F454555
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 494 | 285 | 458 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10136402|Ga0099794_101364021 |
| Length | 207 |
| Sequence | MSKIAFAAVALTAAGFTVSAQAADLYGSRAPYTVNQPLYNAYSWAGPYLGGNIGYAWGSVENNPVNPSGVVGGVQAGYNWQTGPWVFGLEGDLQATGADDTFAPWKFSNPWFGTVRGRAGYAFNNLLVYGTGGLAFGELRGETFGLSESHTNAGWTAGVGAEFGFAQNWSAKVEYLYVDLSSDNFTITGVPNGYHFGVLRAGINYHF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 3 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 4 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 5 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 6 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 7 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 8 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 9 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 10 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 11 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 12 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 13 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 14 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 15 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 16 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 17 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 18 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 19 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 20 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 21 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 22 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 23 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 24 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 25 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 26 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 27 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 28 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 29 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 30 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 31 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 32 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 33 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 34 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 35 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 140 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 149 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 159 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 173 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 174 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 247 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 253 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 254 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 255 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 256 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 257 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 258 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 259 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 260 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 262 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 263 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 264 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 265 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 266 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 267 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 268 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 269 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 270 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 271 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 272 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 273 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 274 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 275 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 276 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 277 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 278 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 279 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 281 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 283 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 284 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 285 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.51 |
