metagRoot

F454539

General Info

Members	Datasets	Scaffolds	Average Seq Length
494	283	481	333

Family's Representative Sequence

Representative Sequence	3300005535\|Ga0070684_100173299\|Ga0070684_1001732991
Length	382
Sequence	MNSQSPCALAEDFVWFRGPPDMLNIMAVGGRGRHARVDCALLARVLRVPPVQPQPILAPLTPAAIFLVLTVDDGGEATVHDALQDVSGLVRGIGFREPQKRLSAITSIGSDAWDRLFSGPRPAELHRFVELNGPRHHAPATPGDLLFHVRAESLDVCFELADRILKSMDGAVTVVDEVHGFRYFDNRDLLGFVDGTENPDGPLAVGATAIGDEDPDFAGSCYVHVQKYLHDMSSWNSISVTEQERVIGRTKLEDIELDDDVKPDDSHIALNVITDDGTELKIVRHNMPFGELGRREYGTYFIGYSRTPQVTEQMLRNMFLGDPPGNTDRILDFSTAVTGGLFFSPTVDFLDDPPPLPTAPVAETSVAQDGSLSIGSLKGTTS

Samples

	Sample ID	Description	Type	Environment
1	2622736605	Geodermatophilus ruber DSM 45317	Isolate	Rhizosphere
2	2643221578	Streptomyces sp. Root63	Isolate	Unclassified
3	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
4	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
5	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
6	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
7	2842888712	Tsukamurella sp. R-71941	Isolate	Unclassified
8	2875391855	Streptomyces cavourensis 1AS2a	Isolate	Rhizosphere
9	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
10	2915358134	Pseudonocardia pini CAP47R	Isolate	Unclassified
11	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
12	2946045630	Streptomyces sp. W4I9-2	Isolate	Rhizosphere
13	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
14	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
15	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
16	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
17	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
18	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
19	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
20	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
21	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
24	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
25	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
26	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
27	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
28	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
29	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
30	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
31	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
32	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
33	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
34	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
35	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
36	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
37	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
38	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
39	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
40	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
41	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
42	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
43	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
44	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
45	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
46	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
47	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
48	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
49	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
53	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
54	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
57	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
58	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
59	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
67	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
68	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
69	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
70	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
71	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
72	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
73	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
74	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
75	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
76	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
77	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
79	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
81	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
82	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
84	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
85	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
86	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
87	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
88	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
89	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
90	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
91	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
92	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
93	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
94	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
95	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
96	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
97	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
98	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
102	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
103	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
104	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
105	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
106	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
154	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
158	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
159	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
160	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
161	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
162	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
163	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
164	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
165	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
166	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
167	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
168	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
169	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
170	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
171	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
172	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
173	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
174	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
175	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
176	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
177	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
178	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
179	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
180	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
181	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
182	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
183	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
184	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
185	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
186	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
187	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
188	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
189	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
190	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
191	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
192	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
193	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
194	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
195	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
196	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
197	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
198	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
199	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
200	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
201	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
202	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
203	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
204	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
205	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
206	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
207	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
208	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
209	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
210	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
211	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
212	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
213	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
214	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
215	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
216	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
217	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
218	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
219	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
220	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
221	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
222	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
223	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
224	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
225	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
226	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
227	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
228	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
229	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
230	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
231	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
232	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
233	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
234	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
235	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
236	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
237	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
238	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
239	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
240	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
241	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
242	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
243	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
244	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
245	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
246	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
247	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
248	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
249	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
251	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
254	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
255	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
257	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
258	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
260	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
262	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
263	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
264	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
265	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
266	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
267	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
268	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
269	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
270	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
271	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
272	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
273	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
274	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
275	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
276	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
277	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
278	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
279	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
280	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
281	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
282	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
283	8056060235	Nocardiopsis endophytica RSe5-2	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	97.17
Metatranscriptomes	0.2
Isolates	2.63

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.29
Nodule	0
Rhizoplane	9.51
Rhizosphere	74.9
Stem	0
Stem Tuber	0
Unclassified	8.3

