F454553

General Info

Members Datasets Scaffolds Average Seq Length
494 242 988 252

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100032389|Ga0075428_1000323895
Length 286
Sequence MIRSLQEEEPRNPCAAGKASAKHMLEIVNPVVVGGIAAACIFFGILLCLVLGRRLGQRSLARHGAVGVSNIGSLEAAVFGLLGLLIAFTFSGALSRFDVRRNQVVDEANAIGTAYLRIDLLPASTQPPLRETFRKYVDARIETYRALPDLEAAHRELVRSQDLQRQIWTQSVAAIHMPESRPGAELLVVPGLNQMFDITTVRMVATRIHPPLIVYGMLIALALASAFLAGYQSAGEKDYDWVHKIGFAGIVAFTVYVILDIEYPRLGWVRLDAIDQVLVDVRAGMN

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2928963466 Dyella japonica 1073 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.82
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 11.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100032389 3300006844 Bacteria 5773
2 MBSR1b_contig_10092069 2162886012 Bacteria 1221
3 Ga0065712_10170489 3300005290 Bacteria 1228
4 Ga0065715_10104305 3300005293 Unclassified 2972
5 Ga0070676_10006212 3300005328 Bacteria 6381
6 Ga0070683_100044552 3300005329 Bacteria 4091
7 Ga0070683_100387918 3300005329 Bacteria 1331
8 Ga0070683_100448123 3300005329 Bacteria 1232
9 Ga0070690_100000472 3300005330 Bacteria 20208
10 Ga0070690_100003159 3300005330 Bacteria 8973
11 Ga0070690_100003197 3300005330 Bacteria 8932
12 Ga0070690_100048488 3300005330 Bacteria 2705
13 Ga0070670_100025791 3300005331 Bacteria 5058
14 Ga0070677_10027063 3300005333 Bacteria 2156
15 Ga0068869_100000410 3300005334 Bacteria 23340
16 Ga0068869_100022840 3300005334 Bacteria 4314
17 Ga0070666_10060907 3300005335 Bacteria 2555
18 Ga0070666_10161889 3300005335 Unclassified 1564
19 Ga0070680_100003471 3300005336 Bacteria 11771
20 Ga0070680_100006482 3300005336 Bacteria 8902
21 Ga0070680_100043244 3300005336 Bacteria 3659
22 Ga0070682_100017355 3300005337 Bacteria 4194
23 Ga0068868_100000209 3300005338 Bacteria 39624
24 Ga0068868_100106856 3300005338 Bacteria 2271
25 Ga0070660_100014758 3300005339 Bacteria 5635
26 Ga0070660_100017975 3300005339 Bacteria 5159
27 Ga0070689_100000614 3300005340 Bacteria 21600
28 Ga0070689_100006112 3300005340 Bacteria 8298
29 Ga0070689_100015234 3300005340 Bacteria 5603
30 Ga0070691_10001516 3300005341 Bacteria 9987
31 Ga0070691_10051095 3300005341 Bacteria 1973
32 Ga0070687_100000190 3300005343 Bacteria 21399
33 Ga0070687_100001061 3300005343 Bacteria 9414
34 Ga0070661_100020597 3300005344 Bacteria 4705
35 Ga0070692_10001339 3300005345 Bacteria 8876
36 Ga0070692_10008470 3300005345 Bacteria 4591
37 Ga0070692_10015733 3300005345 Bacteria 3584
38 Ga0070668_100004402 3300005347 Bacteria 10455
39 Ga0070668_100010824 3300005347 Bacteria 6786
40 Ga0070668_100682198 3300005347 Unclassified 905
41 Ga0070669_100009844 3300005353 Bacteria 6808
42 Ga0070669_100016102 3300005353 Bacteria 5333
43 Ga0070669_100027587 3300005353 Bacteria 4087
44 Ga0070669_100154427 3300005353 Bacteria 1779
45 Ga0070675_100027335 3300005354 Bacteria 4583
46 Ga0070675_100206811 3300005354 Bacteria 1705
47 Ga0070675_100226096 3300005354 Bacteria 1631
48 Ga0070671_100023702 3300005355 Bacteria 5024
49 Ga0070671_100298770 3300005355 Bacteria 1371
50 Ga0070674_100002804 3300005356 Bacteria 9634
51 Ga0070673_100004817 3300005364 Bacteria 8580
52 Ga0070688_100004485 3300005365 Bacteria 7274
53 Ga0070688_100096989 3300005365 Bacteria 1937
54 Ga0070688_100145914 3300005365 Bacteria 1612
55 Ga0070659_100024242 3300005366 Bacteria 4650
56 Ga0070659_100034255 3300005366 Bacteria 3949
57 Ga0070667_100010137 3300005367 Bacteria 7795
58 Ga0070667_100372784 3300005367 Bacteria 1295
59 Ga0070703_10037428 3300005406 Bacteria 1495
60 Ga0070701_10002341 3300005438 Bacteria 7272
61 Ga0070701_10023515 3300005438 Bacteria 2969
62 Ga0070701_10075321 3300005438 Bacteria 1814
63 Ga0070711_100046639 3300005439 Bacteria 2953
64 Ga0070705_100000320 3300005440 Bacteria 28430
65 Ga0070705_100001556 3300005440 Bacteria 12024
66 Ga0070705_100044488 3300005440 Bacteria 2550
67 Ga0070700_100000571 3300005441 Bacteria 18444
68 Ga0070700_100004319 3300005441 Bacteria 7417
69 Ga0070700_100113060 3300005441 Bacteria 1808
70 Ga0070700_100117995 3300005441 Bacteria 1774
71 Ga0070700_100186821 3300005441 Unclassified 1446
72 Ga0070700_100213224 3300005441 Bacteria 1364
73 Ga0070694_100000077 3300005444 Bacteria 47645
74 Ga0070694_100018243 3300005444 Bacteria 4452
75 Ga0070694_100028542 3300005444 Bacteria 3632
76 Ga0070694_100122034 3300005444 Bacteria 1871
77 Ga0070694_100520508 3300005444 Bacteria 949
78 Ga0070708_100042497 3300005445 Bacteria 3990
79 Ga0070708_100664778 3300005445 Bacteria 981
80 Ga0070663_100001684 3300005455 Bacteria 12267
81 Ga0070663_100072084 3300005455 Bacteria 2515
82 Ga0070678_100001194 3300005456 Bacteria 13826
83 Ga0070678_100006807 3300005456 Bacteria 6737