| Metatranscriptomes | 0.2 |
| Isolates | 7.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.92 |
| Nodule | 2.63 |
| Rhizoplane | 8.7 |
| Rhizosphere | 71.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000043 | 3300003203 | Bacteria | 55866 |
| 2 | JGI25404J52841_10006527 | 3300003659 | Bacteria | 2447 |
| 3 | JGI25404J52841_10084347 | 3300003659 | Bacteria | 664 |
| 4 | Ga0055543_1017285 | 3300004625 | Bacteria | 1359 |
| 5 | Ga0065165_1005519 | 3300005262 | Bacteria | 7067 |
| 6 | Ga0065715_10360587 | 3300005293 | Bacteria | 936 |
| 7 | Ga0070658_10140542 | 3300005327 | Bacteria | 2017 |
| 8 | Ga0070658_10329989 | 3300005327 | Bacteria | 1303 |
| 9 | Ga0070680_100015508 | 3300005336 | Bacteria | 5976 |
| 10 | Ga0070660_100002476 | 3300005339 | Bacteria | 12662 |
| 11 | Ga0070661_100123382 | 3300005344 | Bacteria | 1942 |
| 12 | Ga0070674_100107727 | 3300005356 | Bacteria | 2041 |
| 13 | Ga0070674_100139838 | 3300005356 | Bacteria | 1816 |
| 14 | Ga0070673_100745570 | 3300005364 | Bacteria | 901 |
| 15 | Ga0070659_100071210 | 3300005366 | Bacteria | 2764 |
| 16 | Ga0070709_10064886 | 3300005434 | Bacteria | 2336 |
| 17 | Ga0070714_100563062 | 3300005435 | Bacteria | 1092 |
| 18 | Ga0070713_100016921 | 3300005436 | Bacteria | 5496 |
| 19 | Ga0070713_100298475 | 3300005436 | Bacteria | 1483 |
| 20 | Ga0070711_100398237 | 3300005439 | Bacteria | 1117 |
| 21 | Ga0070663_100334322 | 3300005455 | Bacteria | 1222 |
| 22 | Ga0070663_100369100 | 3300005455 | Bacteria | 1166 |
| 23 | Ga0070678_100047779 | 3300005456 | Bacteria | 3078 |
| 24 | Ga0070681_10020543 | 3300005458 | Bacteria | 6618 |
| 25 | Ga0070681_10096136 | 3300005458 | Bacteria | 2910 |
| 26 | Ga0070681_10122770 | 3300005458 | Bacteria | 2530 |
| 27 | Ga0068867_100209218 | 3300005459 | Bacteria | 1566 |
| 28 | Ga0070698_101234308 | 3300005471 | Bacteria | 697 |
| 29 | Ga0070679_100144908 | 3300005530 | Bacteria | 2353 |
| 30 | Ga0070679_100813663 | 3300005530 | Bacteria | 877 |
| 31 | Ga0070684_100019396 | 3300005535 | Bacteria | 5625 |
| 32 | Ga0070684_100069141 | 3300005535 | Bacteria | 3105 |
| 33 | Ga0068853_100001656 | 3300005539 | Bacteria | 16306 |
| 34 | Ga0070686_100138487 | 3300005544 | Bacteria | 1691 |
| 35 | Ga0070665_100243818 | 3300005548 | Bacteria | 1797 |
| 36 | Ga0068855_100054227 | 3300005563 | Bacteria | 4712 |
| 37 | Ga0068855_100562686 | 3300005563 | Bacteria | 1233 |
| 38 | Ga0070664_100459958 | 3300005564 | Bacteria | 1169 |
| 39 | Ga0068857_100130475 | 3300005577 | Bacteria | 2267 |
| 40 | Ga0068857_100364785 | 3300005577 | Bacteria | 1339 |
| 41 | Ga0068852_100082890 | 3300005616 | Bacteria | 2851 |
| 42 | Ga0068852_100489574 | 3300005616 | Bacteria | 1223 |
| 43 | Ga0068864_100016090 | 3300005618 | Bacteria | 6225 |
| 44 | Ga0068861_100440514 | 3300005719 | Bacteria | 1165 |
| 45 | Ga0068851_10023151 | 3300005834 | Bacteria | 3033 |
| 46 | Ga0068863_100435837 | 3300005841 | Bacteria | 1285 |
| 47 | Ga0068863_100437519 | 3300005841 | Bacteria | 1282 |
| 48 | Ga0081540_1035294 | 3300005983 | Bacteria | 2684 |
| 49 | Ga0081540_1089171 | 3300005983 | Bacteria | 1362 |
| 50 | Ga0081539_10000324 | 3300005985 | Bacteria | 106549 |
| 51 | Ga0081539_10001968 | 3300005985 | Bacteria | 31287 |
| 52 | Ga0075365_10209539 | 3300006038 | Bacteria | 1366 |
| 53 | Ga0075364_10088895 | 3300006051 | Bacteria | 2048 |
| 54 | Ga0075370_10033413 | 3300006353 | Bacteria | 2881 |
| 55 | Ga0099794_10132452 | 3300007265 | Bacteria | 1259 |
| 56 | Ga0099794_10136402 | 3300007265 | Bacteria | 1241 |
| 57 | Ga0099794_10199537 | 3300007265 | Bacteria | 1024 |
| 58 | Ga0099795_10008203 | 3300007788 | Bacteria | 2965 |
| 59 | Ga0099795_10250670 | 3300007788 | Bacteria | 763 |
| 60 | Ga0105240_10007694 | 3300009093 | Bacteria | 15591 |
| 61 | Ga0105240_10444411 | 3300009093 | Bacteria | 1452 |
| 62 | Ga0105247_10052284 | 3300009101 | Bacteria | 2518 |
| 63 | Ga0105242_10278216 | 3300009176 | Bacteria | 1519 |
| 64 | Ga0105248_10439938 | 3300009177 | Bacteria | 1469 |
| 65 | Ga0105237_10015525 | 3300009545 | Bacteria | 7923 |
| 66 | Ga0105237_10258969 | 3300009545 | Bacteria | 1742 |