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1009268	3300001977	Bacteria	1473
2	JGI24745J21846_1004759	3300002073	Bacteria	1462
3	JGI24744J21845_10000185	3300002077	Bacteria	9487
4	JGI24744J21845_10002315	3300002077	Bacteria	3883
5	JGI24034J26672_10006382	3300002239	Bacteria	1700
6	JGI24742J22300_10005335	3300002244	Bacteria	2113
7	Ga0070676_10046266	3300005328	Bacteria	2537
8	Ga0070683_100050442	3300005329	Bacteria	3852
9	Ga0070680_100101127	3300005336	Bacteria	2393
10	Ga0070682_100028716	3300005337	Bacteria	3346
11	Ga0068868_100000247	3300005338	Bacteria	36780
12	Ga0068868_100118644	3300005338	Bacteria	2156
13	Ga0068868_100316307	3300005338	Bacteria	1329
14	Ga0070660_100025823	3300005339	Bacteria	4369
15	Ga0070668_100004275	3300005347	Bacteria	10597
16	Ga0070668_100025784	3300005347	Bacteria	4459
17	Ga0070668_100078455	3300005347	Bacteria	2583
18	Ga0070668_100241379	3300005347	Bacteria	1497
19	Ga0070669_100021395	3300005353	Bacteria	4622
20	Ga0070669_100352004	3300005353	Bacteria	1196
21	Ga0070671_100000693	3300005355	Bacteria	24230
22	Ga0070674_100031890	3300005356	Bacteria	3496
23	Ga0070673_100040026	3300005364	Bacteria	3593
24	Ga0070688_100017589	3300005365	Bacteria	4105
25	Ga0070667_100000535	3300005367	Bacteria	37853
26	Ga0070667_100002322	3300005367	Bacteria	16662
27	Ga0070667_100008453	3300005367	Bacteria	8536
28	Ga0070667_100048092	3300005367	Bacteria	3590
29	Ga0070667_100112045	3300005367	Bacteria	2367
30	Ga0070667_100145455	3300005367	Bacteria	2078
31	Ga0070667_100175221	3300005367	Bacteria	1895
32	Ga0070709_10050319	3300005434	Bacteria	2610
33	Ga0070714_100011349	3300005435	Bacteria	7066
34	Ga0070714_100105730	3300005435	Bacteria	2486
35	Ga0070714_100164633	3300005435	Bacteria	2009
36	Ga0070714_100195618	3300005435	Bacteria	1847
37	Ga0070714_100246449	3300005435	Bacteria	1651
38	Ga0070714_100317805	3300005435	Bacteria	1455
39	Ga0070714_100365494	3300005435	Bacteria	1357
40	Ga0070713_100077591	3300005436	Bacteria	2825
41	Ga0070713_100371649	3300005436	Bacteria	1330
42	Ga0070710_10005761	3300005437	Bacteria	5902
43	Ga0070710_10059906	3300005437	Bacteria	2164
44	Ga0070701_10002696	3300005438	Bacteria	6886
45	Ga0070711_100000752	3300005439	Bacteria	16911
46	Ga0070711_100006647	3300005439	Bacteria	6988
47	Ga0070711_100181377	3300005439	Bacteria	1612
48	Ga0070711_100185589	3300005439	Bacteria	1594
49	Ga0070705_100035044	3300005440	Bacteria	2811
50	Ga0070705_100052338	3300005440	Bacteria	2385
51	Ga0070700_100001039	3300005441	Bacteria	13745
52	Ga0070694_100195770	3300005444	Bacteria	1504
53	Ga0070708_100010823	3300005445	Bacteria	7411
54	Ga0070678_100000977	3300005456	Bacteria	14779
55	Ga0070678_100051513	3300005456	Bacteria	2985
56	Ga0070662_100005424	3300005457	Bacteria	8147
57	Ga0070662_100034724	3300005457	Bacteria	3557
58	Ga0068867_100001436	3300005459	Bacteria	16493
59	Ga0070679_100351306	3300005530	Bacteria	1422
60	Ga0070684_100173299	3300005535	Bacteria	1960
61	Ga0068853_100016276	3300005539	Bacteria	6119
62	Ga0068853_100052480	3300005539	Bacteria	3513
63	Ga0070686_100050066	3300005544	Bacteria	2653
64	Ga0070696_100011922	3300005546	Bacteria	5826
65	Ga0070696_100059255	3300005546	Bacteria	2675
66	Ga0070665_100008030	3300005548	Bacteria	10686
67	Ga0070665_100026739	3300005548	Bacteria	5811
68	Ga0070665_100072347	3300005548	Bacteria	3455
69	Ga0070704_100001265	3300005549	Bacteria	13333
70	Ga0068855_100039233	3300005563	Bacteria	5622
71	Ga0068854_100002590	3300005578	Bacteria	11198
72	Ga0068854_100021731	3300005578	Bacteria	4358
73	Ga0068854_100042188	3300005578	Bacteria	3228
74	Ga0070702_100019139	3300005615	Bacteria	3564
75	Ga0070702_100149660	3300005615	Bacteria	1497
76	Ga0068852_100090914	3300005616	Bacteria	2731
77	Ga0068852_100100566	3300005616	Bacteria	2609
78	Ga0068859_100001716	3300005617	Bacteria	22359
79	Ga0068859_100003396	3300005617	Bacteria	16193
80	Ga0068864_100401462	3300005618	Bacteria	1303
81	Ga0068866_10000253	3300005718	Bacteria	25012
82	Ga0068866_10106321	3300005718	Bacteria	1557
83	Ga0068861_100004369	3300005719	Bacteria	9481
84	Ga0068861_100027520	3300005719	Bacteria	4142
85	Ga0068861_100220854	3300005719	Bacteria	1602
86	Ga0068851_10044602	3300005834	Bacteria	2239
87	Ga0068863_100000143	3300005841	Bacteria	75127
88	Ga0068863_100000547	3300005841	Bacteria	38285
89	Ga0068863_100011571	3300005841	Bacteria	8535
90	Ga0068863_100283984	3300005841	Bacteria	1604
91	Ga0068858_100004006	3300005842	Bacteria	14538
92	Ga0068858_100006372	3300005842	Bacteria	11493
93	Ga0068860_100000079	3300005843	Bacteria	170752
94	Ga0068860_100004670	3300005843	Bacteria	13986
95	Ga0068860_100137337	3300005843	Bacteria	2348
96	Ga0068862_100000093	3300005844	Bacteria	106838
97	Ga0068862_100002241	3300005844	Bacteria	17329
98	Ga0081455_10148773	3300005937	Bacteria	1808
99	Ga0070717_10047583	3300006028	Bacteria	3515
100	Ga0070717_10331099	3300006028	Bacteria	1358
101	Ga0075365_10028157	3300006038	Bacteria	3581
102	Ga0075365_10069696	3300006038	Bacteria	2364
103	Ga0075365_10071044	3300006038	Bacteria	2343
104	Ga0075363_100012212	3300006048	Bacteria	4134
105	Ga0075363_100014740	3300006048	Bacteria	3829
106	Ga0075363_100085800	3300006048	Bacteria	1727
107	Ga0075363_100116763	3300006048	Bacteria	1487
108	Ga0075364_10000646	3300006051	Bacteria	17975
109	Ga0075364_10000830	3300006051	Bacteria	16299
110	Ga0075364_10012338	3300006051	Bacteria	5223
111	Ga0075364_10066996	3300006051	Bacteria	2359
112	Ga0075364_10168410	3300006051	Bacteria	1480
113	Ga0070715_10016482	3300006163	Bacteria	2777
114	Ga0070715_10085760	3300006163	Bacteria	1439
115	Ga0070716_100008476	3300006173	Bacteria	5100
116	Ga0070716_100024227	3300006173	Bacteria	3228
117	Ga0070716_100242116	3300006173	Bacteria	1224
118	Ga0070712_100003290	3300006175	Bacteria	9942
119	Ga0070712_100024681	3300006175	Bacteria	3987
120	Ga0070712_100055547	3300006175	Bacteria	2774
121	Ga0075367_10004929	3300006178	Bacteria	6578
122	Ga0075369_10006532	3300006186	Bacteria	4411
123	Ga0075369_10059420	3300006186	Bacteria	1666
124	Ga0068871_100042834	3300006358	Bacteria	3636
125	Ga0075430_100173665	3300006846	Bacteria	1793
126	Ga0075431_100085700	3300006847	Bacteria	3252
127	Ga0097620_100001716	3300006931	Bacteria	22359
128	Ga0097620_100003396	3300006931	Bacteria	16193
129	Ga0105250_10056472	3300009092	Bacteria	1575
130	Ga0111539_10087983	3300009094	Bacteria	3650
131	Ga0105245_10003090	3300009098	Bacteria	14894
132	Ga0105245_10055654	3300009098	Bacteria	3554
133	Ga0105247_10001633	3300009101	Bacteria	15845
134	Ga0114129_10630866	3300009147	Bacteria	1385
135	Ga0105243_10003520	3300009148	Bacteria	12651
136	Ga0105241_10009643	3300009174	Bacteria	7095
137	Ga0105242_10002815	3300009176	Bacteria	13632
138	Ga0105242_10037522	3300009176	Bacteria	3892
139	Ga0105248_10000641	3300009177	Bacteria	39742
140	Ga0105237_10272891	3300009545	Bacteria	1694
141	Ga0105237_10539083	3300009545	Bacteria	1174
142	Ga0105238_10186486	3300009551	Bacteria	2051
143	Ga0105249_10000049	3300009553	Bacteria	169899
144	Ga0105249_10002601	3300009553	Bacteria	15639
145	Ga0105249_10004693	3300009553	Bacteria	11800
146	Ga0105239_10018429	3300010375	Bacteria	7711
147	Ga0105246_10263008	3300011119	Bacteria	1375
148	Ga0157373_10083354	3300013100	Bacteria	2253
149	Ga0157369_10083948	3300013105	Bacteria	3405
150	Ga0157374_10057288	3300013296	Bacteria	3640
151	Ga0157374_10231681	3300013296	Bacteria	1814
152	Ga0157378_10142398	3300013297	Bacteria	2227
153	Ga0163162_10006133	3300013306	Bacteria	11638
154	Ga0163162_10414510	3300013306	Bacteria	1479
155	Ga0163162_10645892	3300013306	Bacteria	1182
156	Ga0157372_10000917	3300013307	Bacteria	32072
157	Ga0157375_10000573	3300013308	Bacteria	32942
158	Ga0157375_10090744	3300013308	Bacteria	3115
159	Ga0163163_10048086	3300014325	Bacteria	4193
160	Ga0157380_10002965	3300014326	Bacteria	11550
161	Ga0157379_10040231	3300014968	Bacteria	4171
162	Ga0157379_10073881	3300014968	Bacteria	3052
163	Ga0163161_10001587	3300017792	Bacteria	16763
164	Ga0163161_10154123	3300017792	Bacteria	1748
165	Ga0213872_10019951	3300021361	Bacteria	3088
166	Ga0213876_10020759	3300021384	Bacteria	3473
167	Ga0213876_10041336	3300021384	Bacteria	2436
168	Ga0213876_10057847	3300021384	Bacteria	2047
169	Ga0224712_10019955	3300022467	Bacteria	2268
170	Ga0209051_1039635	3300025303	Bacteria	1698
171	Ga0207692_10001732	3300025898	Bacteria	8263
172	Ga0207692_10053001	3300025898	Bacteria	2064
173	Ga0207642_10000832	3300025899	Bacteria	9615
174	Ga0207710_10000350	3300025900	Bacteria	33273
175	Ga0207710_10000908	3300025900	Bacteria	15831
176	Ga0207688_10001316	3300025901	Bacteria	12902
177	Ga0207688_10004739	3300025901	Bacteria	7409
178	Ga0207647_10048685	3300025904	Bacteria	2632
179	Ga0207685_10027168	3300025905	Bacteria	2000
180	Ga0207699_10018351	3300025906	Bacteria	3705
181	Ga0207699_10049131	3300025906	Bacteria	2482
182	Ga0207699_10215779	3300025906	Bacteria	1307
183	Ga0207699_10238489	3300025906	Bacteria	1248
184	Ga0207645_10026537	3300025907	Bacteria	3743