84 Ga0070678_100006989 3300005456 Bacteria 6663
85 Ga0070681_10036728 3300005458 Bacteria 4919
86 Ga0070681_10071518 3300005458 Bacteria 3433
87 Ga0070681_10328360 3300005458 Bacteria 1439
88 Ga0068867_100000107 3300005459 Bacteria 53378
89 Ga0068867_100002779 3300005459 Bacteria 12309
90 Ga0070685_10012897 3300005466 Bacteria 4399
91 Ga0070685_10125564 3300005466 Bacteria 1598
92 Ga0070706_100034156 3300005467 Bacteria 4696
93 Ga0070679_100002529 3300005530 Bacteria 16578
94 Ga0070697_100030566 3300005536 Bacteria 4327
95 Ga0068853_100129078 3300005539 Bacteria 2261
96 Ga0068853_100133225 3300005539 Bacteria 2226
97 Ga0068853_100454520 3300005539 Bacteria 1205
98 Ga0070672_100003792 3300005543 Bacteria 9838
99 Ga0070672_100032011 3300005543 Bacteria 3965
100 Ga0070672_100066933 3300005543 Bacteria 2845
101 Ga0070672_100269620 3300005543 Bacteria 1437
102 Ga0070686_100000825 3300005544 Bacteria 17899
103 Ga0070686_100045421 3300005544 Bacteria 2767
104 Ga0070686_100491732 3300005544 Bacteria 950
105 Ga0070686_100675896 3300005544 Bacteria 821
106 Ga0070695_100000457 3300005545 Bacteria 21293
107 Ga0070695_100025176 3300005545 Unclassified 3673
108 Ga0070695_100102986 3300005545 Bacteria 1925
109 Ga0070696_100001446 3300005546 Bacteria 15542
110 Ga0070696_100003445 3300005546 Bacteria 10528
111 Ga0070693_100000040 3300005547 Bacteria 49709
112 Ga0070693_100188855 3300005547 Bacteria 1331
113 Ga0070665_100000167 3300005548 Bacteria 119817
114 Ga0070704_100003720 3300005549 Bacteria 8789
115 Ga0068855_100005158 3300005563 Bacteria 15933
116 Ga0068855_100085252 3300005563 Bacteria 3656
117 Ga0068855_100090924 3300005563 Bacteria 3521
118 Ga0070664_100023786 3300005564 Bacteria 5061
119 Ga0070664_100092755 3300005564 Bacteria 2615
120 Ga0068857_100001320 3300005577 Bacteria 19510
121 Ga0068857_100130183 3300005577 Bacteria 2269
122 Ga0068854_100000693 3300005578 Bacteria 20011
123 Ga0068854_100004898 3300005578 Bacteria 8445
124 Ga0068854_100086641 3300005578 Bacteria 2322
125 Ga0068856_100045174 3300005614 Bacteria 4336
126 Ga0068856_100410188 3300005614 Bacteria 1374
127 Ga0070702_100000050 3300005615 Bacteria 32860
128 Ga0070702_100138521 3300005615 Bacteria 1547
129 Ga0068852_100000255 3300005616 Bacteria 36037
130 Ga0068852_100341699 3300005616 Unclassified 1459
131 Ga0068859_100000332 3300005617 Bacteria 47130
132 Ga0068859_100004149 3300005617 Bacteria 14799
133 Ga0068859_100006983 3300005617 Bacteria 11464
134 Ga0068859_100177798 3300005617 Bacteria 2210
135 Ga0068864_100018377 3300005618 Bacteria 5840
136 Ga0068866_10001291 3300005718 Bacteria 10845
137 Ga0068866_10002275 3300005718 Bacteria 7956
138 Ga0068861_100000100 3300005719 Bacteria 42431
139 Ga0068861_100000549 3300005719 Bacteria 22123
140 Ga0068861_100031573 3300005719 Bacteria 3892
141 Ga0068861_100136854 3300005719 Bacteria 1994
142 Ga0068851_10013250 3300005834 Bacteria 3901
143 Ga0068870_10006180 3300005840 Bacteria 5265
144 Ga0068870_10031554 3300005840 Bacteria 2686
145 Ga0068863_100028593 3300005841 Bacteria 5322
146 Ga0068863_100035539 3300005841 Bacteria 4746
147 Ga0068863_100093107 3300005841 Bacteria 2860
148 Ga0068863_100168837 3300005841 Bacteria 2098
149 Ga0068858_100004862 3300005842 Bacteria 13176
150 Ga0068858_100104856 3300005842 Bacteria 2638
151 Ga0068858_100348118 3300005842 Bacteria 1419
152 Ga0068858_100408015 3300005842 Bacteria 1306
153 Ga0068858_100828038 3300005842 Archaea 903
154 Ga0068860_100070726 3300005843 Bacteria 3317
155 Ga0068860_100123746 3300005843 Unclassified 2478
156 Ga0068860_100150773 3300005843 Bacteria 2239
157 Ga0068860_100318878 3300005843 Bacteria 1525
158 Ga0068860_100466955 3300005843 Unclassified 1256
159 Ga0068862_100003390 3300005844 Bacteria 13741
160 Ga0068862_100011446 3300005844 Bacteria 7322
161 Ga0068862_100534191 3300005844 Bacteria 1118
162 Ga0081540_1000558 3300005983 Bacteria 36128
163 Ga0075365_10344493 3300006038 Bacteria 1050
164 Ga0097621_100000676 3300006237 Bacteria 23878
165 Ga0097621_100003787 3300006237 Bacteria 10478
166 Ga0097621_100040992 3300006237 Bacteria 3725
167 Ga0097621_100649413 3300006237 Unclassified 968
168 Ga0068871_100000238 3300006358 Bacteria 38970
169 Ga0068871_100001226 3300006358 Bacteria 17113
170 Ga0068871_100015707 3300006358 Bacteria 5679
171 Ga0068871_100052300 3300006358 Bacteria 3308
172 Ga0068871_100058965 3300006358 Bacteria 3127
173 Ga0075428_100004117 3300006844 Bacteria 16009
174 Ga0075428_100384683 3300006844 Unclassified 1504
175 Ga0075428_100521801 3300006844 Unclassified 1270
176 Ga0075430_100019091 3300006846 Bacteria 5831
177 Ga0075431_100000994 3300006847 Bacteria 25257
178 Ga0075431_100010101 3300006847 Bacteria 9486
179 Ga0075431_100328343 3300006847 Bacteria 1541
