506 rootL2_10119730
507 rootH1_10284225
508 rootH1_10321069
509 Ga0065704_10155142
510 Ga0070658_10000012
511 Ga0070658_10000015
512 Ga0070658_10001050
513 Ga0070658_10037065
514 Ga0070676_10000882
515 Ga0070676_10010097
516 Ga0070683_100000450
517 Ga0070683_100000530
518 Ga0070683_101117099
519 Ga0070680_100071423
520 Ga0070680_100232791
521 Ga0070682_100000552
522 Ga0070682_100068886
523 Ga0070682_100275095
524 Ga0070660_100000176
525 Ga0070660_100000333
526 Ga0070660_100099799
527 Ga0070660_100409928
528 Ga0070691_10042593
529 Ga0070668_100026689
530 Ga0070671_100000001
531 Ga0070671_100037266
532 Ga0070671_100230574
533 Ga0070674_100034149
534 Ga0070673_100047762
535 Ga0070688_100327045
536 Ga0070659_100000215
537 Ga0070659_100181171
538 Ga0070667_100000001
539 Ga0070667_100005574
540 Ga0070667_100151543
541 Ga0070714_100000778
542 Ga0070713_100040616
543 Ga0070681_10004770
544 Ga0070681_10050052
545 Ga0070681_10138098
546 Ga0068867_100004725
547 Ga0068867_100200507
548 Ga0070685_10000188
549 Ga0070685_10014246
550 Ga0070679_100008696
551 Ga0070679_100017637
552 Ga0070679_100031269
553 Ga0070679_100032597
554 Ga0070679_100084466
555 Ga0070679_100184764
556 Ga0070679_100256220
557 Ga0070684_100001742
558 Ga0070684_100003346
559 Ga0070684_100410568
560 Ga0068853_100008264
561 Ga0068853_100123355
562 Ga0070672_100009435
563 Ga0070686_100001511
564 Ga0070693_100459765
565 Ga0070665_100161219
566 Ga0068855_100000003
567 Ga0068855_100000168
568 Ga0068855_100011906
569 Ga0068855_100012043
570 Ga0068855_100033612
571 Ga0068855_100107772
572 Ga0068855_100246702
573 Ga0068855_100468052
574 Ga0068855_100920505
575 Ga0068857_100000124
576 Ga0068857_100534058
577 Ga0068857_100680780
578 Ga0068857_100716774
579 Ga0068856_100000001
580 Ga0068856_100001486
581 Ga0068856_100001797
582 Ga0068856_100163461
583 Ga0068856_100679559
584 Ga0068856_101246932
585 Ga0068859_100503974
586 Ga0068859_101050491
587 Ga0068864_101294601
588 Ga0068861_100176777
589 Ga0068863_100181958
590 Ga0068863_100783608
591 Ga0068858_100027723
592 Ga0068860_100019817
593 Ga0068860_100024444
594 Ga0068862_100602205
595 Ga0081455_10000003
596 Ga0081539_10001876
597 Ga0081539_10091021
598 Ga0081539_10094162
599 Ga0075365_10008886
600 Ga0075365_10024125
601 Ga0075365_10172961
602 Ga0075368_10000084
603 Ga0075368_10065567
604 Ga0075363_100000006
605 Ga0075363_100027265
606 Ga0075363_100340222
607 Ga0075364_10001729
608 Ga0075364_10047520
609 Ga0075364_10224810
610 Ga0075432_10174275
611 Ga0075362_10000049
612 Ga0075367_10000014
613 Ga0075367_10000021
614 Ga0075367_10013718
615 Ga0075369_10000003
616 Ga0075369_10000057
617 Ga0075369_10271458
618 Ga0075366_10000001
619 Ga0075366_10000065
620 Ga0075366_10000328
621 Ga0075366_10003857
622 Ga0075366_10026508
623 Ga0097621_100001442
624 Ga0097621_100256367
625 Ga0075370_10016950
626 Ga0075370_10020872
627 Ga0068871_100000039
628 Ga0075428_100079130
629 Ga0075430_100029985
630 Ga0097620_100503997
631 Ga0097620_101050473
632 Ga0105240_10000003
633 Ga0105240_10005815
634 Ga0105240_10030540
635 Ga0105240_11410233
636 Ga0111539_10010927
637 Ga0105245_10000001
638 Ga0105245_10000002
639 Ga0105245_10000050
640 Ga0105245_10090078
641 Ga0105245_10090608
642 Ga0105245_10144651
643 Ga0105245_10681895
644 Ga0105247_10094466
645 Ga0105247_10450690
646 Ga0105243_10000001
647 Ga0105243_10005438
648 Ga0105241_10000003
649 Ga0105241_10000102
650 Ga0105242_10000011
651 Ga0105242_10045459
652 Ga0105242_10101085
653 Ga0105242_10124320
654 Ga0105242_10180905
655 Ga0105248_10146982
656 Ga0105248_10431702
657 Ga0105248_10817026
658 Ga0105237_10063347
659 Ga0105237_10237771
660 Ga0105237_10429893
661 Ga0105238_10001974
662 Ga0105238_10041760
663 Ga0105238_10175481
664 Ga0105238_10530371