185	Ga0207654_10018708	3300025911	Bacteria	3640
186	Ga0207695_10014025	3300025913	Bacteria	9516
187	Ga0207671_10000631	3300025914	Bacteria	46289
188	Ga0207693_10000197	3300025915	Bacteria	54675
189	Ga0207693_10000771	3300025915	Bacteria	28766
190	Ga0207693_10013355	3300025915	Bacteria	6621
191	Ga0207693_10177930	3300025915	Bacteria	1674
192	Ga0207663_10005582	3300025916	Bacteria	6350
193	Ga0207663_10039649	3300025916	Bacteria	2856
194	Ga0207657_10033651	3300025919	Bacteria	4617
195	Ga0207681_10014004	3300025923	Bacteria	4971
196	Ga0207694_10004717	3300025924	Bacteria	10606
197	Ga0207659_10077480	3300025926	Bacteria	2447
198	Ga0207687_10011659	3300025927	Bacteria	5747
199	Ga0207687_10241033	3300025927	Bacteria	1433
200	Ga0207700_10048561	3300025928	Bacteria	3152
201	Ga0207700_10209284	3300025928	Bacteria	1648
202	Ga0207700_10262928	3300025928	Bacteria	1478
203	Ga0207664_10120091	3300025929	Bacteria	2198
204	Ga0207664_10242160	3300025929	Bacteria	1571
205	Ga0207664_10264572	3300025929	Bacteria	1505
206	Ga0207644_10086647	3300025931	Bacteria	2326
207	Ga0207690_10117059	3300025932	Bacteria	1928
208	Ga0207706_10006004	3300025933	Bacteria	11294
209	Ga0207706_10018726	3300025933	Bacteria	6228
210	Ga0207686_10001409	3300025934	Bacteria	13667
211	Ga0207686_10023936	3300025934	Bacteria	3531
212	Ga0207709_10199907	3300025935	Bacteria	1427
213	Ga0207704_10000845	3300025938	Bacteria	13588
214	Ga0207665_10002506	3300025939	Bacteria	12363
215	Ga0207665_10034552	3300025939	Bacteria	3355
216	Ga0207691_10074238	3300025940	Bacteria	3067
217	Ga0207711_10000196	3300025941	Bacteria	64910
218	Ga0207689_10002479	3300025942	Bacteria	17159
219	Ga0207667_10259406	3300025949	Bacteria	1777
220	Ga0207651_10235156	3300025960	Bacteria	1490
221	Ga0207712_10000038	3300025961	Bacteria	192762
222	Ga0207712_10005556	3300025961	Bacteria	7958
223	Ga0207668_10002241	3300025972	Bacteria	11280
224	Ga0207668_10067667	3300025972	Bacteria	2536
225	Ga0207668_10092469	3300025972	Bacteria	2226
226	Ga0207658_10025113	3300025986	Bacteria	4170
227	Ga0207658_10048283	3300025986	Bacteria	3120
228	Ga0207658_10060160	3300025986	Bacteria	2833
229	Ga0207677_10003618	3300026023	Bacteria	8199
230	Ga0207677_10421905	3300026023	Bacteria	1136
231	Ga0207703_10014543	3300026035	Bacteria	6140
232	Ga0207703_10033335	3300026035	Bacteria	4082
233	Ga0207639_10009396	3300026041	Bacteria	6745
234	Ga0207678_10016657	3300026067	Bacteria	6457
235	Ga0207708_10006105	3300026075	Bacteria	8933
236	Ga0207641_10000232	3300026088	Bacteria	71885
237	Ga0207641_10011578	3300026088	Bacteria	7240
238	Ga0207648_10001458	3300026089	Bacteria	26029
239	Ga0207648_10061869	3300026089	Bacteria	3264
240	Ga0207675_100002478	3300026118	Bacteria	18279
241	Ga0207675_100036202	3300026118	Bacteria	4604
242	Ga0207675_100053810	3300026118	Bacteria	3755
243	Ga0207675_100500300	3300026118	Bacteria	1210
244	Ga0207683_10002109	3300026121	Bacteria	17499
245	Ga0207683_10008125	3300026121	Bacteria	8974
246	Ga0207698_10251454	3300026142	Bacteria	1618
247	Ga0209813_10004805	3300027866	Bacteria	3245
248	Ga0207428_10089813	3300027907	Bacteria	2387
249	Ga0268266_10008219	3300028379	Bacteria	9302
250	Ga0268266_10008938	3300028379	Bacteria	8865
251	Ga0268266_10038324	3300028379	Bacteria	4080
252	Ga0268265_10000053	3300028380	Bacteria	170215
253	Ga0268265_10274088	3300028380	Bacteria	1506
254	Ga0268264_10000017	3300028381	Bacteria	498037
255	Ga0268264_10005618	3300028381	Bacteria	10625
256	Ga0307408_100373612	3300031548	Bacteria	1217
257	Ga0316578_10069161	3300031728	Bacteria	2089
258	Ga0307413_10031030	3300031824	Bacteria	3010
259	Ga0307409_100170574	3300031995	Bacteria	1915
260	Ga0307409_100454973	3300031995	Bacteria	1236
261	Ga0307416_100011936	3300032002	Bacteria	5829
262	Ga0307415_100155175	3300032126	Bacteria	1767
263	Ga0373926_0044055	3300035083	Bacteria	1598
264	Ga0373932_0033419	3300035112	Bacteria	1444
265	Ga0373939_0017080	3300035114	Bacteria	1923
266	Ga0373945_0020365	3300035116	Bacteria	2269
267	Ga0373954_0121308	3300035118	Bacteria	1269
268	Ga0373956_0108844	3300035119	Bacteria	1289
269	Ga0373960_0022190	3300035121	Bacteria	1697
270	Ga0373924_0023723	3300035410	Bacteria	2410
271	Ga0373931_0002013	3300035691	Bacteria	8950
272	Ga0373935_0056489	3300035692	Bacteria	2502
273	Ga0373927_0198299	3300035695	Bacteria	1317
274	Ga0373933_0072163	3300035724	Bacteria	2102
275	Ga0373925_0000009	3300037068	Bacteria	243099
276	Ga0436365_0271296	3300039437	Bacteria	39035
277	Ga0436365_0502806	3300039437	Bacteria	15120
278	Ga0436365_0984977	3300039437	Bacteria	7271
279	Ga0436365_1781365	3300039437	Bacteria	36167
280	Ga0436361_0630134	3300039447	Bacteria	5449
281	Ga0436363_0207435	3300039450	Bacteria	1302
282	Ga0436363_0622446	3300039450	Bacteria	1610
283	Ga0436363_0844889	3300039450	Bacteria	1738
284	Ga0436363_1047707	3300039450	Bacteria	1124
285	Ga0436363_1339027	3300039450	Bacteria	2693
286	Ga0439466_0000727	3300041411	Bacteria	12446
287	Ga0439466_0003797	3300041411	Bacteria	5830
288	Ga0439465_0003080	3300041413	Bacteria	5454
289	Ga0439465_0003375	3300041413	Bacteria	5212
290	Ga0439431_0009623	3300041997	Bacteria	2183
291	Ga0439442_002888	3300042002	Bacteria	3384
292	Ga0439445_0015124	3300042004	Bacteria	1886
293	Ga0439445_0033709	3300042004	Bacteria	1339
294	Ga0439434_0004878	3300042435	Bacteria	3925
295	Ga0466972_0016633	3300044658	Bacteria	3677
296	Ga0466965_0000791	3300044683	Bacteria	11907
297	Ga0466965_0021397	3300044683	Bacteria	3112
298	Ga0466966_0024120	3300044684	Bacteria	3981
299	Ga0466966_0036792	3300044684	Bacteria	3159
300	Ga0466966_0066433	3300044684	Bacteria	2266
301	Ga0466961_0014900	3300044693	Bacteria	4994
302	Ga0466961_0063522	3300044693	Bacteria	2346
303	Ga0466961_0076431	3300044693	Bacteria	2122
304	Ga0466963_0023587	3300044694	Bacteria	3910
305	Ga0466963_0085112	3300044694	Bacteria	2146
306	Ga0466963_0254090	3300044694	Bacteria	1233
307	Ga0466964_0075746	3300044706	Bacteria	1433
308	Ga0466971_0029082	3300044719	Bacteria	2471
309	Ga0466968_0128346	3300044735	Bacteria	1152
310	Ga0466970_0005808	3300044765	Bacteria	6137
311	Ga0466957_0039784	3300044842	Bacteria	2838
312	Ga0466960_0000170	3300044901	Bacteria	22220
313	Ga0466959_0012046	3300045049	Bacteria	6238
314	Ga0466958_0001408	3300045836	Bacteria	11378
315	Ga0466958_0111292	3300045836	Bacteria	1709
316	Ga0466958_0114133	3300045836	Bacteria	1687
317	Ga0466967_0004920	3300045976	Bacteria	9131
318	Ga0466967_0026984	3300045976	Bacteria	4769
319	Ga0466967_0054965	3300045976	Bacteria	3506
320	Ga0466967_0082323	3300045976	Bacteria	2908
321	Ga0466967_0264799	3300045976	Bacteria	1645
322	Ga0466967_0345884	3300045976	Bacteria	1439
323	Ga0495592_0008962	3300046454	Bacteria	7514
324	Ga0495603_0002803	3300046455	Bacteria	10293
325	Ga0495603_0021703	3300046455	Bacteria	3889
326	Ga0495629_0004685	3300046459	Bacteria	10243
327	Ga0495629_0005393	3300046459	Bacteria	9539
328	Ga0495629_0100981	3300046459	Bacteria	2013
329	Ga0495651_0000560	3300046462	Bacteria	28731
330	Ga0495651_0001510	3300046462	Bacteria	18001
331	Ga0495653_0002430	3300046463	Bacteria	14811
332	Ga0495606_0012903	3300046507	Bacteria	6650
333	Ga0495618_0021839	3300046514	Bacteria	3948
334	Ga0495628_0064740	3300046516	Bacteria	2861
335	Ga0495628_0195041	3300046516	Bacteria	1528
336	Ga0495652_0002264	3300046529	Bacteria	20075
337	Ga0495652_0043590	3300046529	Bacteria	3863
338	Ga0495587_0001096	3300046536	Bacteria	17807
339	Ga0495645_0090653	3300046543	Bacteria	2185
340	Ga0495645_0137787	3300046543	Bacteria	1705
341	Ga0495634_0040791	3300046642	Bacteria	3154
342	Ga0495635_0189536	3300046663	Bacteria	1396
343	Ga0495657_0003537	3300046675	Bacteria	12740
344	Ga0495599_0000925	3300046678	Bacteria	16369
345	Ga0495623_0034501	3300046679	Bacteria	3244
346	Ga0495658_0098822	3300046683	Bacteria	1739
347	Ga0495658_0177433	3300046683	Bacteria	1321
348	Ga0495613_0011838	3300046689	Bacteria	6482
349	Ga0495624_0029982	3300046690	Bacteria	3546
350	Ga0495600_0011689	3300046809	Bacteria	5476
351	Ga0495581_0148982	3300047315	Bacteria	1366
352	Ga0495676_0012248	3300047321	Bacteria	7730
353	Ga0495680_0002737	3300047322	Bacteria	17793
354	Ga0495675_0059156	3300047444	Bacteria	2429
355	Ga0495593_0024363	3300047673	Bacteria	3355
356	Ga0495602_0003424	3300048088	Bacteria	16394
357	Ga0495614_0007819	3300048089	Bacteria	4753
358	Ga0496100_0014669	3300048903	Bacteria	4556
359	Ga0496100_0029854	3300048903	Bacteria	3376
360	Ga0496100_0210782	3300048903	Bacteria	1421
361	Ga0496100_0261500	3300048903	Bacteria	1284
362	Ga0496101_0000991	3300048904	Bacteria	16799
363	Ga0496101_0003805	3300048904	Bacteria	9426
364	Ga0496101_0019546	3300048904	Bacteria	4625
365	Ga0496101_0044829	3300048904	Bacteria	3166
366	Ga0496102_0000055	3300048905	Bacteria	173798
367	Ga0496102_0000559	3300048905	Bacteria	39807
368	Ga0496102_0002369	3300048905	Bacteria	16076
369	Ga0496102_0004549	3300048905	Bacteria	11721
370	Ga0496102_0108074	3300048905	Bacteria	2591
371	Ga0496102_0153923	3300048905	Bacteria	2161