180 Ga0075433_10010304 3300006852 Bacteria 7496
181 Ga0075433_10029402 3300006852 Bacteria 4681
182 Ga0075434_100044229 3300006871 Bacteria 4418
183 Ga0075434_100196615 3300006871 Bacteria 2036
184 Ga0075434_100432395 3300006871 Unclassified 1337
185 Ga0075429_100002612 3300006880 Bacteria 15188
186 Ga0075429_100029583 3300006880 Bacteria 4757
187 Ga0068865_100000571 3300006881 Bacteria 20589
188 Ga0068865_100001561 3300006881 Bacteria 13390
189 Ga0068865_100026822 3300006881 Bacteria 3801
190 Ga0068865_100480818 3300006881 Bacteria 1032
191 Ga0097620_100000332 3300006931 Bacteria 47130
192 Ga0097620_100004149 3300006931 Bacteria 14799
193 Ga0097620_100006983 3300006931 Bacteria 11464
194 Ga0097620_100177796 3300006931 Bacteria 2210
195 Ga0075435_100011247 3300007076 Bacteria 6571
196 Ga0075435_100040179 3300007076 Bacteria 3734
197 Ga0105240_10247972 3300009093 Bacteria 2061
198 Ga0111539_10097614 3300009094 Bacteria 3451
199 Ga0111539_10138276 3300009094 Bacteria 2853
200 Ga0111539_10367680 3300009094 Unclassified 1674
201 Ga0111539_10476152 3300009094 Unclassified 1454
202 Ga0105245_10000115 3300009098 Bacteria 77632
203 Ga0105245_10000482 3300009098 Bacteria 36560
204 Ga0105245_10013137 3300009098 Bacteria 7216
205 Ga0105247_10000388 3300009101 Bacteria 37351
206 Ga0114129_10189764 3300009147 Unclassified 2791
207 Ga0114129_10450055 3300009147 Bacteria 1689
208 Ga0114129_10546737 3300009147 Unclassified 1506
209 Ga0105243_10000035 3300009148 Bacteria 177598
210 Ga0105243_10004331 3300009148 Bacteria 11242
211 Ga0105243_10011190 3300009148 Bacteria 6787
212 Ga0105241_10021871 3300009174 Bacteria 4733
213 Ga0105241_10102552 3300009174 Bacteria 2277
214 Ga0105242_10000268 3300009176 Bacteria 41263
215 Ga0105242_10001933 3300009176 Bacteria 16293
216 Ga0105242_10004528 3300009176 Bacteria 10796
217 Ga0105248_10042121 3300009177 Bacteria 5121
218 Ga0105248_10069953 3300009177 Bacteria 3941
219 Ga0105248_10250327 3300009177 Bacteria 1994
220 Ga0105248_10251323 3300009177 Bacteria 1990
221 Ga0105248_10325447 3300009177 Bacteria 1731
222 Ga0105248_10447028 3300009177 Bacteria 1456
223 Ga0105237_10264859 3300009545 Unclassified 1722
224 Ga0105238_10085984 3300009551 Bacteria 3132
225 Ga0105238_10554951 3300009551 Bacteria 1153
226 Ga0105249_10002683 3300009553 Bacteria 15379
227 Ga0105249_10007315 3300009553 Bacteria 9625
228 Ga0105239_10016952 3300010375 Bacteria 8053
229 Ga0105239_10045325 3300010375 Bacteria 4820
230 Ga0105246_10001139 3300011119 Bacteria 15420
231 Ga0105246_10006498 3300011119 Bacteria 7137
232 Ga0157373_10015100 3300013100 Bacteria 5647
233 Ga0157373_10062156 3300013100 Bacteria 2645
234 Ga0157371_10030697 3300013102 Bacteria 3875
235 Ga0157371_10111640 3300013102 Bacteria 1940
236 Ga0157369_10009916 3300013105 Bacteria 10884
237 Ga0157369_10068940 3300013105 Unclassified 3800
238 Ga0157374_10008067 3300013296 Bacteria 9003
239 Ga0157374_10266212 3300013296 Bacteria 1689
240 Ga0157374_10589071 3300013296 Unclassified 1121
241 Ga0157378_10001030 3300013297 Bacteria 25495
242 Ga0157378_10024685 3300013297 Bacteria 5293
243 Ga0157378_10025219 3300013297 Bacteria 5238
244 Ga0157378_10060457 3300013297 Bacteria 3381
245 Ga0157378_10458837 3300013297 Bacteria 1266
246 Ga0163162_10198771 3300013306 Bacteria 2133
247 Ga0163162_10345723 3300013306 Unclassified 1620
248 Ga0163162_10816550 3300013306 Bacteria 1049
249 Ga0157375_10041632 3300013308 Bacteria 4438
250 Ga0157375_10057101 3300013308 Bacteria 3857
251 Ga0157375_10158367 3300013308 Bacteria 2405
252 Ga0157375_10477856 3300013308 Bacteria 1411
253 Ga0157375_11059040 3300013308 Bacteria 948
254 Ga0163163_10106936 3300014325 Unclassified 2824
255 Ga0157380_10010889 3300014326 Bacteria 6557
256 Ga0157380_10019992 3300014326 Bacteria 4998
257 Ga0157380_10034934 3300014326 Bacteria 3879
258 Ga0157380_10133671 3300014326 Bacteria 2120
259 Ga0157380_10637654 3300014326 Bacteria 1061
260 Ga0157377_10000443 3300014745 Bacteria 17886
261 Ga0157377_10109548 3300014745 Bacteria 1658
262 Ga0157379_10005394 3300014968 Bacteria 10980
263 Ga0157376_10000582 3300014969 Bacteria 23542
264 Ga0157376_10002049 3300014969 Bacteria 13520
265 Ga0157376_10004574 3300014969 Bacteria 9631
266 Ga0157376_10028852 3300014969 Bacteria 4415
267 Ga0163161_10001181 3300017792 Bacteria 19617
268 Ga0207697_10000176 3300025315 Bacteria 32694
269 Ga0207656_10002891 3300025321 Bacteria 5855
270 Ga0207682_10029884 3300025893 Bacteria 2180
271 Ga0207642_10000874 3300025899 Bacteria 9417
272 Ga0207688_10000191 3300025901 Bacteria 27075
273 Ga0207688_10010499 3300025901 Bacteria 5037
274 Ga0207680_10060790 3300025903 Bacteria 2301
275 Ga0207647_10006169 3300025904 Bacteria 8732
276 Ga0207645_10000066 3300025907 Bacteria 76090