665 Ga0105238_10789710
666 Ga0105033_100875
667 Ga0105028_100114
668 Ga0105239_10007973
669 Ga0105239_10014629
670 Ga0105239_10034305
671 Ga0105239_10089477
672 Ga0105239_10566030
673 Ga0105246_10742442
674 Ga0157373_10000351
675 Ga0157373_10024817
676 Ga0157371_10000176
677 Ga0157370_10047737
678 Ga0157370_10349464
679 Ga0157369_10006673
680 Ga0157369_10144177
681 Ga0157369_10408593
682 Ga0157369_10864423
683 Ga0157374_10000031
684 Ga0157374_10000115
685 Ga0157374_10001076
686 Ga0157374_10002651
687 Ga0157374_10040136
688 Ga0157378_10008523
689 Ga0157378_10876700
690 Ga0163162_10027062
691 Ga0157372_10000670
692 Ga0157372_10066791
693 Ga0157372_10645479
694 Ga0157372_10999532
695 Ga0163163_10010765
696 Ga0163163_10036801
697 Ga0157380_10319994
698 Ga0157377_10001723
699 Ga0157377_10008731
700 Ga0157379_10054160
701 Ga0157376_10000001
702 Ga0207645_10000476
703 Ga0207645_10005988
704 Ga0207705_10000011
705 Ga0207705_10000038
706 Ga0207705_10038379
707 Ga0207705_10099049
708 Ga0207654_10000002
709 Ga0207707_10004217
710 Ga0207707_10084457
711 Ga0207707_10615201
712 Ga0207695_10000005
713 Ga0207695_10006811
714 Ga0207695_10629115
715 Ga0207671_10186456
716 Ga0207660_10029433
717 Ga0207660_10146884
718 Ga0207662_10289365
719 Ga0207657_10000804
720 Ga0207657_10004485
721 Ga0207657_10368677
722 Ga0207657_10442534
723 Ga0207652_10008932
724 Ga0207652_10037066
725 Ga0207652_10041132
726 Ga0207652_10064053
727 Ga0207652_10078500
728 Ga0207652_10153877
729 Ga0207652_10346876
730 Ga0207652_10454269
731 Ga0207694_10005473
732 Ga0207694_10045113
733 Ga0207694_10415660
734 Ga0207687_10000001
735 Ga0207687_10000030
736 Ga0207687_10000324
737 Ga0207687_10033871
738 Ga0207687_10155023
739 Ga0207687_10678015
740 Ga0207700_10062964
741 Ga0207664_10000295
742 Ga0207644_10000001
743 Ga0207644_10064082
744 Ga0207690_10005984
745 Ga0207690_10359045
746 Ga0207686_10000001
747 Ga0207686_10012616
748 Ga0207686_10109499
749 Ga0207709_10000002
750 Ga0207669_10018236
751 Ga0207691_10020500
752 Ga0207661_10000021
753 Ga0207661_10003681
754 Ga0207661_10508352
755 Ga0207667_10000008
756 Ga0207667_10000339
757 Ga0207667_10001896
758 Ga0207667_10014149
759 Ga0207667_10086914
760 Ga0207667_10154176
761 Ga0207667_10296893
762 Ga0207667_10411718
763 Ga0207651_10036080
764 Ga0207712_10093145
765 Ga0207640_10233359
766 Ga0207658_10000003
767 Ga0207658_10013268
768 Ga0207658_10123346
769 Ga0207703_10043569
770 Ga0207639_10090032
771 Ga0207702_10000001
772 Ga0207702_10001013
773 Ga0207702_10001268
774 Ga0207702_10078232
775 Ga0207641_10165562
776 Ga0207648_10038887
777 Ga0207674_10000001
778 Ga0207674_10005495
779 Ga0207674_10715090
780 Ga0207675_100371456
781 Ga0209998_10005862
782 Ga0209813_10000009
783 Ga0207428_10105819
784 Ga0207428_10687388
785 Ga0268266_10001018
786 Ga0268266_10072437
787 Ga0268266_10176036
788 Ga0268265_10417748
789 Ga0268264_10015129
790 Ga0268264_10026011
791 Ga0265337_1000001
792 Ga0265337_1000227
793 Ga0265337_1000244
794 Ga0265337_1011945
795 Ga0265337_1045952
796 Ga0265326_10001303
797 Ga0265326_10002354
798 Ga0265326_10004330
799 Ga0265326_10005562
800 Ga0265326_10052295
801 Ga0265319_1003037
802 Ga0265319_1006533
803 Ga0265334_10000114
804 Ga0265334_10007615
805 Ga0265334_10024662
806 Ga0265334_10035358
807 Ga0265334_10036982
808 Ga0265318_10012683
809 Ga0265318_10038983
810 Ga0265323_10006102
811 Ga0265322_10001067
812 Ga0265322_10002979
813 Ga0265336_10001619
814 Ga0265336_10001710
815 Ga0265336_10004675
816 Ga0265336_10005246
817 Ga0265338_10000052
818 Ga0265338_10000054
819 Ga0265338_10000130
820 Ga0265338_10000178
821 Ga0265338_10000217
822 Ga0265338_10000366
823 Ga0265338_10000543
824 Ga0265338_10001885
825 Ga0265338_10002761
826 Ga0265338_10004179
827 Ga0265338_10008051