372	Ga0496103_0000054	3300048906	Bacteria	144653
373	Ga0496103_0002295	3300048906	Bacteria	12080
374	Ga0496103_0035361	3300048906	Bacteria	3058
375	Ga0496103_0048677	3300048906	Bacteria	2620
376	Ga0496103_0057516	3300048906	Bacteria	2414
377	Ga0496104_0001343	3300048907	Bacteria	21285
378	Ga0496104_0002043	3300048907	Bacteria	17529
379	Ga0496104_0096289	3300048907	Bacteria	2831
380	Ga0496104_0371474	3300048907	Bacteria	1343
381	Ga0496105_0000915	3300048908	Bacteria	20101
382	Ga0496105_0004230	3300048908	Bacteria	10787
383	Ga0496105_0016133	3300048908	Bacteria	5958
384	Ga0496105_0028419	3300048908	Bacteria	4572
385	Ga0496106_0007302	3300048909	Bacteria	8165
386	Ga0496106_0037664	3300048909	Bacteria	3618
387	Ga0496107_0000908	3300048910	Bacteria	17458
388	Ga0496107_0005364	3300048910	Bacteria	8771
389	Ga0496107_0044709	3300048910	Bacteria	3184
390	Ga0496108_0003267	3300048911	Bacteria	13040
391	Ga0496110_0221013	3300048913	Bacteria	1722
392	Ga0496110_0504129	3300048913	Bacteria	1102
393	Ga0496111_0035785	3300048914	Bacteria	3550
394	Ga0496111_0143784	3300048914	Bacteria	1768
395	Ga0496112_0003811	3300048915	Bacteria	12600
396	Ga0496112_0183945	3300048915	Bacteria	2053
397	Ga0496112_0283874	3300048915	Bacteria	1602
398	Ga0496113_0007940	3300048916	Bacteria	6872
399	Ga0496113_0025188	3300048916	Bacteria	4238
400	Ga0496114_0001231	3300048917	Bacteria	19347
401	Ga0496114_0072062	3300048917	Bacteria	2905
402	Ga0496114_0114247	3300048917	Bacteria	2315
403	Ga0496115_0001352	3300048918	Bacteria	17502
404	Ga0496115_0149370	3300048918	Bacteria	1929
405	Ga0496116_0000210	3300048919	Bacteria	109494
406	Ga0496116_0018478	3300048919	Bacteria	5374
407	Ga0496117_0000119	3300048920	Bacteria	173772
408	Ga0496117_0005020	3300048920	Bacteria	14189
409	Ga0496118_0000063	3300048921	Bacteria	214325
410	Ga0496118_0000272	3300048921	Bacteria	91016
411	Ga0496118_0004348	3300048921	Bacteria	16865
412	Ga0496119_0000053	3300048922	Bacteria	182875
413	Ga0496119_0071518	3300048922	Bacteria	2030
414	Ga0496120_0001927	3300048923	Bacteria	22846
415	Ga0496120_0080325	3300048923	Bacteria	1768
416	Ga0496121_0000436	3300048924	Bacteria	82397
417	Ga0496121_0007605	3300048924	Bacteria	13035
418	Ga0496121_0017638	3300048924	Bacteria	7272
419	Ga0496123_0089367	3300048926	Bacteria	1835
420	Ga0496126_0000131	3300048929	Bacteria	173789
421	Ga0496126_0001476	3300048929	Bacteria	36542
422	Ga0496126_0002253	3300048929	Bacteria	26616
423	Ga0496126_0006402	3300048929	Bacteria	13130
424	Ga0496126_0012266	3300048929	Bacteria	8793
425	Ga0501032_0003894	3300049569	Bacteria	11330
426	Ga0501032_0004604	3300049569	Bacteria	10372
427	Ga0501033_0017750	3300049570	Bacteria	5375
428	Ga0501033_0042712	3300049570	Bacteria	3379
429	Ga0501034_0004377	3300049571	Bacteria	15734
430	Ga0501034_0015364	3300049571	Bacteria	7867
431	Ga0501036_0019151	3300049572	Bacteria	5743
432	Ga0501036_0025607	3300049572	Bacteria	4979
433	Ga0501036_0107139	3300049572	Bacteria	2363
434	Ga0501037_0000401	3300049573	Bacteria	36095
435	Ga0501038_0094271	3300049574	Bacteria	2502
436	Ga0501039_0037284	3300049575	Bacteria	3751
437	Ga0501043_0001613	3300049579	Bacteria	19644
438	Ga0501043_0091701	3300049579	Bacteria	2389
439	Ga0501046_0000769	3300049580	Bacteria	31025
440	Ga0501047_0015367	3300049581	Bacteria	7292
441	Ga0501047_0297883	3300049581	Bacteria	1456
442	Ga0501070_0000985	3300049586	Bacteria	25575
443	Ga0501070_0016125	3300049586	Bacteria	6280
444	Ga0501070_0110862	3300049586	Bacteria	2268
445	Ga0501073_0160770	3300049589	Bacteria	1556
446	Ga0501080_0012330	3300049742	Bacteria	7834
447	Ga0501083_0084327	3300049744	Bacteria	2104
448	Ga0501035_0000886	3300049822	Bacteria	31764
449	Ga0501035_0006987	3300049822	Bacteria	10542
450	Ga0501044_0000313	3300049823	Bacteria	61310
451	Ga0501044_0002408	3300049823	Bacteria	21329
452	Ga0501044_0015683	3300049823	Bacteria	8159
453	Ga0501044_0020862	3300049823	Bacteria	6995
454	nmdc:mga03n38_101390_c1	3300050490	Bacteria	1389
455	nmdc:mga03n38_1099_c1	3300050490	Bacteria	7471
456	nmdc:mga03n38_48480_c1	3300050490	Bacteria	1885
457	nmdc:mga03n38_57262_c1	3300050490	Bacteria	1762
458	nmdc:mga03n38_77128_c1	3300050490	Bacteria	1557
459	nmdc:mga00v17_19915_c1	3300050491	Bacteria	3837
460	nmdc:mga00v17_709_c1	3300050491	Bacteria	18242
461	nmdc:mga0yw44_123176_c1	3300050492	Bacteria	1672
462	nmdc:mga04h51_4875_c1	3300050495	Bacteria	3376
463	nmdc:mga07m45_10261_c1	3300050496	Bacteria	4887
464	nmdc:mga07m45_1536_c1	3300050496	Bacteria	10608
465	nmdc:mga05p37_14986_c1	3300050507	Bacteria	9306
466	nmdc:mga05p37_86471_c1	3300050507	Bacteria	3864
467	nmdc:mga0n895_416015_c1	3300050512	Bacteria	1359
468	nmdc:mga0rr50_335164_c1	3300050513	Bacteria	1270
469	nmdc:mga0sz30_1098_c1	3300050516	Bacteria	9721
470	nmdc:mga0sz30_16089_c1	3300050516	Bacteria	2963
471	Ga0495612_0015849	3300053078	Bacteria	3021
472	Ga0500635_0001068	3300053080	Bacteria	6556
473	Ga0495595_0003711	3300053084	Bacteria	6071
474	Ga0495619_0076086	3300053085	Bacteria	2253
475	Ga0500652_000371	3300053131	Bacteria	16112
476	Ga0500559_0102395	3300053136	Bacteria	1320
477	Ga0500616_0003976	3300053153	Bacteria	10819
478	Ga0500616_0049181	3300053153	Bacteria	2232
479	Ga0500645_000056	3300053730	Bacteria	92126
480	Ga0466962_0079199	3300061719	Bacteria	1571
481	Ga0466962_0087658	3300061719	Bacteria	1490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300039450	Ga0436363_1047707	Ga0436363_1047707_158_1009	276
2	3300005329	Ga0070683_100050442	Ga0070683_1000504423	296
3	3300005841	Ga0068863_100000547	Ga0068863_10000054735	296
4	3300014968	Ga0157379_10040231	Ga0157379_100402314	296
5	3300026088	Ga0207641_10011578	Ga0207641_100115788	296
6	3300048905	Ga0496102_0000055	Ga0496102_0000055_53648_54655	296
7	3300048906	Ga0496103_0000054	Ga0496103_0000054_119117_120124	296
8	3300048919	Ga0496116_0000210	Ga0496116_0000210_53657_54664	296
9	3300048920	Ga0496117_0000119	Ga0496117_0000119_119125_120132	296
10	3300048921	Ga0496118_0000063	Ga0496118_0000063_119142_120149	296
11	3300048929	Ga0496126_0000131	Ga0496126_0000131_119124_120131	296
12	3300005435	Ga0070714_100365494	Ga0070714_1003654941	297
13	3300005439	Ga0070711_100185589	Ga0070711_1001855892	297
14	3300048908	Ga0496105_0004230	Ga0496105_0004230_5606_6610	301
15	3300048922	Ga0496119_0000053	Ga0496119_0000053_146224_147228	301
16	3300048923	Ga0496120_0001927	Ga0496120_0001927_2496_3500	301
17	3300048903	Ga0496100_0014669	Ga0496100_0014669_3437_4441	302
18	3300048904	Ga0496101_0019546	Ga0496101_0019546_2233_3237	302
19	3300048924	Ga0496121_0007605	Ga0496121_0007605_9425_10429	302
20	3300050512	nmdc:mga0n895_416015_c1	nmdc:mga0n895_416015_c1_145_1170	305
21	3300009545	Ga0105237_10539083	Ga0105237_105390832	307
22	3300022467	Ga0224712_10019955	Ga0224712_100199553	308
23	3300002239	JGI24034J26672_10006382	JGI24034J26672_100063821	309
24	3300002244	JGI24742J22300_10005335	JGI24742J22300_100053352	309
25	3300005339	Ga0070660_100025823	Ga0070660_1000258232	309
26	3300005347	Ga0070668_100025784	Ga0070668_1000257844	309
27	3300005356	Ga0070674_100031890	Ga0070674_1000318902	309
28	3300005365	Ga0070688_100017589	Ga0070688_1000175892	309
29	3300005367	Ga0070667_100002322	Ga0070667_1000023229	309
30	3300005439	Ga0070711_100000752	Ga0070711_1000007529	309
31	3300005440	Ga0070705_100035044	Ga0070705_1000350442	309
32	3300005441	Ga0070700_100001039	Ga0070700_10000103912	309
33	3300005456	Ga0070678_100000977	Ga0070678_1000009778	309
34	3300005457	Ga0070662_100005424	Ga0070662_1000054242	309
35	3300005459	Ga0068867_100001436	Ga0068867_1000014369	309
36	3300005539	Ga0068853_100016276	Ga0068853_1000162764	309
37	3300005546	Ga0070696_100011922	Ga0070696_1000119224	309
38	3300005549	Ga0070704_100001265	Ga0070704_1000012656	309
39	3300005615	Ga0070702_100019139	Ga0070702_1000191393	309
40	3300009098	Ga0105245_10003090	Ga0105245_100030909	309
41	3300009176	Ga0105242_10002815	Ga0105242_1000281512	309
42	3300009553	Ga0105249_10004693	Ga0105249_1000469312	309
43	3300013105	Ga0157369_10083948	Ga0157369_100839484	309
44	3300013307	Ga0157372_10000917	Ga0157372_100009175	309
45	3300013308	Ga0157375_10000573	Ga0157375_1000057329	309
46	3300014326	Ga0157380_10002965	Ga0157380_100029653	309
47	3300025899	Ga0207642_10000832	Ga0207642_100008328	309
48	3300035691	Ga0373931_0002013	Ga0373931_0002013_3532_4500	309
49	3300048903	Ga0496100_0029854	Ga0496100_0029854_1735_2703	309
50	3300048904	Ga0496101_0000991	Ga0496101_0000991_7401_8369	309
51	3300048905	Ga0496102_0004549	Ga0496102_0004549_9697_10665	309
52	3300048906	Ga0496103_0002295	Ga0496103_0002295_9705_10673	309
53	3300048909	Ga0496106_0007302	Ga0496106_0007302_6244_7212	309
54	3300048910	Ga0496107_0000908	Ga0496107_0000908_6907_7875	309
55	3300048917	Ga0496114_0001231	Ga0496114_0001231_4463_5431	309
56	3300048918	Ga0496115_0001352	Ga0496115_0001352_6996_7964	309
57	3300035083	Ga0373926_0044055	Ga0373926_0044055_156_1202	310
58	3300035116	Ga0373945_0020365	Ga0373945_0020365_935_1981	310