277 Ga0207645_10000595 3300025907 Bacteria 29991
278 Ga0207643_10000020 3300025908 Bacteria 107342
279 Ga0207643_10049662 3300025908 Bacteria 2377
280 Ga0207705_10018250 3300025909 Bacteria 5017
281 Ga0207654_10021724 3300025911 Unclassified 3416
282 Ga0207707_10027959 3300025912 Bacteria 4932
283 Ga0207707_10054425 3300025912 Bacteria 3483
284 Ga0207671_10034477 3300025914 Bacteria 3760
285 Ga0207663_10141832 3300025916 Bacteria 1675
286 Ga0207663_10318508 3300025916 Bacteria 1168
287 Ga0207660_10003008 3300025917 Bacteria 11029
288 Ga0207660_10082345 3300025917 Bacteria 2367
289 Ga0207662_10000017 3300025918 Bacteria 75622
290 Ga0207662_10000333 3300025918 Bacteria 21392
291 Ga0207657_10000040 3300025919 Bacteria 119777
292 Ga0207657_10017386 3300025919 Bacteria 6899
293 Ga0207649_10007364 3300025920 Bacteria 5988
294 Ga0207652_10069170 3300025921 Bacteria 3065
295 Ga0207646_10031390 3300025922 Bacteria 4809
296 Ga0207681_10002562 3300025923 Bacteria 11539
297 Ga0207681_10031466 3300025923 Bacteria 3465
298 Ga0207681_10071832 3300025923 Bacteria 2415
299 Ga0207681_10163642 3300025923 Unclassified 1680
300 Ga0207681_10174820 3300025923 Unclassified 1631
301 Ga0207694_10060942 3300025924 Bacteria 2937
302 Ga0207650_10007703 3300025925 Bacteria 7337
303 Ga0207650_10008474 3300025925 Bacteria 7020
304 Ga0207659_10007637 3300025926 Bacteria 6671
305 Ga0207659_10011593 3300025926 Bacteria 5575
306 Ga0207687_10001542 3300025927 Bacteria 15813
307 Ga0207687_10076617 3300025927 Bacteria 2403
308 Ga0207644_10170981 3300025931 Viruses 1696
309 Ga0207690_10006627 3300025932 Bacteria 6861
310 Ga0207706_10001090 3300025933 Bacteria 27564
311 Ga0207706_10001297 3300025933 Bacteria 25186
312 Ga0207686_10002255 3300025934 Bacteria 10576
313 Ga0207686_10008783 3300025934 Bacteria 5460
314 Ga0207709_10000917 3300025935 Bacteria 22229
315 Ga0207709_10067230 3300025935 Bacteria 2261
316 Ga0207670_10000311 3300025936 Bacteria 29168
317 Ga0207670_10041144 3300025936 Bacteria 3038
318 Ga0207670_10105740 3300025936 Bacteria 2018
319 Ga0207669_10021102 3300025937 Bacteria 3430
320 Ga0207669_10024139 3300025937 Bacteria 3263
321 Ga0207669_10591210 3300025937 Unclassified 901
322 Ga0207704_10000141 3300025938 Bacteria 38563
323 Ga0207704_10018664 3300025938 Unclassified 3626
324 Ga0207704_10113086 3300025938 Bacteria 1840
325 Ga0207704_10157850 3300025938 Bacteria 1610
326 Ga0207691_10000207 3300025940 Bacteria 56952
327 Ga0207691_10000692 3300025940 Bacteria 33334
328 Ga0207691_10056703 3300025940 Bacteria 3568
329 Ga0207711_10042532 3300025941 Bacteria 3872
330 Ga0207711_10172598 3300025941 Bacteria 1963
331 Ga0207711_10394180 3300025941 Bacteria 1286
332 Ga0207689_10000549 3300025942 Bacteria 35791
333 Ga0207689_10001634 3300025942 Bacteria 21241
334 Ga0207689_10001663 3300025942 Bacteria 21091
335 Ga0207661_10149489 3300025944 Unclassified 2018
336 Ga0207679_10007305 3300025945 Bacteria 7005
337 Ga0207679_10032232 3300025945 Bacteria 3676
338 Ga0207667_10001264 3300025949 Bacteria 31701
339 Ga0207651_10155975 3300025960 Bacteria 1783
340 Ga0207712_10051247 3300025961 Bacteria 2886
341 Ga0207668_10286399 3300025972 Unclassified 1353
342 Ga0207640_10008279 3300025981 Bacteria 5771
343 Ga0207640_10008647 3300025981 Bacteria 5660
344 Ga0207640_10012732 3300025981 Bacteria 4799
345 Ga0207658_10013513 3300025986 Bacteria 5579
346 Ga0207658_10029273 3300025986 Bacteria 3888
347 Ga0207658_10311565 3300025986 Bacteria 1360
348 Ga0207658_10428051 3300025986 Bacteria 1168
349 Ga0207677_10001096 3300026023 Bacteria 14748
350 Ga0207677_10002397 3300026023 Bacteria 9825
351 Ga0207677_10111969 3300026023 Bacteria 2034
352 Ga0207703_10000296 3300026035 Bacteria 54809
353 Ga0207703_10001682 3300026035 Bacteria 19893
354 Ga0207639_10159152 3300026041 Bacteria 1901
355 Ga0207678_10000845 3300026067 Bacteria 28081
356 Ga0207678_10069701 3300026067 Bacteria 3015
357 Ga0207708_10000114 3300026075 Bacteria 61971
358 Ga0207708_10000656 3300026075 Bacteria 26483
359 Ga0207708_10031633 3300026075 Bacteria 4017
360 Ga0207708_10069786 3300026075 Bacteria 2690
361 Ga0207708_10175911 3300026075 Bacteria 1697
362 Ga0207702_10003642 3300026078 Bacteria 13960
363 Ga0207641_10014849 3300026088 Bacteria 6383
364 Ga0207641_10070847 3300026088 Bacteria 2997
365 Ga0207641_10072859 3300026088 Bacteria 2959
366 Ga0207641_10076393 3300026088 Bacteria 2896
367 Ga0207641_10158050 3300026088 Bacteria 2058
368 Ga0207641_10220887 3300026088 Bacteria 1757
369 Ga0207648_10000113 3300026089 Bacteria 78626
370 Ga0207648_10001090 3300026089 Bacteria 30426
371 Ga0207648_10081976 3300026089 Bacteria 2813
372 Ga0207676_10000402 3300026095 Bacteria 36617
373 Ga0207676_10376685 3300026095 Unclassified 1320