| 67 | Ga0105237_10297361 | 3300009545 | Bacteria | 1617 |
| 68 | Ga0105237_10559011 | 3300009545 | Bacteria | 1151 |
| 69 | Ga0105238_10029507 | 3300009551 | Bacteria | 5587 |
| 70 | Ga0105238_10297957 | 3300009551 | Bacteria | 1596 |
| 71 | Ga0099796_10068340 | 3300010159 | Bacteria | 1276 |
| 72 | Ga0105239_10029597 | 3300010375 | Bacteria | 6021 |
| 73 | Ga0105239_10047895 | 3300010375 | Bacteria | 4685 |
| 74 | Ga0105239_10124139 | 3300010375 | Bacteria | 2869 |
| 75 | Ga0157369_10019439 | 3300013105 | Bacteria | 7599 |
| 76 | Ga0157369_10043264 | 3300013105 | Bacteria | 4910 |
| 77 | Ga0157374_10428494 | 3300013296 | Bacteria | 1322 |
| 78 | Ga0157378_11096631 | 3300013297 | Bacteria | 833 |
| 79 | Ga0163162_10369271 | 3300013306 | Bacteria | 1568 |
| 80 | Ga0157372_11351747 | 3300013307 | Bacteria | 822 |
| 81 | Ga0157375_10352162 | 3300013308 | Bacteria | 1638 |
| 82 | Ga0163163_10218870 | 3300014325 | Bacteria | 1953 |
| 83 | Ga0163163_10785806 | 3300014325 | Bacteria | 1015 |
| 84 | Ga0157379_10398932 | 3300014968 | Bacteria | 1264 |
| 85 | Ga0157376_10114806 | 3300014969 | Bacteria | 2376 |
| 86 | Ga0197907_10398635 | 3300020069 | Bacteria | 1234 |
| 87 | Ga0213875_10077451 | 3300021388 | Bacteria | 1552 |
| 88 | Ga0209563_103012 | 3300025230 | Bacteria | 3612 |
| 89 | Ga0209677_104064 | 3300025253 | Bacteria | 4398 |
| 90 | Ga0209673_1022322 | 3300025273 | Bacteria | 2187 |
| 91 | Ga0209758_1005318 | 3300025297 | Bacteria | 10036 |
| 92 | Ga0207426_1005781 | 3300025302 | Bacteria | 5551 |
| 93 | Ga0207426_1007382 | 3300025302 | Bacteria | 4611 |
| 94 | Ga0207426_1013780 | 3300025302 | Bacteria | 2983 |
| 95 | Ga0209257_1054008 | 3300025304 | Bacteria | 1120 |
| 96 | Ga0207692_10200510 | 3300025898 | Bacteria | 1173 |
| 97 | Ga0207710_10032876 | 3300025900 | Bacteria | 2273 |
| 98 | Ga0207699_10064392 | 3300025906 | Bacteria | 2218 |
| 99 | Ga0207705_10089755 | 3300025909 | Bacteria | 2249 |
| 100 | Ga0207705_10322001 | 3300025909 | Bacteria | 1188 |
| 101 | Ga0207707_10003102 | 3300025912 | Bacteria | 14744 |
| 102 | Ga0207707_10024022 | 3300025912 | Bacteria | 5330 |
| 103 | Ga0207707_10311839 | 3300025912 | Bacteria | 1359 |
| 104 | Ga0207695_10063410 | 3300025913 | Bacteria | 3811 |
| 105 | Ga0207695_10126612 | 3300025913 | Bacteria | 2516 |
| 106 | Ga0207671_10084122 | 3300025914 | Bacteria | 2389 |
| 107 | Ga0207671_10213861 | 3300025914 | Bacteria | 1509 |
| 108 | Ga0207693_10117582 | 3300025915 | Bacteria | 2087 |
| 109 | Ga0207663_10051060 | 3300025916 | Bacteria | 2573 |
| 110 | Ga0207663_10112086 | 3300025916 | Bacteria | 1852 |
| 111 | Ga0207660_10003607 | 3300025917 | Bacteria | 10083 |
| 112 | Ga0207657_10015320 | 3300025919 | Bacteria | 7432 |
| 113 | Ga0207649_10039938 | 3300025920 | Bacteria | 2848 |
| 114 | Ga0207652_10052496 | 3300025921 | Bacteria | 3499 |
| 115 | Ga0207652_10088917 | 3300025921 | Bacteria | 2711 |
| 116 | Ga0207652_10597403 | 3300025921 | Bacteria | 990 |
| 117 | Ga0207646_10345011 | 3300025922 | Bacteria | 1345 |
| 118 | Ga0207694_10007559 | 3300025924 | Bacteria | 8238 |
| 119 | Ga0207650_10683007 | 3300025925 | Bacteria | 867 |
| 120 | Ga0207659_10222364 | 3300025926 | Bacteria | 1519 |
| 121 | Ga0207687_10109720 | 3300025927 | Bacteria | 2045 |
| 122 | Ga0207700_10024184 | 3300025928 | Bacteria | 4200 |
| 123 | Ga0207664_10033040 | 3300025929 | Bacteria | 3972 |
| 124 | Ga0207664_10118054 | 3300025929 | Bacteria | 2216 |
| 125 | Ga0207706_10258587 | 3300025933 | Bacteria | 1520 |
| 126 | Ga0207669_10100216 | 3300025937 | Bacteria | 1913 |
| 127 | Ga0207661_10000597 | 3300025944 | Bacteria | 23061 |
| 128 | Ga0207661_10470027 | 3300025944 | Bacteria | 1147 |
| 129 | Ga0207667_10001989 | 3300025949 | Bacteria | 25637 |
| 130 | Ga0207667_10640702 | 3300025949 | Bacteria | 1069 |
| 131 | Ga0207651_11038356 | 3300025960 | Bacteria | 733 |
| 132 | Ga0207639_10004121 | 3300026041 | Bacteria | 9799 |
| 133 | Ga0207678_10096823 | 3300026067 | Bacteria | 2522 |
| 134 | Ga0207678_10172161 | 3300026067 | Bacteria | 1849 |
| 135 | Ga0207678_10259588 | 3300026067 | Bacteria | 1489 |
| 136 | Ga0207702_10477579 | 3300026078 | Bacteria | 1213 |
| 137 | Ga0207641_10350473 | 3300026088 | Bacteria | 1407 |
| 138 | Ga0207648_10124448 | 3300026089 | Bacteria | 2268 |