59	3300035118	Ga0373954_0121308	Ga0373954_0121308_113_1141	310
60	3300035119	Ga0373956_0108844	Ga0373956_0108844_17_1063	310
61	3300035410	Ga0373924_0023723	Ga0373924_0023723_65_1111	310
62	3300035692	Ga0373935_0056489	Ga0373935_0056489_1101_2147	310
63	3300035695	Ga0373927_0198299	Ga0373927_0198299_182_1228	310
64	3300035724	Ga0373933_0072163	Ga0373933_0072163_264_1310	310
65	3300046454	Ga0495592_0008962	Ga0495592_0008962_3725_4771	310
66	3300046459	Ga0495629_0100981	Ga0495629_0100981_352_1398	310
67	3300046462	Ga0495651_0001510	Ga0495651_0001510_10486_11532	310
68	3300046463	Ga0495653_0002430	Ga0495653_0002430_10941_11987	310
69	3300046514	Ga0495618_0021839	Ga0495618_0021839_2528_3574	310
70	3300046516	Ga0495628_0064740	Ga0495628_0064740_130_1176	310
71	3300046516	Ga0495628_0195041	Ga0495628_0195041_481_1473	310
72	3300046529	Ga0495652_0002264	Ga0495652_0002264_3370_4416	310
73	3300046536	Ga0495587_0001096	Ga0495587_0001096_5711_6757	310
74	3300046642	Ga0495634_0040791	Ga0495634_0040791_21_1067	310
75	3300046663	Ga0495635_0189536	Ga0495635_0189536_291_1337	310
76	3300046675	Ga0495657_0003537	Ga0495657_0003537_773_1819	310
77	3300046678	Ga0495599_0000925	Ga0495599_0000925_1065_2111	310
78	3300046679	Ga0495623_0034501	Ga0495623_0034501_1084_2130	310
79	3300046809	Ga0495600_0011689	Ga0495600_0011689_3051_4097	310
80	3300047322	Ga0495680_0002737	Ga0495680_0002737_13205_14251	310
81	3300047444	Ga0495675_0059156	Ga0495675_0059156_759_1805	310
82	3300048088	Ga0495602_0003424	Ga0495602_0003424_10833_11879	310
83	3300053084	Ga0495595_0003711	Ga0495595_0003711_139_1185	310
84	3300009551	Ga0105238_10186486	Ga0105238_101864861	311
85	3300050507	nmdc:mga05p37_14986_c1	nmdc:mga05p37_14986_c1_1614_2582	311
86	3300005435	Ga0070714_100246449	Ga0070714_1002464491	312
87	3300025928	Ga0207700_10209284	Ga0207700_102092842	312
88	3300025929	Ga0207664_10264572	Ga0207664_102645721	312
89	3300050513	nmdc:mga0rr50_335164_c1	nmdc:mga0rr50_335164_c1_54_1115	312
90	3300053080	Ga0500635_0001068	Ga0500635_0001068_726_1688	312
91	3300053131	Ga0500652_000371	Ga0500652_000371_10_972	312
92	3300026023	Ga0207677_10421905	Ga0207677_104219052	313
93	3300005347	Ga0070668_100004275	Ga0070668_10000427510	314
94	3300009094	Ga0111539_10087983	Ga0111539_100879832	314
95	3300005434	Ga0070709_10050319	Ga0070709_100503192	315
96	3300025906	Ga0207699_10049131	Ga0207699_100491312	315
97	3300046683	Ga0495658_0177433	Ga0495658_0177433_256_1269	315
98	3300048913	Ga0496110_0504129	Ga0496110_0504129_64_1086	315
99	3300047673	Ga0495593_0024363	Ga0495593_0024363_1547_2617	316
100	3300048907	Ga0496104_0096289	Ga0496104_0096289_172_1212	316
101	3300048908	Ga0496105_0028419	Ga0496105_0028419_2178_3200	316
102	3300050516	nmdc:mga0sz30_1098_c1	nmdc:mga0sz30_1098_c1_1508_2551	316
103	3300005435	Ga0070714_100317805	Ga0070714_1003178052	317
104	3300006028	Ga0070717_10331099	Ga0070717_103310991	317
105	3300009148	Ga0105243_10003520	Ga0105243_1000352012	317
106	3300025928	Ga0207700_10262928	Ga0207700_102629281	317
107	3300025929	Ga0207664_10120091	Ga0207664_101200912	317
108	3300045976	Ga0466967_0004920	Ga0466967_0004920_8075_9049	318
109	3300005338	Ga0068868_100118644	Ga0068868_1001186441	319
110	3300005367	Ga0070667_100175221	Ga0070667_1001752212	319
111	iso_pu_bacteria	2915358134	2915360869	320
112	3300005347	Ga0070668_100078455	Ga0070668_1000784552	321
113	3300005548	Ga0070665_100008030	Ga0070665_1000080301	321
114	3300005618	Ga0068864_100401462	Ga0068864_1004014622	321
115	3300009098	Ga0105245_10055654	Ga0105245_100556543	321
116	3300009147	Ga0114129_10630866	Ga0114129_106308661	321
117	3300009553	Ga0105249_10002601	Ga0105249_100026014	321
118	3300025927	Ga0207687_10241033	Ga0207687_102410332	321
119	3300028379	Ga0268266_10008938	Ga0268266_100089387	321
120	3300046543	Ga0495645_0137787	Ga0495645_0137787_173_1198	321
121	3300048916	Ga0496113_0007940	Ga0496113_0007940_1594_2565	321
122	3300050490	nmdc:mga03n38_101390_c1	nmdc:mga03n38_101390_c1_257_1228	321
123	3300050492	nmdc:mga0yw44_123176_c1	nmdc:mga0yw44_123176_c1_126_1097	321
124	3300005328	Ga0070676_10046266	Ga0070676_100462661	322
125	3300005336	Ga0070680_100101127	Ga0070680_1001011271	322
126	3300005353	Ga0070669_100352004	Ga0070669_1003520041	322
127	3300005435	Ga0070714_100195618	Ga0070714_1001956182	322
128	3300005436	Ga0070713_100371649	Ga0070713_1003716492	322
129	3300005437	Ga0070710_10059906	Ga0070710_100599062	322
130	3300005439	Ga0070711_100006647	Ga0070711_1000066474	322
131	3300005719	Ga0068861_100027520	Ga0068861_1000275205	322
132	3300009092	Ga0105250_10056472	Ga0105250_100564722	322
133	3300010375	Ga0105239_10018429	Ga0105239_100184294	322
134	3300011119	Ga0105246_10263008	Ga0105246_102630082	322
135	3300013100	Ga0157373_10083354	Ga0157373_100833542	322
136	3300013296	Ga0157374_10057288	Ga0157374_100572883	322
137	3300013296	Ga0157374_10231681	Ga0157374_102316812	322
138	3300013297	Ga0157378_10142398	Ga0157378_101423982	322
139	3300013306	Ga0163162_10006133	Ga0163162_1000613312	322
140	3300013306	Ga0163162_10414510	Ga0163162_104145101	322
141	3300013308	Ga0157375_10090744	Ga0157375_100907444	322
142	3300025906	Ga0207699_10215779	Ga0207699_102157791	322
143	3300025915	Ga0207693_10177930	Ga0207693_101779302	322
144	3300025929	Ga0207664_10242160	Ga0207664_102421602	322
145	3300026118	Ga0207675_100036202	Ga0207675_1000362025	322
146	3300035112	Ga0373932_0033419	Ga0373932_0033419_81_1049	322
147	3300035114	Ga0373939_0017080	Ga0373939_0017080_161_1129	322
148	3300035121	Ga0373960_0022190	Ga0373960_0022190_231_1199	322
149	3300048905	Ga0496102_0002369	Ga0496102_0002369_8733_9707	322
150	3300048906	Ga0496103_0057516	Ga0496103_0057516_519_1487	322
151	3300048911	Ga0496108_0003267	Ga0496108_0003267_2739_3707	322
152	3300048913	Ga0496110_0221013	Ga0496110_0221013_114_1082	322
153	3300048914	Ga0496111_0143784	Ga0496111_0143784_536_1504	322
154	3300048915	Ga0496112_0183945	Ga0496112_0183945_501_1469	322
155	3300048916	Ga0496113_0025188	Ga0496113_0025188_2603_3571	322
156	3300048917	Ga0496114_0114247	Ga0496114_0114247_676_1644	322
157	3300048918	Ga0496115_0149370	Ga0496115_0149370_804_1772	322
158	3300050507	nmdc:mga05p37_86471_c1	nmdc:mga05p37_86471_c1_941_1909	322
159	3300006038	Ga0075365_10071044	Ga0075365_100710442	323
160	3300045976	Ga0466967_0054965	Ga0466967_0054965_2257_3231	323
161	3300048907	Ga0496104_0002043	Ga0496104_0002043_7767_8750	323
162	3300048908	Ga0496105_0000915	Ga0496105_0000915_14705_15688	323
163	3300049569	Ga0501032_0004604	Ga0501032_0004604_4479_5459	323
164	3300049571	Ga0501034_0015364	Ga0501034_0015364_3503_4483	323
165	3300049572	Ga0501036_0107139	Ga0501036_0107139_240_1220	323
166	3300049573	Ga0501037_0000401	Ga0501037_0000401_15084_16064	323
167	3300049574	Ga0501038_0094271	Ga0501038_0094271_1282_2262	323
168	3300049575	Ga0501039_0037284	Ga0501039_0037284_758_1738	323
169	3300049579	Ga0501043_0001613	Ga0501043_0001613_1079_2059	323
170	3300049586	Ga0501070_0016125	Ga0501070_0016125_822_1802	323
171	3300049823	Ga0501044_0002408	Ga0501044_0002408_13783_14766	324
172	3300053078	Ga0495612_0015849	Ga0495612_0015849_940_2040	324
173	3300053085	Ga0495619_0076086	Ga0495619_0076086_326_1426	324
174	3300045976	Ga0466967_0026984	Ga0466967_0026984_1093_2124	325
175	3300006048	Ga0075363_100085800	Ga0075363_1000858002	326
176	3300026118	Ga0207675_100500300	Ga0207675_1005003001	326
177	3300044719	Ga0466971_0029082	Ga0466971_0029082_61_1044	326
178	3300048903	Ga0496100_0261500	Ga0496100_0261500_148_1143	326
179	3300048905	Ga0496102_0153923	Ga0496102_0153923_279_1295	326
180	3300048906	Ga0496103_0048677	Ga0496103_0048677_937_1953	326
181	3300049572	Ga0501036_0025607	Ga0501036_0025607_3131_4144	326
182	3300053153	Ga0500616_0049181	Ga0500616_0049181_603_1619	326
183	iso_pu_bacteria	8056060235	8056064743	326
184	3300006173	Ga0070716_100242116	Ga0070716_1002421161	327
185	3300006175	Ga0070712_100055547	Ga0070712_1000555473	327
186	3300025915	Ga0207693_10013355	Ga0207693_100133555	327
187	3300037068	Ga0373925_0000009	Ga0373925_0000009_99839_100897	327
188	3300042004	Ga0439445_0033709	Ga0439445_0033709_89_1081	327
189	3300046462	Ga0495651_0000560	Ga0495651_0000560_25383_26438	327
190	3300046529	Ga0495652_0043590	Ga0495652_0043590_1646_2701	327
191	3300046543	Ga0495645_0090653	Ga0495645_0090653_970_2025	327
192	3300005456	Ga0070678_100051513	Ga0070678_1000515132	328
193	3300014968	Ga0157379_10073881	Ga0157379_100738812	328
194	3300039450	Ga0436363_0207435	Ga0436363_0207435_282_1271	328
195	3300048915	Ga0496112_0003811	Ga0496112_0003811_4297_5331	328
196	3300048923	Ga0496120_0080325	Ga0496120_0080325_239_1273	328
197	3300048926	Ga0496123_0089367	Ga0496123_0089367_397_1431	328
198	3300048929	Ga0496126_0006402	Ga0496126_0006402_7975_9009	328
199	3300002077	JGI24744J21845_10000185	JGI24744J21845_100001851	329
200	3300005338	Ga0068868_100000247	Ga0068868_10000024710	329
201	3300005435	Ga0070714_100011349	Ga0070714_1000113494	329
202	3300005437	Ga0070710_10005761	Ga0070710_100057612	329