374 Ga0207676_10509619 3300026095 Unclassified 1144
375 Ga0207674_10001435 3300026116 Bacteria 30790
376 Ga0207674_10015980 3300026116 Bacteria 8223
377 Ga0207675_100000017 3300026118 Bacteria 124338
378 Ga0207675_100000191 3300026118 Bacteria 55750
379 Ga0207675_100008911 3300026118 Bacteria 9413
380 Ga0207683_10000072 3300026121 Bacteria 78277
381 Ga0207683_10000081 3300026121 Bacteria 75875
382 Ga0207698_10193344 3300026142 Bacteria 1815
383 Ga0209969_1000434 3300027360 Bacteria 5596
384 Ga0209996_1000059 3300027395 Bacteria 15029
385 Ga0210000_1000155 3300027462 Bacteria 9695
386 Ga0209995_1000028 3300027471 Bacteria 22611
387 Ga0209968_1000100 3300027526 Bacteria 15730
388 Ga0209999_1001000 3300027543 Bacteria 4776
389 Ga0209970_1000688 3300027614 Bacteria 5874
390 Ga0210002_1000123 3300027617 Bacteria 12088
391 Ga0209966_1000196 3300027695 Bacteria 24998
392 Ga0209998_10000132 3300027717 Bacteria 28917
393 Ga0209974_10000471 3300027876 Bacteria 13396
394 Ga0207428_10005187 3300027907 Bacteria 12192
395 Ga0207428_10094902 3300027907 Bacteria 2311
396 Ga0268266_10000082 3300028379 Bacteria 205422
397 Ga0268266_10001053 3300028379 Bacteria 34569
398 Ga0268265_10027207 3300028380 Bacteria 4078
399 Ga0268265_10617117 3300028380 Bacteria 1038
400 Ga0268264_10015314 3300028381 Bacteria 6289
401 Ga0268264_10073240 3300028381 Unclassified 2906
402 Ga0268264_10109658 3300028381 Bacteria 2415
403 Ga0268264_10174860 3300028381 Bacteria 1945
404 Ga0265338_10004036 3300028800 Bacteria 20147
405 Ga0265328_10018307 3300031239 Bacteria 2703
406 Ga0265340_10096690 3300031247 Bacteria 1376
407 Ga0265339_10002360 3300031249 Bacteria 13557
408 Ga0265327_10012901 3300031251 Bacteria 5593
409 Ga0265316_10119344 3300031344 Bacteria 1992
410 Ga0373959_0043229 3300034820 Bacteria 952
411 Ga0373934_0000748 3300035086 Bacteria 11626
412 Ga0373923_0031474 3300035111 Unclassified 2139
413 Ga0373961_0007539 3300035241 Bacteria 2635
414 Ga0373931_0047059 3300035691 Bacteria 2282
415 Ga0373931_0286835 3300035691 Unclassified 1013
416 Ga0373927_0009047 3300035695 Bacteria 6686
417 Ga0373927_0154447 3300035695 Unclassified 1503
418 Ga0373947_0304306 3300035725 Unclassified 1064
419 Ga0373937_0443800 3300036401 Unclassified 1232
420 Ga0373925_0221301 3300037068 Unclassified 1511
421 Ga0439448_0047074 3300042005 Bacteria 1406
422 Ga0439450_034777 3300042008 Bacteria 1147
423 Ga0439458_0115892 3300042157 Unclassified 703
424 Ga0451577_0002655 3300042876 Bacteria 20946
425 Ga0451577_0090511 3300042876 Bacteria 2731
426 Ga0451577_0226626 3300042876 Bacteria 1690
427 Ga0451577_0268920 3300042876 Bacteria 1544
428 Ga0453684_0027488 3300044712 Bacteria 8156
429 Ga0453684_0666893 3300044712 Bacteria 1133
430 Ga0451576_0037812 3300045051 Bacteria 5111
431 Ga0451576_0049436 3300045051 Bacteria 4412
432 Ga0451576_0054190 3300045051 Unclassified 4200
433 Ga0451576_0109645 3300045051 Bacteria 2872
434 Ga0451576_0176666 3300045051 Unclassified 2229
435 Ga0451576_0379013 3300045051 Unclassified 1483
436 Ga0495603_0070483 3300046455 Bacteria 2055
437 Ga0495651_0064806 3300046462 Unclassified 2792
438 Ga0495580_0000002 3300046472 Bacteria 121311
439 Ga0495580_0029497 3300046472 Bacteria 3981
440 Ga0495580_0054618 3300046472 Bacteria 2817
441 Ga0495580_0081133 3300046472 Bacteria 2261
442 Ga0495594_0094042 3300046499 Unclassified 1682
443 Ga0495665_0056755 3300046531 Unclassified 2067
444 Ga0495598_0019367 3300046537 Bacteria 1784
445 Ga0495635_0207425 3300046663 Unclassified 1328
446 Ga0495669_0053953 3300046684 Bacteria 1809
447 Ga0495636_0006482 3300047318 Bacteria 4598
448 Ga0495636_0097094 3300047318 Unclassified 1285
449 Ga0495684_0019858 3300047471 Bacteria 5178
450 Ga0496103_0259469 3300048906 Bacteria 1118
451 Ga0496104_0378182 3300048907 Bacteria 1329
452 Ga0496106_0017492 3300048909 Bacteria 5304
453 Ga0496106_0082114 3300048909 Bacteria 2477
454 Ga0496106_0310095 3300048909 Unclassified 1266
455 Ga0496108_0300262 3300048911 Bacteria 1399
456 Ga0496112_0036484 3300048915 Bacteria 4796
457 Ga0496112_0646939 3300048915 Unclassified 987
458 Ga0496114_0361583 3300048917 Unclassified 1284
459 Ga0496126_0095307 3300048929 Unclassified 2611
460 Ga0501036_0311555 3300049572 Bacteria 1316
461 Ga0501040_0048417 3300049576 Bacteria 2905
462 Ga0501041_0064109 3300049577 Bacteria 2250
463 Ga0501042_0059027 3300049578 Bacteria 2739
464 Ga0501048_0069888 3300049582 Bacteria 2480
465 Ga0501075_0092873 3300049591 Unclassified 2291
466 Ga0501075_0549605 3300049591 Bacteria 881
467 Ga0501076_0075506 3300049592 Bacteria 2702
468 Ga0501076_0096810 3300049592 Bacteria 2377
469 Ga0501076_0150611 3300049592 Bacteria 1893
470 Ga0501079_0039738 3300049741 Bacteria 3629
471 Ga0501079_0082156 3300049741 Bacteria 2492