| 139 | Ga0207676_10035908 | 3300026095 | Bacteria | 3767 |
| 140 | Ga0207674_10145484 | 3300026116 | Bacteria | 2328 |
| 141 | Ga0207683_10076908 | 3300026121 | Bacteria | 2955 |
| 142 | Ga0207683_10096708 | 3300026121 | Bacteria | 2633 |
| 143 | Ga0207683_10207698 | 3300026121 | Bacteria | 1781 |
| 144 | Ga0207698_10253026 | 3300026142 | Bacteria | 1613 |
| 145 | Ga0268266_10137558 | 3300028379 | Bacteria | 2189 |
| 146 | Ga0265334_10037283 | 3300028573 | Bacteria | 1917 |
| 147 | Ga0265330_10010904 | 3300031235 | Bacteria | 4271 |
| 148 | Ga0265330_10059220 | 3300031235 | Bacteria | 1668 |
| 149 | Ga0265332_10050591 | 3300031238 | Bacteria | 1786 |
| 150 | Ga0265328_10092146 | 3300031239 | Bacteria | 1120 |
| 151 | Ga0265313_10047266 | 3300031595 | Bacteria | 2084 |
| 152 | Ga0307510_10006233 | 3300033180 | Bacteria | 14224 |
| 153 | Ga0373930_0081805 | 3300034816 | Bacteria | 747 |
| 154 | Ga0373926_0026762 | 3300035083 | Bacteria | 2019 |
| 155 | Ga0373928_0005159 | 3300035084 | Bacteria | 2493 |
| 156 | Ga0373934_0000917 | 3300035086 | Bacteria | 10657 |
| 157 | Ga0373934_0043566 | 3300035086 | Bacteria | 1773 |
| 158 | Ga0373923_0004430 | 3300035111 | Bacteria | 4657 |
| 159 | Ga0373923_0009785 | 3300035111 | Bacteria | 3467 |
| 160 | Ga0373936_0019613 | 3300035113 | Bacteria | 2621 |
| 161 | Ga0373936_0021993 | 3300035113 | Bacteria | 2483 |
| 162 | Ga0373939_0104584 | 3300035114 | Bacteria | 977 |
| 163 | Ga0373941_0033118 | 3300035115 | Bacteria | 1551 |
| 164 | Ga0373945_0040597 | 3300035116 | Bacteria | 1680 |
| 165 | Ga0373945_0276478 | 3300035116 | Bacteria | 715 |
| 166 | Ga0373953_0007777 | 3300035117 | Bacteria | 3609 |
| 167 | Ga0373953_0133001 | 3300035117 | Bacteria | 1061 |
| 168 | Ga0373954_0007560 | 3300035118 | Bacteria | 4756 |
| 169 | Ga0373954_0077586 | 3300035118 | Bacteria | 1584 |
| 170 | Ga0373956_0002486 | 3300035119 | Bacteria | 7500 |
| 171 | Ga0373956_0012134 | 3300035119 | Bacteria | 3565 |
| 172 | Ga0373957_0005552 | 3300035120 | Bacteria | 3913 |
| 173 | Ga0373957_0010606 | 3300035120 | Bacteria | 3051 |
| 174 | Ga0373943_0001395 | 3300035170 | Bacteria | 10885 |
| 175 | Ga0373943_0085384 | 3300035170 | Bacteria | 1625 |
| 176 | Ga0373943_0244985 | 3300035170 | Bacteria | 1005 |
| 177 | Ga0373946_0417340 | 3300035171 | Bacteria | 679 |
| 178 | Ga0373955_0030392 | 3300035172 | Bacteria | 2819 |
| 179 | Ga0373955_0033119 | 3300035172 | Bacteria | 2719 |
| 180 | Ga0373962_0068829 | 3300035242 | Bacteria | 1054 |
| 181 | Ga0373924_0007709 | 3300035410 | Bacteria | 3890 |
| 182 | Ga0373924_0038958 | 3300035410 | Bacteria | 1940 |
| 183 | Ga0373924_0039737 | 3300035410 | Bacteria | 1923 |
| 184 | Ga0373931_0003292 | 3300035691 | Bacteria | 7230 |
| 185 | Ga0373931_0178503 | 3300035691 | Bacteria | 1256 |
| 186 | Ga0373935_0001273 | 3300035692 | Bacteria | 13895 |
| 187 | Ga0373935_0052160 | 3300035692 | Bacteria | 2599 |
| 188 | Ga0373935_0094930 | 3300035692 | Bacteria | 1958 |
| 189 | Ga0373927_0000792 | 3300035695 | Bacteria | 24123 |
| 190 | Ga0373927_0005966 | 3300035695 | Bacteria | 8343 |
| 191 | Ga0373927_0064177 | 3300035695 | Bacteria | 2375 |
| 192 | Ga0373927_0429348 | 3300035695 | Bacteria | 872 |
| 193 | Ga0373933_0000964 | 3300035724 | Bacteria | 17534 |
| 194 | Ga0373933_0004963 | 3300035724 | Bacteria | 7255 |
| 195 | Ga0373947_0002479 | 3300035725 | Bacteria | 11100 |
| 196 | Ga0373947_0014814 | 3300035725 | Bacteria | 4474 |
| 197 | Ga0373947_0066856 | 3300035725 | Bacteria | 2194 |
| 198 | Ga0373937_0100605 | 3300036401 | Bacteria | 2682 |
| 199 | Ga0373937_0202213 | 3300036401 | Bacteria | 1867 |
| 200 | Ga0373937_0280338 | 3300036401 | Bacteria | 1574 |
| 201 | Ga0373925_0007136 | 3300037068 | Bacteria | 8166 |
| 202 | Ga0373925_0082976 | 3300037068 | Bacteria | 2440 |
| 203 | Ga0373925_0113735 | 3300037068 | Bacteria | 2093 |
| 204 | Ga0373925_0248345 | 3300037068 | Bacteria | 1427 |
| 205 | Ga0373925_0474061 | 3300037068 | Bacteria | 1026 |
| 206 | Ga0373925_0557096 | 3300037068 | Bacteria | 943 |
| 207 | Ga0395900_0012938 | 3300037418 | Bacteria | 8524 |
| 208 | Ga0395898_0071507 | 3300037466 | Bacteria | 3352 |
| 209 | Ga0395898_0644608 | 3300037466 | Bacteria | 1002 |
| 210 | Ga0436364_0994846 | 3300037853 | Bacteria | 2431 |