203	3300005438	Ga0070701_10002696	Ga0070701_100026962	329
204	3300005439	Ga0070711_100181377	Ga0070711_1001813771	329
205	3300005548	Ga0070665_100026739	Ga0070665_1000267396	329
206	3300005578	Ga0068854_100002590	Ga0068854_10000259011	329
207	3300005617	Ga0068859_100003396	Ga0068859_1000033969	329
208	3300005718	Ga0068866_10000253	Ga0068866_1000025319	329
209	3300005719	Ga0068861_100004369	Ga0068861_1000043699	329
210	3300005842	Ga0068858_100006372	Ga0068858_10000637213	329
211	3300005843	Ga0068860_100004670	Ga0068860_1000046707	329
212	3300006028	Ga0070717_10047583	Ga0070717_100475833	329
213	3300006163	Ga0070715_10016482	Ga0070715_100164822	329
214	3300006173	Ga0070716_100008476	Ga0070716_1000084766	329
215	3300006175	Ga0070712_100003290	Ga0070712_1000032902	329
216	3300006931	Ga0097620_100003396	Ga0097620_10000339610	329
217	3300025898	Ga0207692_10001732	Ga0207692_100017329	329
218	3300025898	Ga0207692_10053001	Ga0207692_100530012	329
219	3300025900	Ga0207710_10000350	Ga0207710_1000035010	329
220	3300025901	Ga0207688_10001316	Ga0207688_1000131611	329
221	3300025906	Ga0207699_10238489	Ga0207699_102384891	329
222	3300025915	Ga0207693_10000197	Ga0207693_1000019755	329
223	3300025916	Ga0207663_10005582	Ga0207663_100055822	329
224	3300025916	Ga0207663_10039649	Ga0207663_100396493	329
225	3300025919	Ga0207657_10033651	Ga0207657_100336513	329
226	3300025926	Ga0207659_10077480	Ga0207659_100774803	329
227	3300025927	Ga0207687_10011659	Ga0207687_100116593	329
228	3300025928	Ga0207700_10048561	Ga0207700_100485612	329
229	3300025932	Ga0207690_10117059	Ga0207690_101170592	329
230	3300025933	Ga0207706_10006004	Ga0207706_100060044	329
231	3300025934	Ga0207686_10001409	Ga0207686_1000140910	329
232	3300025938	Ga0207704_10000845	Ga0207704_100008453	329
233	3300025939	Ga0207665_10034552	Ga0207665_100345521	329
234	3300025960	Ga0207651_10235156	Ga0207651_102351562	329
235	3300025961	Ga0207712_10005556	Ga0207712_100055569	329
236	3300025972	Ga0207668_10002241	Ga0207668_100022415	329
237	3300025986	Ga0207658_10025113	Ga0207658_100251136	329
238	3300026023	Ga0207677_10003618	Ga0207677_100036182	329
239	3300026035	Ga0207703_10014543	Ga0207703_100145432	329
240	3300026041	Ga0207639_10009396	Ga0207639_100093962	329
241	3300026075	Ga0207708_10006105	Ga0207708_100061055	329
242	3300026089	Ga0207648_10001458	Ga0207648_1000145819	329
243	3300026118	Ga0207675_100002478	Ga0207675_10000247811	329
244	3300026121	Ga0207683_10002109	Ga0207683_1000210913	329
245	3300028379	Ga0268266_10008219	Ga0268266_100082194	329
246	3300028381	Ga0268264_10005618	Ga0268264_100056186	329
247	3300044694	Ga0466963_0254090	Ga0466963_0254090_94_1167	329
248	3300048905	Ga0496102_0108074	Ga0496102_0108074_569_1567	329
249	3300049570	Ga0501033_0017750	Ga0501033_0017750_3329_4321	329
250	iso_pu_bacteria	2842888712	2842891083	329
251	3300005435	Ga0070714_100164633	Ga0070714_1001646332	330
252	3300013306	Ga0163162_10645892	Ga0163162_106458921	330
253	3300039450	Ga0436363_0844889	Ga0436363_0844889_562_1572	330
254	3300048929	Ga0496126_0012266	Ga0496126_0012266_5108_6106	330
255	3300053136	Ga0500559_0102395	Ga0500559_0102395_228_1226	330
256	3300053730	Ga0500645_000056	Ga0500645_000056_46756_47754	330
257	iso_pu_bacteria	2738541264	2738667351	330
258	iso_pu_bacteria	2738541356	2739146194	330
259	3300005435	Ga0070714_100105730	Ga0070714_1001057302	331
260	3300021384	Ga0213876_10057847	Ga0213876_100578472	331
261	3300039437	Ga0436365_1781365	Ga0436365_1781365_28719_29732	331
262	3300044684	Ga0466966_0066433	Ga0466966_0066433_1215_2213	331
263	3300044694	Ga0466963_0023587	Ga0466963_0023587_1579_2577	331
264	3300045049	Ga0466959_0012046	Ga0466959_0012046_4726_5724	331
265	3300045836	Ga0466958_0114133	Ga0466958_0114133_515_1513	331
266	3300046507	Ga0495606_0012903	Ga0495606_0012903_4437_5441	332
267	3300005367	Ga0070667_100048092	Ga0070667_1000480924	333
268	3300053153	Ga0500616_0003976	Ga0500616_0003976_5736_6746	333
269	iso_pu_bacteria	2622736605	2623501800	333
270	3300005436	Ga0070713_100077591	Ga0070713_1000775913	334
271	3300005530	Ga0070679_100351306	Ga0070679_1003513062	334
272	3300005535	Ga0070684_100173299	Ga0070684_1001732991	334
273	3300005548	Ga0070665_100072347	Ga0070665_1000723473	334
274	3300005563	Ga0068855_100039233	Ga0068855_1000392335	334
275	3300005578	Ga0068854_100042188	Ga0068854_1000421883	334
276	3300005616	Ga0068852_100100566	Ga0068852_1001005662	334
277	3300009174	Ga0105241_10009643	Ga0105241_100096435	334
278	3300009545	Ga0105237_10272891	Ga0105237_102728912	334
279	3300025904	Ga0207647_10048685	Ga0207647_100486852	334
280	3300025911	Ga0207654_10018708	Ga0207654_100187083	334
281	3300025913	Ga0207695_10014025	Ga0207695_100140259	334
282	3300025914	Ga0207671_10000631	Ga0207671_100006314	334
283	3300025924	Ga0207694_10004717	Ga0207694_100047177	334
284	3300025949	Ga0207667_10259406	Ga0207667_102594062	334
285	3300044693	Ga0466961_0076431	Ga0466961_0076431_551_1582	334
286	3300049586	Ga0501070_0110862	Ga0501070_0110862_643_1707	334
287	iso_pu_bacteria	2902799365	2902804124	334
288	3300006048	Ga0075363_100116763	Ga0075363_1001167632	335
289	3300039437	Ga0436365_0984977	Ga0436365_0984977_4797_5825	335
290	3300039450	Ga0436363_0622446	Ga0436363_0622446_257_1285	335
291	3300044684	Ga0466966_0036792	Ga0466966_0036792_429_1439	335
292	3300044693	Ga0466961_0014900	Ga0466961_0014900_1401_2411	335
293	3300044694	Ga0466963_0085112	Ga0466963_0085112_222_1232	335
294	3300044735	Ga0466968_0128346	Ga0466968_0128346_91_1101	335
295	3300044842	Ga0466957_0039784	Ga0466957_0039784_1641_2651	335
296	3300045836	Ga0466958_0001408	Ga0466958_0001408_1272_2282	335
297	3300049569	Ga0501032_0003894	Ga0501032_0003894_8411_9421	335
298	3300049571	Ga0501034_0004377	Ga0501034_0004377_1493_2503	335
299	3300049572	Ga0501036_0019151	Ga0501036_0019151_2978_3988	335
300	3300049579	Ga0501043_0091701	Ga0501043_0091701_829_1839	335
301	3300049580	Ga0501046_0000769	Ga0501046_0000769_28013_29023	335
302	3300049586	Ga0501070_0000985	Ga0501070_0000985_19584_20594	335
303	3300049742	Ga0501080_0012330	Ga0501080_0012330_6476_7486	335
304	3300049744	Ga0501083_0084327	Ga0501083_0084327_193_1203	335
305	3300049822	Ga0501035_0006987	Ga0501035_0006987_6451_7461	335
306	3300049823	Ga0501044_0020862	Ga0501044_0020862_2211_3221	335
307	iso_pu_bacteria	2738543028	2739328834	335
308	iso_pu_bacteria	2939582691	2939585127	335
309	3300005353	Ga0070669_100021395	Ga0070669_1000213954	336
310	3300005367	Ga0070667_100000535	Ga0070667_1000005353	336
311	3300005445	Ga0070708_100010823	Ga0070708_1000108234	336
312	3300005617	Ga0068859_100001716	Ga0068859_10000171623	336
313	3300005841	Ga0068863_100000143	Ga0068863_10000014381	336
314	3300005842	Ga0068858_100004006	Ga0068858_1000040062	336
315	3300005843	Ga0068860_100000079	Ga0068860_100000079147	336
316	3300005844	Ga0068862_100000093	Ga0068862_1000000933	336
317	3300006931	Ga0097620_100001716	Ga0097620_10000171623	336
318	3300009101	Ga0105247_10001633	Ga0105247_100016332	336
319	3300009177	Ga0105248_10000641	Ga0105248_100006413	336
320	3300009553	Ga0105249_10000049	Ga0105249_10000049144	336
321	3300014325	Ga0163163_10048086	Ga0163163_100480865	336
322	3300021361	Ga0213872_10019951	Ga0213872_100199512	336
323	3300021384	Ga0213876_10020759	Ga0213876_100207594	336
324	3300025900	Ga0207710_10000908	Ga0207710_100009082	336
325	3300025923	Ga0207681_10014004	Ga0207681_100140042	336
326	3300025941	Ga0207711_10000196	Ga0207711_1000019669	336
327	3300025961	Ga0207712_10000038	Ga0207712_10000038158	336
328	3300026035	Ga0207703_10033335	Ga0207703_100333354	336
329	3300026088	Ga0207641_10000232	Ga0207641_100002322	336
330	3300028380	Ga0268265_10000053	Ga0268265_100000533	336
331	3300028381	Ga0268264_10000017	Ga0268264_10000017145	336
332	3300039437	Ga0436365_0271296	Ga0436365_0271296_36656_37687	336
333	3300039447	Ga0436361_0630134	Ga0436361_0630134_795_1862	336
334	3300048904	Ga0496101_0044829	Ga0496101_0044829_713_1729	336
335	3300048905	Ga0496102_0000559	Ga0496102_0000559_1573_2589	336
336	3300048906	Ga0496103_0035361	Ga0496103_0035361_1098_2114	336
337	3300048910	Ga0496107_0044709	Ga0496107_0044709_1566_2582	336
338	3300048915	Ga0496112_0283874	Ga0496112_0283874_524_1534	336
339	3300048917	Ga0496114_0072062	Ga0496114_0072062_1149_2165	336
340	3300048919	Ga0496116_0018478	Ga0496116_0018478_15_1031	336
341	3300048920	Ga0496117_0005020	Ga0496117_0005020_11056_12072	336
342	3300048921	Ga0496118_0004348	Ga0496118_0004348_1752_2768	336
343	3300048924	Ga0496121_0000436	Ga0496121_0000436_6451_7518	336
344	3300048924	Ga0496121_0017638	Ga0496121_0017638_1296_2312	336
345	3300048929	Ga0496126_0002253	Ga0496126_0002253_22432_23499	336
346	3300049570	Ga0501033_0042712	Ga0501033_0042712_1326_2396	336
347	3300049581	Ga0501047_0015367	Ga0501047_0015367_4025_5095	336
348	3300049581	Ga0501047_0297883	Ga0501047_0297883_305_1351	336
349	3300049822	Ga0501035_0000886	Ga0501035_0000886_23226_24296	336
350	3300049823	Ga0501044_0000313	Ga0501044_0000313_8604_9674	336