472 Ga0501081_0017133 3300049743 Bacteria 4793
473 Ga0501045_0009364 3300049824 Bacteria 6849
474 nmdc:mga0yw44_352835_c1 3300050492 Bacteria 990
475 nmdc:mga05p37_155845_c1 3300050507 Unclassified 2791
476 nmdc:mga05p37_38084_c1 3300050507 Bacteria 5898
477 nmdc:mga05p37_629075_c1 3300050507 Bacteria 1206
478 nmdc:mga09592_3271_c1 3300050508 Bacteria 13119
479 nmdc:mga0qj67_43405_c1 3300050509 Unclassified 3541
480 nmdc:mga06r32_13427_c1 3300050510 Bacteria 7417
481 nmdc:mga06r32_159359_c1 3300050510 Bacteria 2239
482 nmdc:mga08y16_168962_c1 3300050511 Bacteria 2272
483 nmdc:mga0n895_100484_c1 3300050512 Bacteria 2901
484 nmdc:mga0n895_373305_c1 3300050512 Unclassified 1444
485 nmdc:mga0n895_4599_c1 3300050512 Bacteria 11370
486 nmdc:mga0rr50_5313_c1 3300050513 Bacteria 7664
487 nmdc:mga0a205_14470_c1 3300050515 Bacteria 7359
488 nmdc:mga0a205_20166_c1 3300050515 Bacteria 6288
489 Ga0500556_0093470 3300053104 Unclassified 1151
490 Ga0501084_0182644 3300054114 Bacteria 1771
491 Ga0501084_0261743 3300054114 Bacteria 1460
492 Ga0501082_0426374 3300060353 Bacteria 1158
493 Ga0530510_0102145 3300061734 Bacteria 2097
494 2928968120 2928963466 Bacteria 5165703
495 Ga0075428_100032389
496 MBSR1b_contig_10092069
497 Ga0065712_10170489
498 Ga0065715_10104305
499 Ga0070676_10006212
500 Ga0070683_100044552
501 Ga0070683_100387918
502 Ga0070683_100448123
503 Ga0070690_100000472
504 Ga0070690_100003159
505 Ga0070690_100003197
506 Ga0070690_100048488
507 Ga0070670_100025791
508 Ga0070677_10027063
509 Ga0068869_100000410
510 Ga0068869_100022840
511 Ga0070666_10060907
512 Ga0070666_10161889
513 Ga0070680_100003471
514 Ga0070680_100006482
515 Ga0070680_100043244
516 Ga0070682_100017355
517 Ga0068868_100000209
518 Ga0068868_100106856
519 Ga0070660_100014758
520 Ga0070660_100017975
521 Ga0070689_100000614
522 Ga0070689_100006112
523 Ga0070689_100015234
524 Ga0070691_10001516
525 Ga0070691_10051095
526 Ga0070687_100000190
527 Ga0070687_100001061
528 Ga0070661_100020597
529 Ga0070692_10001339
530 Ga0070692_10008470
531 Ga0070692_10015733
532 Ga0070668_100004402
533 Ga0070668_100010824
534 Ga0070668_100682198
535 Ga0070669_100009844
536 Ga0070669_100016102
537 Ga0070669_100027587
538 Ga0070669_100154427
539 Ga0070675_100027335
540 Ga0070675_100206811
541 Ga0070675_100226096
542 Ga0070671_100023702
543 Ga0070671_100298770
544 Ga0070674_100002804
545 Ga0070673_100004817
546 Ga0070688_100004485
547 Ga0070688_100096989
548 Ga0070688_100145914
549 Ga0070659_100024242
550 Ga0070659_100034255
551 Ga0070667_100010137
552 Ga0070667_100372784
553 Ga0070703_10037428
554 Ga0070701_10002341
555 Ga0070701_10023515
556 Ga0070701_10075321
557 Ga0070711_100046639
558 Ga0070705_100000320
559 Ga0070705_100001556
560 Ga0070705_100044488
561 Ga0070700_100000571
562 Ga0070700_100004319
563 Ga0070700_100113060
564 Ga0070700_100117995
565 Ga0070700_100186821
566 Ga0070700_100213224
567 Ga0070694_100000077
568 Ga0070694_100018243
569 Ga0070694_100028542
570 Ga0070694_100122034
571 Ga0070694_100520508
572 Ga0070708_100042497
573 Ga0070708_100664778
574 Ga0070663_100001684
575 Ga0070663_100072084
576 Ga0070678_100001194
577 Ga0070678_100006807
578 Ga0070678_100006989
579 Ga0070681_10036728
580 Ga0070681_10071518
581 Ga0070681_10328360
582 Ga0068867_100000107
583 Ga0068867_100002779
584 Ga0070685_10012897
585 Ga0070685_10125564
586 Ga0070706_100034156
587 Ga0070679_100002529
588 Ga0070697_100030566
589 Ga0068853_100129078
590 Ga0068853_100133225
591 Ga0068853_100454520
592 Ga0070672_100003792
593 Ga0070672_100032011
594 Ga0070672_100066933
595 Ga0070672_100269620
596 Ga0070686_100000825
597 Ga0070686_100045421
598 Ga0070686_100491732
599 Ga0070686_100675896
600 Ga0070695_100000457
601 Ga0070695_100025176
602 Ga0070695_100102986
603 Ga0070696_100001446
604 Ga0070696_100003445
605 Ga0070693_100000040
606 Ga0070693_100188855
607 Ga0070665_100000167
608 Ga0070704_100003720
609 Ga0068855_100005158
610 Ga0068855_100085252
611 Ga0068855_100090924
612 Ga0070664_100023786
613 Ga0070664_100092755
614 Ga0068857_100001320
615 Ga0068857_100130183
616 Ga0068854_100000693
617 Ga0068854_100004898
618 Ga0068854_100086641
619 Ga0068856_100045174
620 Ga0068856_100410188
621 Ga0070702_100000050
622 Ga0070702_100138521
623 Ga0068852_100000255
624 Ga0068852_100341699
625 Ga0068859_100000332
626 Ga0068859_100004149
627 Ga0068859_100006983
628 Ga0068859_100177798
629 Ga0068864_100018377
630 Ga0068866_10001291
631 Ga0068866_10002275
632 Ga0068861_100000100
633 Ga0068861_100000549
634 Ga0068861_100031573
635 Ga0068861_100136854
636 Ga0068851_10013250
637 Ga0068870_10006180
638 Ga0068870_10031554
639 Ga0068863_100028593
640 Ga0068863_100035539
641 Ga0068863_100093107
642 Ga0068863_100168837
643 Ga0068858_100004862