| 211 | Ga0436364_0997941 | 3300037853 | Bacteria | 2124 |
| 212 | Ga0395901_0061423 | 3300038443 | Bacteria | 3910 |
| 213 | Ga0436365_1077088 | 3300039437 | Bacteria | 3217 |
| 214 | Ga0436365_1444382 | 3300039437 | Bacteria | 1952 |
| 215 | Ga0436365_1505691 | 3300039437 | Bacteria | 1245 |
| 216 | Ga0451851_0123442 | 3300041507 | Bacteria | 995 |
| 217 | Ga0466972_0034670 | 3300044658 | Bacteria | 2471 |
| 218 | Ga0466965_0289232 | 3300044683 | Bacteria | 887 |
| 219 | Ga0466968_0065287 | 3300044735 | Bacteria | 1575 |
| 220 | Ga0466960_0029330 | 3300044901 | Bacteria | 2524 |
| 221 | Ga0495592_0002895 | 3300046454 | Bacteria | 12206 |
| 222 | Ga0495592_0023469 | 3300046454 | Bacteria | 4691 |
| 223 | Ga0495592_0058249 | 3300046454 | Bacteria | 2850 |
| 224 | Ga0495592_0066701 | 3300046454 | Bacteria | 2633 |
| 225 | Ga0495592_0068034 | 3300046454 | Bacteria | 2601 |
| 226 | Ga0495603_0003882 | 3300046455 | Bacteria | 8902 |
| 227 | Ga0495629_0000236 | 3300046459 | Bacteria | 48386 |
| 228 | Ga0495629_0011071 | 3300046459 | Bacteria | 6553 |
| 229 | Ga0495629_0021237 | 3300046459 | Bacteria | 4634 |
| 230 | Ga0495638_0040101 | 3300046460 | Bacteria | 2968 |
| 231 | Ga0495641_0003725 | 3300046461 | Bacteria | 11224 |
| 232 | Ga0495651_0015634 | 3300046462 | Bacteria | 5875 |
| 233 | Ga0495651_0020175 | 3300046462 | Bacteria | 5173 |
| 234 | Ga0495651_0108523 | 3300046462 | Bacteria | 2055 |
| 235 | Ga0495653_0012185 | 3300046463 | Bacteria | 7015 |
| 236 | Ga0495653_0027945 | 3300046463 | Bacteria | 4515 |
| 237 | Ga0495653_0130007 | 3300046463 | Bacteria | 1784 |
| 238 | Ga0495653_0484958 | 3300046463 | Bacteria | 773 |
| 239 | Ga0495650_0141370 | 3300046471 | Bacteria | 871 |
| 240 | Ga0495580_0019020 | 3300046472 | Bacteria | 5107 |
| 241 | Ga0495580_0102441 | 3300046472 | Bacteria | 1990 |
| 242 | Ga0495582_0000084 | 3300046473 | Bacteria | 47752 |
| 243 | Ga0495582_0077070 | 3300046473 | Bacteria | 1849 |
| 244 | Ga0495639_0001155 | 3300046475 | Bacteria | 11924 |
| 245 | Ga0495639_0033767 | 3300046475 | Bacteria | 2286 |
| 246 | Ga0495639_0085844 | 3300046475 | Bacteria | 1471 |
| 247 | Ga0495639_0096263 | 3300046475 | Bacteria | 1394 |
| 248 | Ga0495639_0190557 | 3300046475 | Bacteria | 1001 |
| 249 | Ga0495662_0000454 | 3300046476 | Bacteria | 18465 |
| 250 | Ga0495662_0213297 | 3300046476 | Bacteria | 952 |
| 251 | Ga0495664_0003578 | 3300046477 | Bacteria | 8467 |
| 252 | Ga0495664_0031081 | 3300046477 | Bacteria | 3129 |
| 253 | Ga0495594_0001840 | 3300046499 | Bacteria | 11034 |
| 254 | Ga0495606_0017760 | 3300046507 | Bacteria | 5363 |
| 255 | Ga0495608_0018513 | 3300046511 | Bacteria | 4803 |
| 256 | Ga0495608_0132895 | 3300046511 | Bacteria | 1591 |
| 257 | Ga0495608_0191726 | 3300046511 | Bacteria | 1290 |
| 258 | Ga0495610_0243704 | 3300046512 | Bacteria | 715 |
| 259 | Ga0495618_0020851 | 3300046514 | Bacteria | 4034 |
| 260 | Ga0495618_0040236 | 3300046514 | Bacteria | 2941 |
| 261 | Ga0495618_0230812 | 3300046514 | Bacteria | 1165 |
| 262 | Ga0495628_0008781 | 3300046516 | Bacteria | 8648 |
| 263 | Ga0495628_0022522 | 3300046516 | Bacteria | 5176 |
| 264 | Ga0495628_0065003 | 3300046516 | Bacteria | 2855 |
| 265 | Ga0495628_0080234 | 3300046516 | Bacteria | 2537 |
| 266 | Ga0495630_0002622 | 3300046517 | Bacteria | 12449 |
| 267 | Ga0495630_0087384 | 3300046517 | Bacteria | 2354 |
| 268 | Ga0495630_0151879 | 3300046517 | Bacteria | 1762 |
| 269 | Ga0495630_0424864 | 3300046517 | Bacteria | 1018 |
| 270 | Ga0495648_0035521 | 3300046524 | Bacteria | 3230 |
| 271 | Ga0495666_0020271 | 3300046526 | Bacteria | 3296 |
| 272 | Ga0495666_0036901 | 3300046526 | Bacteria | 2379 |
| 273 | Ga0495666_0134608 | 3300046526 | Bacteria | 1154 |
| 274 | Ga0495652_0011193 | 3300046529 | Bacteria | 8124 |
| 275 | Ga0495652_0084605 | 3300046529 | Bacteria | 2608 |
| 276 | Ga0495652_0138489 | 3300046529 | Bacteria | 1917 |
| 277 | Ga0495652_0514716 | 3300046529 | Bacteria | 828 |
| 278 | Ga0495665_0001312 | 3300046531 | Bacteria | 13267 |
| 279 | Ga0495665_0016204 | 3300046531 | Bacteria | 4016 |
| 280 | Ga0495640_0006537 | 3300046533 | Bacteria | 9213 |
| 281 | Ga0495640_0011192 | 3300046533 | Bacteria | 6907 |
| 282 | Ga0495640_0032353 | 3300046533 | Bacteria | 3726 |