828 Ga0265338_10008859
829 Ga0265338_10009726
830 Ga0265338_10014018
831 Ga0265338_10023254
832 Ga0265338_10137349
833 Ga0265338_10165530
834 Ga0265338_10177640
835 Ga0265338_10240718
836 Ga0265324_10007303
837 Ga0265324_10027338
838 Ga0265324_10027904
839 Ga0265324_10050228
840 Ga0265324_10070602
841 Ga0314311_1124955
842 Ga0316179_1039616
843 Ga0265330_10015478
844 Ga0265332_10006168
845 Ga0265328_10001186
846 Ga0265320_10021484
847 Ga0265320_10033803
848 Ga0265325_10051757
849 Ga0265329_10002548
850 Ga0265340_10000533
851 Ga0265340_10003085
852 Ga0265339_10012639
853 Ga0265339_10147770
854 Ga0265339_10172300
855 Ga0265339_10281735
856 Ga0265331_10088401
857 Ga0265327_10000017
858 Ga0265327_10003601
859 Ga0265327_10048169
860 Ga0265327_10088684
861 Ga0265316_10093550
862 Ga0265316_10116696
863 Ga0265316_10196779
864 Ga0265316_10324432
865 Ga0265313_10005077
866 Ga0265313_10027131
867 Ga0265313_10096886
868 Ga0395899_0060550
869 Ga0395900_0005264
870 Ga0395900_0013904
871 Ga0395900_0024724
872 Ga0395900_0135595
873 Ga0395900_0210321
874 Ga0395900_0691981
875 Ga0395900_0803736
876 Ga0395898_0026341
877 Ga0395898_0032580
878 Ga0395905_0002458
879 Ga0395905_0054570
880 Ga0395905_0236115
881 Ga0395901_0001243
882 Ga0395901_0011912
883 Ga0395901_0025642
884 Ga0395901_0034662
885 Ga0395901_0244531
886 Ga0451807_0568926
887 Ga0451807_1609328
888 Ga0466960_0165873
889 Ga0466967_0788336
890 Ga0495629_0127134
891 Ga0495583_0023272
892 Ga0495587_0266336
893 Ga0495622_0000035
894 Ga0495588_0000116
895 Ga0495658_0003943
896 Ga0495670_0290995
897 Ga0495649_0000182
898 Ga0495600_0018152
899 Ga0495672_0000016
900 Ga0495672_0184998
901 Ga0496100_0031806
902 Ga0496104_0171917
903 Ga0496126_0052098
904 Ga0496126_0206683
905 Ga0501034_0031918
906 Ga0501034_0147875
907 Ga0501036_0078057
908 Ga0501046_0081082
909 Ga0501047_0002015
910 Ga0501048_0085046
911 Ga0501080_0001402
912 Ga0501083_0021836
913 Ga0501083_0067142
914 Ga0501083_0116968
915 Ga0501035_0001229
916 Ga0501044_0205545
917 nmdc:mga03683_66_c2
918 nmdc:mga03n38_19_c1
919 nmdc:mga03n38_51064_c1
920 nmdc:mga00v17_132785_c1
921 nmdc:mga00v17_29277_c1
922 nmdc:mga00v17_3209_c1
923 nmdc:mga00v17_520172_c1
924 nmdc:mga0yw44_13879_c1
925 nmdc:mga0yw44_152448_c1
926 nmdc:mga0yw44_171079_c1
927 nmdc:mga0yw44_234101_c1
928 nmdc:mga0yw44_2_c1
929 nmdc:mga0k408_14_c3
930 nmdc:mga0k408_173896_c1
931 nmdc:mga0k408_1_c1
932 nmdc:mga0k408_34_c1
933 nmdc:mga0k408_3681_c1
934 nmdc:mga0k408_76453_c1
935 nmdc:mga06z11_14_c1
936 nmdc:mga06z11_16368_c1
937 nmdc:mga06z11_53_c2
938 nmdc:mga04h51_10_c1
939 nmdc:mga04h51_18703_c1
940 nmdc:mga07m45_38190_c1
941 nmdc:mga0qj67_24820_c1
942 nmdc:mga08y16_7379_c1
943 nmdc:mga0sz30_168180_c1
944 nmdc:mga0sz30_1_c1
945 nmdc:mga0sz30_8_c1
946 Ga0500610_0000001
947 Ga0500610_0054682
948 Ga0500610_0294417
949 Ga0500643_000010
950 Ga0500643_000011
951 Ga0500643_000038
952 Ga0500643_009866
953 Ga0500644_0000199
954 Ga0500644_0000281
955 Ga0500644_0001096
956 Ga0500644_0030547
957 Ga0500646_0000426
958 Ga0500583_0000067
959 Ga0500583_0003044
960 Ga0500583_0103354
961 Ga0500651_0000416
962 Ga0500651_0002377
963 Ga0500566_0000001
964 Ga0500650_0000001
965 Ga0500555_000001
966 Ga0500555_000002
967 Ga0500556_0000246
968 Ga0500562_000002
969 Ga0500562_013841
970 Ga0500562_047339
971 Ga0500593_000001
972 Ga0500594_0000001
973 Ga0500614_000001
974 Ga0500614_000411
975 Ga0500621_094898
976 Ga0500628_000006
977 Ga0500642_0070078
978 Ga0500652_000054
979 Ga0500655_000374
980 Ga0500561_0000001
981 Ga0500577_0020650
982 Ga0500579_001169
983 Ga0500589_000008
984 Ga0500603_010587
985 Ga0500616_0000005
986 Ga0500649_000014
987 Ga0500570_000045
988 Ga0500611_002701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00515