644 Ga0068858_100104856
645 Ga0068858_100348118
646 Ga0068858_100408015
647 Ga0068858_100828038
648 Ga0068860_100070726
649 Ga0068860_100123746
650 Ga0068860_100150773
651 Ga0068860_100318878
652 Ga0068860_100466955
653 Ga0068862_100003390
654 Ga0068862_100011446
655 Ga0068862_100534191
656 Ga0081540_1000558
657 Ga0075365_10344493
658 Ga0097621_100000676
659 Ga0097621_100003787
660 Ga0097621_100040992
661 Ga0097621_100649413
662 Ga0068871_100000238
663 Ga0068871_100001226
664 Ga0068871_100015707
665 Ga0068871_100052300
666 Ga0068871_100058965
667 Ga0075428_100004117
668 Ga0075428_100384683
669 Ga0075428_100521801
670 Ga0075430_100019091
671 Ga0075431_100000994
672 Ga0075431_100010101
673 Ga0075431_100328343
674 Ga0075433_10010304
675 Ga0075433_10029402
676 Ga0075434_100044229
677 Ga0075434_100196615
678 Ga0075434_100432395
679 Ga0075429_100002612
680 Ga0075429_100029583
681 Ga0068865_100000571
682 Ga0068865_100001561
683 Ga0068865_100026822
684 Ga0068865_100480818
685 Ga0097620_100000332
686 Ga0097620_100004149
687 Ga0097620_100006983
688 Ga0097620_100177796
689 Ga0075435_100011247
690 Ga0075435_100040179
691 Ga0105240_10247972
692 Ga0111539_10097614
693 Ga0111539_10138276
694 Ga0111539_10367680
695 Ga0111539_10476152
696 Ga0105245_10000115
697 Ga0105245_10000482
698 Ga0105245_10013137
699 Ga0105247_10000388
700 Ga0114129_10189764
701 Ga0114129_10450055
702 Ga0114129_10546737
703 Ga0105243_10000035
704 Ga0105243_10004331
705 Ga0105243_10011190
706 Ga0105241_10021871
707 Ga0105241_10102552
708 Ga0105242_10000268
709 Ga0105242_10001933
710 Ga0105242_10004528
711 Ga0105248_10042121
712 Ga0105248_10069953
713 Ga0105248_10250327
714 Ga0105248_10251323
715 Ga0105248_10325447
716 Ga0105248_10447028
717 Ga0105237_10264859
718 Ga0105238_10085984
719 Ga0105238_10554951
720 Ga0105249_10002683
721 Ga0105249_10007315
722 Ga0105239_10016952
723 Ga0105239_10045325
724 Ga0105246_10001139
725 Ga0105246_10006498
726 Ga0157373_10015100
727 Ga0157373_10062156
728 Ga0157371_10030697
729 Ga0157371_10111640
730 Ga0157369_10009916
731 Ga0157369_10068940
732 Ga0157374_10008067
733 Ga0157374_10266212
734 Ga0157374_10589071
735 Ga0157378_10001030
736 Ga0157378_10024685
737 Ga0157378_10025219
738 Ga0157378_10060457
739 Ga0157378_10458837
740 Ga0163162_10198771
741 Ga0163162_10345723
742 Ga0163162_10816550
743 Ga0157375_10041632
744 Ga0157375_10057101
745 Ga0157375_10158367
746 Ga0157375_10477856
747 Ga0157375_11059040
748 Ga0163163_10106936
749 Ga0157380_10010889
750 Ga0157380_10019992
751 Ga0157380_10034934
752 Ga0157380_10133671
753 Ga0157380_10637654
754 Ga0157377_10000443
755 Ga0157377_10109548
756 Ga0157379_10005394
757 Ga0157376_10000582
758 Ga0157376_10002049
759 Ga0157376_10004574
760 Ga0157376_10028852
761 Ga0163161_10001181
762 Ga0207697_10000176
763 Ga0207656_10002891
764 Ga0207682_10029884
765 Ga0207642_10000874
766 Ga0207688_10000191
767 Ga0207688_10010499
768 Ga0207680_10060790
769 Ga0207647_10006169
770 Ga0207645_10000066
771 Ga0207645_10000595
772 Ga0207643_10000020
773 Ga0207643_10049662
774 Ga0207705_10018250
775 Ga0207654_10021724
776 Ga0207707_10027959
777 Ga0207707_10054425
778 Ga0207671_10034477
779 Ga0207663_10141832
780 Ga0207663_10318508
781 Ga0207660_10003008
782 Ga0207660_10082345
783 Ga0207662_10000017
784 Ga0207662_10000333
785 Ga0207657_10000040
786 Ga0207657_10017386
787 Ga0207649_10007364
788 Ga0207652_10069170
789 Ga0207646_10031390
790 Ga0207681_10002562
791 Ga0207681_10031466
792 Ga0207681_10071832
793 Ga0207681_10163642
794 Ga0207681_10174820
795 Ga0207694_10060942
796 Ga0207650_10007703
797 Ga0207650_10008474
798 Ga0207659_10007637
799 Ga0207659_10011593
800 Ga0207687_10001542
801 Ga0207687_10076617
802 Ga0207644_10170981
803 Ga0207690_10006627
804 Ga0207706_10001090
805 Ga0207706_10001297
806 Ga0207686_10002255
807 Ga0207686_10008783
808 Ga0207709_10000917
809 Ga0207709_10067230
810 Ga0207670_10000311
811 Ga0207670_10041144
812 Ga0207670_10105740
813 Ga0207669_10021102
814 Ga0207669_10024139
815 Ga0207669_10591210
816 Ga0207704_10000141
817 Ga0207704_10018664
818 Ga0207704_10113086
819 Ga0207704_10157850
820 Ga0207691_10000207
821 Ga0207691_10000692
822 Ga0207691_10056703
823 Ga0207711_10042532
824 Ga0207711_10172598
825 Ga0207711_10394180
826 Ga0207689_10000549
827 Ga0207689_10001634
828 Ga0207689_10001663
829 Ga0207661_10149489
830 Ga0207679_10007305
831 Ga0207679_10032232
832 Ga0207667_10001264
833 Ga0207651_10155975
834 Ga0207712_10051247
835 Ga0207668_10286399
836 Ga0207640_10008279
837 Ga0207640_10008647
838 Ga0207640_10012732
839 Ga0207658_10013513
840 Ga0207658_10029273
841 Ga0207658_10311565
842 Ga0207658_10428051
843 Ga0207677_10001096
844 Ga0207677_10002397
845 Ga0207677_10111969
846 Ga0207703_10000296
847 Ga0207703_10001682