| 283 | Ga0495640_0280046 | 3300046533 | Bacteria | 1039 |
| 284 | Ga0495587_0016668 | 3300046536 | Bacteria | 4570 |
| 285 | Ga0495587_0026726 | 3300046536 | Bacteria | 3516 |
| 286 | Ga0495587_0123417 | 3300046536 | Bacteria | 1483 |
| 287 | Ga0495587_0189042 | 3300046536 | Bacteria | 1166 |
| 288 | Ga0495645_0049445 | 3300046543 | Bacteria | 3062 |
| 289 | Ga0495645_0098842 | 3300046543 | Bacteria | 2077 |
| 290 | Ga0495645_0114473 | 3300046543 | Bacteria | 1906 |
| 291 | Ga0495645_0390357 | 3300046543 | Bacteria | 889 |
| 292 | Ga0495622_0003118 | 3300046557 | Bacteria | 7857 |
| 293 | Ga0495667_0005125 | 3300046559 | Bacteria | 8853 |
| 294 | Ga0495667_0008101 | 3300046559 | Bacteria | 7131 |
| 295 | Ga0495667_0019089 | 3300046559 | Bacteria | 4627 |
| 296 | Ga0495667_0069957 | 3300046559 | Bacteria | 2290 |
| 297 | Ga0495667_0240177 | 3300046559 | Bacteria | 1154 |
| 298 | Ga0495634_0000321 | 3300046642 | Bacteria | 46387 |
| 299 | Ga0495634_0011437 | 3300046642 | Bacteria | 6464 |
| 300 | Ga0495634_0030658 | 3300046642 | Bacteria | 3712 |
| 301 | Ga0495634_0056445 | 3300046642 | Bacteria | 2623 |
| 302 | Ga0495635_0003139 | 3300046663 | Bacteria | 11370 |
| 303 | Ga0495635_0022784 | 3300046663 | Bacteria | 4366 |
| 304 | Ga0495635_0026028 | 3300046663 | Bacteria | 4074 |
| 305 | Ga0495635_0030431 | 3300046663 | Bacteria | 3751 |
| 306 | Ga0495657_0009754 | 3300046675 | Bacteria | 7249 |
| 307 | Ga0495657_0093493 | 3300046675 | Bacteria | 1924 |
| 308 | Ga0495599_0005351 | 3300046678 | Bacteria | 7661 |
| 309 | Ga0495599_0015612 | 3300046678 | Bacteria | 4715 |
| 310 | Ga0495599_0020314 | 3300046678 | Bacteria | 4136 |
| 311 | Ga0495599_0061754 | 3300046678 | Bacteria | 2341 |
| 312 | Ga0495623_0053900 | 3300046679 | Bacteria | 2539 |
| 313 | Ga0495623_0081457 | 3300046679 | Bacteria | 2001 |
| 314 | Ga0495623_0086541 | 3300046679 | Bacteria | 1931 |
| 315 | Ga0495623_0098545 | 3300046679 | Bacteria | 1784 |
| 316 | Ga0495646_0019568 | 3300046680 | Bacteria | 4283 |
| 317 | Ga0495646_0029579 | 3300046680 | Bacteria | 3424 |
| 318 | Ga0495647_0003687 | 3300046681 | Bacteria | 4918 |
| 319 | Ga0495647_0045848 | 3300046681 | Bacteria | 1681 |
| 320 | Ga0495658_0002077 | 3300046683 | Bacteria | 10151 |
| 321 | Ga0495658_0038010 | 3300046683 | Bacteria | 2663 |
| 322 | Ga0495613_0015877 | 3300046689 | Bacteria | 5607 |
| 323 | Ga0495613_0086687 | 3300046689 | Bacteria | 2270 |
| 324 | Ga0495613_0132420 | 3300046689 | Bacteria | 1785 |
| 325 | Ga0495624_0001596 | 3300046690 | Bacteria | 17405 |
| 326 | Ga0495600_0006764 | 3300046809 | Bacteria | 6991 |
| 327 | Ga0495600_0013900 | 3300046809 | Bacteria | 5071 |
| 328 | Ga0495600_0056308 | 3300046809 | Bacteria | 2569 |
| 329 | Ga0495581_0000174 | 3300047315 | Bacteria | 29174 |
| 330 | Ga0495581_0021346 | 3300047315 | Bacteria | 3754 |
| 331 | Ga0495581_0053479 | 3300047315 | Bacteria | 2332 |
| 332 | Ga0495604_0053959 | 3300047317 | Bacteria | 3103 |
| 333 | Ga0495604_0058569 | 3300047317 | Bacteria | 2957 |
| 334 | Ga0495604_0104500 | 3300047317 | Bacteria | 2075 |
| 335 | Ga0495604_0131064 | 3300047317 | Bacteria | 1802 |
| 336 | Ga0495604_0173616 | 3300047317 | Bacteria | 1513 |
| 337 | Ga0495604_0284070 | 3300047317 | Bacteria | 1117 |
| 338 | Ga0495674_0010664 | 3300047319 | Bacteria | 8696 |
| 339 | Ga0495674_0012229 | 3300047319 | Bacteria | 8088 |
| 340 | Ga0495674_0046885 | 3300047319 | Bacteria | 3834 |
| 341 | Ga0495674_0052543 | 3300047319 | Bacteria | 3585 |
| 342 | Ga0495674_0073997 | 3300047319 | Bacteria | 2935 |
| 343 | Ga0495676_0052222 | 3300047321 | Bacteria | 3264 |
| 344 | Ga0495680_0015403 | 3300047322 | Bacteria | 6598 |
| 345 | Ga0495680_0026093 | 3300047322 | Bacteria | 4823 |
| 346 | Ga0495675_0247476 | 3300047444 | Bacteria | 1071 |
| 347 | Ga0495673_0014385 | 3300047469 | Bacteria | 4117 |
| 348 | Ga0495684_0003361 | 3300047471 | Bacteria | 12567 |
| 349 | Ga0495684_0007348 | 3300047471 | Bacteria | 8539 |
| 350 | Ga0495684_0014558 | 3300047471 | Bacteria | 6053 |
| 351 | Ga0495684_0068439 | 3300047471 | Bacteria | 2700 |
| 352 | Ga0495684_0150183 | 3300047471 | Bacteria | 1742 |
| 353 | Ga0495686_0021905 | 3300047472 | Bacteria | 4234 |
| 354 | Ga0495686_0026657 | 3300047472 | Bacteria | 3781 |
| 355 | Ga0495593_0000321 | 3300047673 | Bacteria | 26527 |