TPR_1

Tetratricopeptide repeat

70

99

0.94

PF13181

TPR_8

Tetratricopeptide repeat

70

99

0.93

PF13181

TPR_8

Tetratricopeptide repeat

96

128

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kcl-assembly1.cif.gz_A solution nmr structure of tetratricopeptide repeat domain protein sru_0103 from salinibacter ruber, northeast structural genomics consortium (nesg) target srr115c 0.8774 100 153
7pqh-assembly1.cif.gz_K cryo-em structure of saccharomyces cerevisiae toroid (torc1 organized in inhibited domains). 0.8538 99 153
3qou-assembly1.cif.gz_A crystal structure of e. coli ybbn 0.8256 99 153
3esk-assembly1.cif.gz_A structure of hop tpr2a domain in complex with the non-cognate hsc70 peptide ligand 0.8 99 155
3qdn-assembly1.cif.gz_A putative thioredoxin protein from salmonella typhimurium 0.7993 99 160
ID Description Score Start End Superfamily
af_Q9VVU6_600_680_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9053 99 154 1.25.40.10
af_A0A1D6N4S9_1_156_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9011 99 151 1.25.40.10
af_A0A1D6MXR6_618_705_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8983 99 156 1.25.40.10
af_K7TYH4_612_702_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8977 99 156 1.25.40.10
af_Q8VD72_227_326_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8944 99 154 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0D1BPA0-F1-model_v4 Uncharacterized protein 0.8904 99 162
AF-A0A2D0N0L5-F1-model_v4 Uncharacterized protein 0.8774 99 155
AF-A0A7Z9XL99-F1-model_v4 Tetratricopeptide repeat protein 0.8513 95 156
AF-A0A0K1Q656-F1-model_v4 PEGA domain-containing protein 0.843 98 168 GO:0016020
AF-A0A7S1BCF9-F1-model_v4 Serine/threonine-protein kinase mTOR domain-containing protein 0.839 95 154 GO:0004674
GO:0005634
GO:0005737
GO:0016242
GO:0031929
GO:0031931
GO:0031932

Map