351	3300006048	Ga0075363_100014740	Ga0075363_1000147402	337
352	3300006051	Ga0075364_10000646	Ga0075364_1000064614	337
353	3300031728	Ga0316578_10069161	Ga0316578_100691613	337
354	3300048907	Ga0496104_0371474	Ga0496104_0371474_195_1220	337
355	3300049589	Ga0501073_0160770	Ga0501073_0160770_365_1378	337
356	3300050490	nmdc:mga03n38_77128_c1	nmdc:mga03n38_77128_c1_354_1370	337
357	3300005440	Ga0070705_100052338	Ga0070705_1000523382	338
358	3300006048	Ga0075363_100012212	Ga0075363_1000122122	338
359	3300009176	Ga0105242_10037522	Ga0105242_100375224	338
360	3300025303	Ga0209051_1039635	Ga0209051_10396352	338
361	3300025934	Ga0207686_10023936	Ga0207686_100239364	338
362	3300039450	Ga0436363_1339027	Ga0436363_1339027_1353_2369	338
363	3300046455	Ga0495603_0021703	Ga0495603_0021703_490_1518	338
364	3300046459	Ga0495629_0005393	Ga0495629_0005393_4046_5074	338
365	3300046683	Ga0495658_0098822	Ga0495658_0098822_69_1097	338
366	3300046690	Ga0495624_0029982	Ga0495624_0029982_356_1384	338
367	3300047315	Ga0495581_0148982	Ga0495581_0148982_281_1309	338
368	3300048921	Ga0496118_0000272	Ga0496118_0000272_40312_41331	338
369	3300048929	Ga0496126_0001476	Ga0496126_0001476_8373_9404	338
370	3300050490	nmdc:mga03n38_48480_c1	nmdc:mga03n38_48480_c1_248_1264	338
371	3300050491	nmdc:mga00v17_19915_c1	nmdc:mga00v17_19915_c1_1366_2382	338
372	3300050496	nmdc:mga07m45_10261_c1	nmdc:mga07m45_10261_c1_3319_4335	338
373	3300006051	Ga0075364_10000830	Ga0075364_100008306	339
374	3300006846	Ga0075430_100173665	Ga0075430_1001736652	339
375	3300031824	Ga0307413_10031030	Ga0307413_100310303	339
376	3300031995	Ga0307409_100170574	Ga0307409_1001705742	339
377	3300041411	Ga0439466_0003797	Ga0439466_0003797_2959_3987	339
378	3300041413	Ga0439465_0003080	Ga0439465_0003080_3176_4204	339
379	3300044765	Ga0466970_0005808	Ga0466970_0005808_4364_5389	339
380	3300045976	Ga0466967_0082323	Ga0466967_0082323_1194_2261	339
381	3300045976	Ga0466967_0345884	Ga0466967_0345884_99_1121	339
382	3300050491	nmdc:mga00v17_709_c1	nmdc:mga00v17_709_c1_2577_3596	339
383	3300061719	Ga0466962_0079199	Ga0466962_0079199_332_1399	339
384	3300006038	Ga0075365_10028157	Ga0075365_100281572	340
385	3300006051	Ga0075364_10012338	Ga0075364_100123385	340
386	3300006051	Ga0075364_10168410	Ga0075364_101684102	340
387	3300006178	Ga0075367_10004929	Ga0075367_100049294	340
388	3300021384	Ga0213876_10041336	Ga0213876_100413362	340
389	3300027866	Ga0209813_10004805	Ga0209813_100048052	340
390	3300031548	Ga0307408_100373612	Ga0307408_1003736121	340
391	3300031995	Ga0307409_100454973	Ga0307409_1004549731	340
392	3300032002	Ga0307416_100011936	Ga0307416_1000119366	340
393	3300032126	Ga0307415_100155175	Ga0307415_1001551752	340
394	3300039437	Ga0436365_0502806	Ga0436365_0502806_4820_5845	340
395	3300044683	Ga0466965_0000791	Ga0466965_0000791_2884_3909	340
396	3300044901	Ga0466960_0000170	Ga0466960_0000170_20010_21035	340
397	3300050490	nmdc:mga03n38_1099_c1	nmdc:mga03n38_1099_c1_1400_2422	340
398	3300050490	nmdc:mga03n38_57262_c1	nmdc:mga03n38_57262_c1_444_1466	340
399	3300050495	nmdc:mga04h51_4875_c1	nmdc:mga04h51_4875_c1_1652_2674	340
400	3300050496	nmdc:mga07m45_1536_c1	nmdc:mga07m45_1536_c1_2427_3449	340
401	3300005355	Ga0070671_100000693	Ga0070671_1000006933	341
402	3300005367	Ga0070667_100008453	Ga0070667_10000845310	341
403	3300005367	Ga0070667_100145455	Ga0070667_1001454552	341
404	3300005544	Ga0070686_100050066	Ga0070686_1000500661	341
405	3300005841	Ga0068863_100011571	Ga0068863_10001157111	341
406	3300005841	Ga0068863_100283984	Ga0068863_1002839842	341
407	3300005937	Ga0081455_10148773	Ga0081455_101487732	341
408	3300006038	Ga0075365_10069696	Ga0075365_100696962	341
409	3300006051	Ga0075364_10066996	Ga0075364_100669962	341
410	3300006186	Ga0075369_10006532	Ga0075369_100065326	341
411	3300025931	Ga0207644_10086647	Ga0207644_100866471	341
412	3300025972	Ga0207668_10067667	Ga0207668_100676672	341
413	3300025986	Ga0207658_10048283	Ga0207658_100482832	341
414	3300025986	Ga0207658_10060160	Ga0207658_100601602	341
415	3300027907	Ga0207428_10089813	Ga0207428_100898132	341
416	3300044658	Ga0466972_0016633	Ga0466972_0016633_2304_3329	341
417	3300044683	Ga0466965_0021397	Ga0466965_0021397_1446_2471	341
418	3300044684	Ga0466966_0024120	Ga0466966_0024120_364_1389	341
419	3300044693	Ga0466961_0063522	Ga0466961_0063522_965_1990	341
420	3300044706	Ga0466964_0075746	Ga0466964_0075746_223_1248	341
421	3300045836	Ga0466958_0111292	Ga0466958_0111292_321_1346	341
422	3300045976	Ga0466967_0264799	Ga0466967_0264799_451_1482	341
423	3300048903	Ga0496100_0210782	Ga0496100_0210782_352_1383	341
424	3300048904	Ga0496101_0003805	Ga0496101_0003805_1779_2807	341
425	3300048907	Ga0496104_0001343	Ga0496104_0001343_1779_2807	341
426	3300048908	Ga0496105_0016133	Ga0496105_0016133_3554_4582	341
427	3300048909	Ga0496106_0037664	Ga0496106_0037664_1132_2160	341
428	3300048910	Ga0496107_0005364	Ga0496107_0005364_483_1511	341
429	3300048914	Ga0496111_0035785	Ga0496111_0035785_1669_2700	341
430	3300048922	Ga0496119_0071518	Ga0496119_0071518_187_1218	341
431	3300049823	Ga0501044_0015683	Ga0501044_0015683_424_1464	341
432	3300061719	Ga0466962_0087658	Ga0466962_0087658_160_1185	341
433	3300001977	JGI24746J21847_1009268	JGI24746J21847_10092681	342
434	3300002073	JGI24745J21846_1004759	JGI24745J21846_10047592	342
435	3300002077	JGI24744J21845_10002315	JGI24744J21845_100023152	342
436	3300005337	Ga0070682_100028716	Ga0070682_1000287163	342
437	3300005338	Ga0068868_100316307	Ga0068868_1003163072	342
438	3300005347	Ga0070668_100241379	Ga0070668_1002413791	342
439	3300005364	Ga0070673_100040026	Ga0070673_1000400262	342
440	3300005367	Ga0070667_100112045	Ga0070667_1001120452	342
441	3300005444	Ga0070694_100195770	Ga0070694_1001957702	342
442	3300005457	Ga0070662_100034724	Ga0070662_1000347242	342
443	3300005539	Ga0068853_100052480	Ga0068853_1000524802	342
444	3300005546	Ga0070696_100059255	Ga0070696_1000592553	342
445	3300005578	Ga0068854_100021731	Ga0068854_1000217313	342
446	3300005615	Ga0070702_100149660	Ga0070702_1001496601	342
447	3300005616	Ga0068852_100090914	Ga0068852_1000909142	342
448	3300005718	Ga0068866_10106321	Ga0068866_101063212	342
449	3300005719	Ga0068861_100220854	Ga0068861_1002208542	342
450	3300005834	Ga0068851_10044602	Ga0068851_100446023	342
451	3300005843	Ga0068860_100137337	Ga0068860_1001373371	342
452	3300005844	Ga0068862_100002241	Ga0068862_1000022417	342
453	3300006163	Ga0070715_10085760	Ga0070715_100857601	342
454	3300006173	Ga0070716_100024227	Ga0070716_1000242271	342
455	3300006175	Ga0070712_100024681	Ga0070712_1000246814	342
456	3300006186	Ga0075369_10059420	Ga0075369_100594202	342
457	3300006358	Ga0068871_100042834	Ga0068871_1000428342	342
458	3300006847	Ga0075431_100085700	Ga0075431_1000857002	342
459	3300017792	Ga0163161_10001587	Ga0163161_1000158711	342
460	3300017792	Ga0163161_10154123	Ga0163161_101541232	342
461	3300025901	Ga0207688_10004739	Ga0207688_100047393	342
462	3300025905	Ga0207685_10027168	Ga0207685_100271682	342
463	3300025906	Ga0207699_10018351	Ga0207699_100183514	342
464	3300025907	Ga0207645_10026537	Ga0207645_100265372	342
465	3300025915	Ga0207693_10000771	Ga0207693_1000077112	342
466	3300025933	Ga0207706_10018726	Ga0207706_100187263	342
467	3300025935	Ga0207709_10199907	Ga0207709_101999071	342
468	3300025939	Ga0207665_10002506	Ga0207665_1000250612	342
469	3300025940	Ga0207691_10074238	Ga0207691_100742382	342
470	3300025942	Ga0207689_10002479	Ga0207689_1000247918	342
471	3300025972	Ga0207668_10092469	Ga0207668_100924692	342
472	3300026067	Ga0207678_10016657	Ga0207678_100166577	342
473	3300026089	Ga0207648_10061869	Ga0207648_100618692	342
474	3300026118	Ga0207675_100053810	Ga0207675_1000538103	342
475	3300026121	Ga0207683_10008125	Ga0207683_100081258	342
476	3300026142	Ga0207698_10251454	Ga0207698_102514542	342
477	3300028379	Ga0268266_10038324	Ga0268266_100383244	342
478	3300028380	Ga0268265_10274088	Ga0268265_102740882	342
479	3300041411	Ga0439466_0000727	Ga0439466_0000727_5131_6162	342
480	3300041413	Ga0439465_0003375	Ga0439465_0003375_3993_5024	342
481	3300041997	Ga0439431_0009623	Ga0439431_0009623_23_1054	342
482	3300042002	Ga0439442_002888	Ga0439442_002888_2276_3307	342
483	3300042004	Ga0439445_0015124	Ga0439445_0015124_117_1148	342
484	3300042435	Ga0439434_0004878	Ga0439434_0004878_1540_2571	342
485	3300046455	Ga0495603_0002803	Ga0495603_0002803_4465_5538	342
486	3300046459	Ga0495629_0004685	Ga0495629_0004685_4486_5559	342
487	3300046689	Ga0495613_0011838	Ga0495613_0011838_3129_4202	342
488	3300047321	Ga0495676_0012248	Ga0495676_0012248_1068_2141	342
489	3300048089	Ga0495614_0007819	Ga0495614_0007819_1247_2320	342
490	3300050516	nmdc:mga0sz30_16089_c1	nmdc:mga0sz30_16089_c1_890_1918	342
491	iso_pu_bacteria	2643221578	2643901519	342
492	iso_pu_bacteria	2643221673	2644407665	342
493	iso_pu_bacteria	2875391855	2875398087	342
494	iso_pu_bacteria	2946045630	2946046399	342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20628