| 356 | Ga0495593_0031420 | 3300047673 | Bacteria | 2900 |
| 357 | Ga0495593_0069526 | 3300047673 | Bacteria | 1830 |
| 358 | Ga0495602_0034315 | 3300048088 | Bacteria | 4748 |
| 359 | Ga0495602_0038535 | 3300048088 | Bacteria | 4417 |
| 360 | Ga0495602_0605162 | 3300048088 | Bacteria | 753 |
| 361 | Ga0495602_0643521 | 3300048088 | Bacteria | 725 |
| 362 | Ga0496100_0082597 | 3300048903 | Bacteria | 2173 |
| 363 | Ga0496101_0117817 | 3300048904 | Bacteria | 2005 |
| 364 | Ga0496102_0026708 | 3300048905 | Bacteria | 5153 |
| 365 | Ga0496102_0054164 | 3300048905 | Bacteria | 3657 |
| 366 | Ga0496103_0027003 | 3300048906 | Bacteria | 3476 |
| 367 | Ga0496104_0021948 | 3300048907 | Bacteria | 5864 |
| 368 | Ga0496104_0060487 | 3300048907 | Bacteria | 3588 |
| 369 | Ga0496104_0111039 | 3300048907 | Bacteria | 2628 |
| 370 | Ga0496104_0157345 | 3300048907 | Bacteria | 2180 |
| 371 | Ga0496105_0013476 | 3300048908 | Bacteria | 6491 |
| 372 | Ga0496105_0038018 | 3300048908 | Bacteria | 3965 |
| 373 | Ga0496105_0199663 | 3300048908 | Bacteria | 1632 |
| 374 | Ga0496106_0016874 | 3300048909 | Bacteria | 5403 |
| 375 | Ga0496106_0018456 | 3300048909 | Bacteria | 5158 |
| 376 | Ga0496106_0095898 | 3300048909 | Bacteria | 2295 |
| 377 | Ga0496107_0002177 | 3300048910 | Bacteria | 12590 |
| 378 | Ga0496107_0018133 | 3300048910 | Bacteria | 4953 |
| 379 | Ga0496107_0153969 | 3300048910 | Bacteria | 1701 |
| 380 | Ga0496108_0003416 | 3300048911 | Bacteria | 12751 |
| 381 | Ga0496108_0023228 | 3300048911 | Bacteria | 5101 |
| 382 | Ga0496108_0196758 | 3300048911 | Bacteria | 1748 |
| 383 | Ga0496109_0000230 | 3300048912 | Bacteria | 54618 |
| 384 | Ga0496109_0017788 | 3300048912 | Bacteria | 6234 |
| 385 | Ga0496109_0586664 | 3300048912 | Bacteria | 1050 |
| 386 | Ga0496110_0016246 | 3300048913 | Bacteria | 6211 |
| 387 | Ga0496110_0137148 | 3300048913 | Bacteria | 2211 |
| 388 | Ga0496110_0203385 | 3300048913 | Bacteria | 1799 |
| 389 | Ga0496110_0747600 | 3300048913 | Bacteria | 881 |
| 390 | Ga0496111_0023006 | 3300048914 | Bacteria | 4370 |
| 391 | Ga0496111_0067534 | 3300048914 | Bacteria | 2597 |
| 392 | Ga0496111_0119277 | 3300048914 | Bacteria | 1948 |
| 393 | Ga0496112_0009599 | 3300048915 | Bacteria | 8727 |
| 394 | Ga0496112_0025801 | 3300048915 | Bacteria | 5645 |
| 395 | Ga0496112_0053526 | 3300048915 | Bacteria | 3964 |
| 396 | Ga0496112_0055204 | 3300048915 | Bacteria | 3905 |
| 397 | Ga0496112_0745281 | 3300048915 | Bacteria | 906 |
| 398 | Ga0496113_0006600 | 3300048916 | Bacteria | 7376 |
| 399 | Ga0496113_0066885 | 3300048916 | Bacteria | 2723 |
| 400 | Ga0496113_0072032 | 3300048916 | Bacteria | 2629 |
| 401 | Ga0496114_0031540 | 3300048917 | Bacteria | 4361 |
| 402 | Ga0496114_0073302 | 3300048917 | Bacteria | 2881 |
| 403 | Ga0496115_0005259 | 3300048918 | Bacteria | 9407 |
| 404 | Ga0496115_0064029 | 3300048918 | Bacteria | 2967 |
| 405 | Ga0496119_0076280 | 3300048922 | Bacteria | 1945 |
| 406 | Ga0496121_0002915 | 3300048924 | Bacteria | 25094 |
| 407 | Ga0496121_0100455 | 3300048924 | Bacteria | 2233 |
| 408 | Ga0496126_0418186 | 3300048929 | Bacteria | 1084 |
| 409 | Ga0496126_0674358 | 3300048929 | Bacteria | 806 |
| 410 | nmdc:mga0yw44_172735_c1 | 3300050492 | Bacteria | 1420 |
| 411 | Ga0495601_0053666 | 3300053077 | Bacteria | 2548 |
| 412 | Ga0495601_0479686 | 3300053077 | Bacteria | 803 |
| 413 | Ga0495601_0537644 | 3300053077 | Bacteria | 753 |
| 414 | Ga0495612_0005522 | 3300053078 | Bacteria | 5227 |
| 415 | Ga0495612_0008630 | 3300053078 | Bacteria | 4131 |
| 416 | Ga0495595_0014358 | 3300053084 | Bacteria | 3359 |
| 417 | Ga0495595_0017393 | 3300053084 | Bacteria | 3093 |
| 418 | Ga0495595_0070165 | 3300053084 | Bacteria | 1655 |
| 419 | Ga0495619_0004748 | 3300053085 | Bacteria | 8643 |
| 420 | Ga0495619_0037345 | 3300053085 | Bacteria | 3164 |
| 421 | Ga0495619_0097270 | 3300053085 | Bacteria | 2000 |
| 422 | Ga0495619_0188315 | 3300053085 | Bacteria | 1428 |
| 423 | Ga0495619_0667252 | 3300053085 | Bacteria | 708 |
| 424 | Ga0500578_0094579 | 3300053086 | Bacteria | 1896 |
| 425 | Ga0500578_0201428 | 3300053086 | Bacteria | 1218 |
| 426 | Ga0500578_0202470 | 3300053086 | Bacteria | 1214 |
| 427 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 428 | Ga0500647_0234730 | 3300053091 | Bacteria | 814 |