848 Ga0207639_10159152
849 Ga0207678_10000845
850 Ga0207678_10069701
851 Ga0207708_10000114
852 Ga0207708_10000656
853 Ga0207708_10031633
854 Ga0207708_10069786
855 Ga0207708_10175911
856 Ga0207702_10003642
857 Ga0207641_10014849
858 Ga0207641_10070847
859 Ga0207641_10072859
860 Ga0207641_10076393
861 Ga0207641_10158050
862 Ga0207641_10220887
863 Ga0207648_10000113
864 Ga0207648_10001090
865 Ga0207648_10081976
866 Ga0207676_10000402
867 Ga0207676_10376685
868 Ga0207676_10509619
869 Ga0207674_10001435
870 Ga0207674_10015980
871 Ga0207675_100000017
872 Ga0207675_100000191
873 Ga0207675_100008911
874 Ga0207683_10000072
875 Ga0207683_10000081
876 Ga0207698_10193344
877 Ga0209969_1000434
878 Ga0209996_1000059
879 Ga0210000_1000155
880 Ga0209995_1000028
881 Ga0209968_1000100
882 Ga0209999_1001000
883 Ga0209970_1000688
884 Ga0210002_1000123
885 Ga0209966_1000196
886 Ga0209998_10000132
887 Ga0209974_10000471
888 Ga0207428_10005187
889 Ga0207428_10094902
890 Ga0268266_10000082
891 Ga0268266_10001053
892 Ga0268265_10027207
893 Ga0268265_10617117
894 Ga0268264_10015314
895 Ga0268264_10073240
896 Ga0268264_10109658
897 Ga0268264_10174860
898 Ga0265338_10004036
899 Ga0265328_10018307
900 Ga0265340_10096690
901 Ga0265339_10002360
902 Ga0265327_10012901
903 Ga0265316_10119344
904 Ga0373959_0043229
905 Ga0373934_0000748
906 Ga0373923_0031474
907 Ga0373961_0007539
908 Ga0373931_0047059
909 Ga0373931_0286835
910 Ga0373927_0009047
911 Ga0373927_0154447
912 Ga0373947_0304306
913 Ga0373937_0443800
914 Ga0373925_0221301
915 Ga0439448_0047074
916 Ga0439450_034777
917 Ga0439458_0115892
918 Ga0451577_0002655
919 Ga0451577_0090511
920 Ga0451577_0226626
921 Ga0451577_0268920
922 Ga0453684_0027488
923 Ga0453684_0666893
924 Ga0451576_0037812
925 Ga0451576_0049436
926 Ga0451576_0054190
927 Ga0451576_0109645
928 Ga0451576_0176666
929 Ga0451576_0379013
930 Ga0495603_0070483
931 Ga0495651_0064806
932 Ga0495580_0000002
933 Ga0495580_0029497
934 Ga0495580_0054618
935 Ga0495580_0081133
936 Ga0495594_0094042
937 Ga0495665_0056755
938 Ga0495598_0019367
939 Ga0495635_0207425
940 Ga0495669_0053953
941 Ga0495636_0006482
942 Ga0495636_0097094
943 Ga0495684_0019858
944 Ga0496103_0259469
945 Ga0496104_0378182
946 Ga0496106_0017492
947 Ga0496106_0082114
948 Ga0496106_0310095
949 Ga0496108_0300262
950 Ga0496112_0036484
951 Ga0496112_0646939
952 Ga0496114_0361583
953 Ga0496126_0095307
954 Ga0501036_0311555
955 Ga0501040_0048417
956 Ga0501041_0064109
957 Ga0501042_0059027
958 Ga0501048_0069888
959 Ga0501075_0092873
960 Ga0501075_0549605
961 Ga0501076_0075506
962 Ga0501076_0096810
963 Ga0501076_0150611
964 Ga0501079_0039738
965 Ga0501079_0082156
966 Ga0501081_0017133
967 Ga0501045_0009364
968 nmdc:mga0yw44_352835_c1
969 nmdc:mga05p37_155845_c1
970 nmdc:mga05p37_38084_c1
971 nmdc:mga05p37_629075_c1
972 nmdc:mga09592_3271_c1
973 nmdc:mga0qj67_43405_c1
974 nmdc:mga06r32_13427_c1
975 nmdc:mga06r32_159359_c1
976 nmdc:mga08y16_168962_c1
977 nmdc:mga0n895_100484_c1
978 nmdc:mga0n895_373305_c1
979 nmdc:mga0n895_4599_c1
980 nmdc:mga0rr50_5313_c1
981 nmdc:mga0a205_14470_c1
982 nmdc:mga0a205_20166_c1
983 Ga0500556_0093470
984 Ga0501084_0182644
985 Ga0501084_0261743
986 Ga0501082_0426374
987 Ga0530510_0102145
988 2928968120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ek2-assembly1.cif.gz_A cryo-em structure of vccn1 in lipid nanodisc 0.7573 30 238
7pl9-assembly1.cif.gz_A cryo-em structure of bestrhodopsin (rhodopsin-rhodopsin-bestrophin) complex 0.7367 4 238
6iv1-assembly1.cif.gz_E crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae with a mutation i180t 0.7252 26 238
7pl9-assembly1.cif.gz_A cryo-em structure of bestrhodopsin (rhodopsin-rhodopsin-bestrophin) complex 0.7238 4 238
6ivo-assembly1.cif.gz_C crystal structure of a membrane protein p208a 0.7228 26 236
ID Description Score Start End Superfamily
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.6525 51 153 1.20.1440.60
af_Q8CD92_752_847_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.6491 80 153 1.10.287.1060
2rldD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.618 51 153 1.20.1440.60
af_Q6K8B0_32_156_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6133 40 140 1.20.140.40
af_Q561T9_7_123_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5903 57 157 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A4Y9EQA4-F1-model_v4 DUF4239 domain-containing protein 0.9466 7 238 GO:0016020
AF-A0A3B8Q4I8-F1-model_v4 DUF4239 domain-containing protein 0.9404 54 239 GO:0016020
AF-A0A7Y7SUU4-F1-model_v4 DUF4239 domain-containing protein 0.9397 33 162
AF-A0A3A8LLL0-F1-model_v4 DUF4239 domain-containing protein 0.9387 6 239 GO:0016020
AF-R8AUJ9-F1-model_v4 DUF4239 domain-containing protein 0.9359 6 238 GO:0016020

Map