Dyp_perox_C

Dyp-type peroxidase, C-terminal

185

349

0.98 PF04261

Dyp_perox_N

Dyp-type peroxidase, N-terminal

53

182

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7bok-assembly1.cif.gz_A	cryo-em structure of the encapsulated dyp-type peroxidase from mycobacterium smegmatis	0.9792	3	310
6yr4-assembly1.cif.gz_C	dye-type peroxidase dtpb in the ferryl state: spectroscopically validated composite structure	0.9784	4	305
7qzf-assembly1.cif.gz_C	sfx structure of dye-type peroxidase dtpb d152a/n245a variant in the ferric state	0.9782	4	305
7zmj-assembly1.cif.gz_A	sfx structure of dye-type peroxidase dtpb r243a variant in the ferric state	0.9778	4	305
7qzg-assembly1.cif.gz_D	sfx structure of dye-type peroxidase dtpb n245a variant in the ferric state	0.976	4	305

ID	Description	Score	Start	End	Superfamily
af_F4J1H2_92_173_3.30.1370.10	Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1	0.6607	93	122	3.30.1370.10
5loqB02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1	0.6553	14	137	3.30.70.1030
af_Q9GZD5_39_207_2.40.160.110	Mainly Beta;Beta Barrel;Porin;	0.6483	236	258	2.40.160.110
af_Q8IHR6_950_1067_3.30.310.10	Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein	0.6363	235	271	3.30.310.10
af_Q4DTP4_747_863_3.30.310.10	Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein	0.6354	224	271	3.30.310.10

ID	Description	Score	Start	End	GO Terms
AF-A0A536L890-F1-model_v4	Dyp-type peroxidase	0.9933	200	303	GO:0004601 GO:0005829 GO:0020037 GO:0046872
AF-T0YK82-F1-model_v4	Dyp-type peroxidase (EC 1.11.1.-)	0.9924	194	292	GO:0004601 GO:0005829 GO:0020037 GO:0046872
AF-A0A4R2H4I8-F1-model_v4	Putative iron-dependent peroxidase	0.9881	2	310	GO:0004601 GO:0005829 GO:0020037 GO:0046872
AF-A0A6P1CWB1-F1-model_v4	Peroxidase	0.9871	6	119	GO:0004601 GO:0005829 GO:0020037
AF-A0A841JKC0-F1-model_v4	Dyp-type peroxidase family	0.9859	162	305	GO:0004601 GO:0005829 GO:0020037 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
88.08	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F454539

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF20628

Dyp_perox_C

Dyp-type peroxidase, C-terminal

185

349

0.98

PF04261

Dyp_perox_N

Dyp-type peroxidase, N-terminal

53

182

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map