| 429 | Ga0500651_0013550 | 3300053093 | Bacteria | 4969 |
| 430 | Ga0500566_0084289 | 3300053094 | Bacteria | 1764 |
| 431 | Ga0500640_039162 | 3300053095 | Bacteria | 2082 |
| 432 | Ga0500648_146433 | 3300053097 | Bacteria | 1262 |
| 433 | Ga0500650_0283029 | 3300053098 | Bacteria | 737 |
| 434 | Ga0500555_005779 | 3300053103 | Bacteria | 3511 |
| 435 | Ga0500556_0005933 | 3300053104 | Bacteria | 3459 |
| 436 | Ga0500569_027396 | 3300053109 | Bacteria | 1570 |
| 437 | Ga0500572_006678 | 3300053111 | Bacteria | 2648 |
| 438 | Ga0500594_0004879 | 3300053118 | Bacteria | 2966 |
| 439 | Ga0500595_002456 | 3300053119 | Bacteria | 9189 |
| 440 | Ga0500595_007068 | 3300053119 | Bacteria | 4694 |
| 441 | Ga0500607_033384 | 3300053121 | Bacteria | 2819 |
| 442 | Ga0500608_031942 | 3300053122 | Bacteria | 2500 |
| 443 | Ga0500614_025437 | 3300053123 | Bacteria | 1407 |
| 444 | Ga0500642_0012128 | 3300053130 | Bacteria | 3113 |
| 445 | Ga0500655_060615 | 3300053133 | Bacteria | 762 |
| 446 | Ga0500559_0029270 | 3300053136 | Bacteria | 2357 |
| 447 | Ga0500568_0024528 | 3300053139 | Bacteria | 2553 |
| 448 | Ga0500588_0032160 | 3300053146 | Bacteria | 1520 |
| 449 | Ga0500616_0075077 | 3300053153 | Bacteria | 1712 |
| 450 | Ga0500619_001595 | 3300053154 | Bacteria | 4071 |
| 451 | Ga0500620_001777 | 3300053155 | Bacteria | 4110 |
| 452 | Ga0500622_0153432 | 3300053156 | Bacteria | 1086 |
| 453 | Ga0500624_002308 | 3300053157 | Bacteria | 2611 |
| 454 | Ga0500627_0176241 | 3300053158 | Bacteria | 962 |
| 455 | Ga0500639_092255 | 3300053163 | Bacteria | 1506 |
| 456 | Ga0500636_0000701 | 3300053177 | Bacteria | 17989 |
| 457 | Ga0500599_007270 | 3300053736 | Bacteria | 1422 |
| 458 | Ga0500601_000311 | 3300053737 | Bacteria | 9117 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10297361 | Ga0105237_102973611 | 197 |
| 2 | 3300013105 | Ga0157369_10043264 | Ga0157369_100432644 | 197 |
| 3 | 3300003659 | JGI25404J52841_10006527 | JGI25404J52841_100065272 | 198 |
| 4 | 3300005983 | Ga0081540_1035294 | Ga0081540_10352943 | 198 |
| 5 | 3300039437 | Ga0436365_1505691 | Ga0436365_1505691_558_1166 | 199 |
| 6 | 3300048929 | Ga0496126_0674358 | Ga0496126_0674358_12_707 | 199 |
| 7 | 3300035116 | Ga0373945_0276478 | Ga0373945_0276478_95_697 | 200 |
| 8 | 3300035171 | Ga0373946_0417340 | Ga0373946_0417340_53_655 | 200 |
| 9 | 3300005458 | Ga0070681_10020543 | Ga0070681_100205435 | 201 |
| 10 | 3300005563 | Ga0068855_100562686 | Ga0068855_1005626861 | 201 |
| 11 | 3300005616 | Ga0068852_100489574 | Ga0068852_1004895741 | 201 |
| 12 | 3300009545 | Ga0105237_10559011 | Ga0105237_105590112 | 201 |
| 13 | 3300025912 | Ga0207707_10024022 | Ga0207707_100240223 | 201 |
| 14 | 3300025921 | Ga0207652_10597403 | Ga0207652_105974031 | 201 |
| 15 | 3300025949 | Ga0207667_10640702 | Ga0207667_106407021 | 201 |
| 16 | 3300044683 | Ga0466965_0289232 | Ga0466965_0289232_199_804 | 201 |
| 17 | 3300037068 | Ga0373925_0557096 | Ga0373925_0557096_61_669 | 202 |
| 18 | 3300046679 | Ga0495623_0086541 | Ga0495623_0086541_1309_1917 | 202 |
| 19 | 3300053153 | Ga0500616_0075077 | Ga0500616_0075077_1091_1699 | 202 |
| 20 | iso_pu_bacteria | 2824600985 | 2824607170 | 202 |
| 21 | iso_pu_bacteria | 2824609381 | 2824615130 | 202 |
| 22 | iso_pu_bacteria | 2824653114 | 2824659901 | 202 |
| 23 | iso_pu_bacteria | 2885409591 | 2885412428 | 202 |
| 24 | iso_pu_bacteria | 2888419890 | 2888426682 | 202 |
| 25 | 3300003659 | JGI25404J52841_10084347 | JGI25404J52841_100843471 | 203 |
| 26 | 3300005983 | Ga0081540_1089171 | Ga0081540_10891711 | 203 |
| 27 | 3300007265 | Ga0099794_10199537 | Ga0099794_101995371 | 203 |
| 28 | 3300025916 | Ga0207663_10112086 | Ga0207663_101120863 | 203 |
| 29 | 3300036401 | Ga0373937_0202213 | Ga0373937_0202213_282_893 | 203 |
| 30 | 3300044658 | Ga0466972_0034670 | Ga0466972_0034670_714_1325 | 203 |
| 31 | 3300044735 | Ga0466968_0065287 | Ga0466968_0065287_922_1533 | 203 |
| 32 | 3300044901 | Ga0466960_0029330 | Ga0466960_0029330_24_635 | 203 |
| 33 | 3300046526 | Ga0495666_0036901 | Ga0495666_0036901_500_1111 | 203 |
| 34 | 3300046543 | Ga0495645_0098842 | Ga0495645_0098842_1069_1680 | 203 |
| 35 | 3300046559 | Ga0495667_0069957 | Ga0495667_0069957_317_928 | 203 |
| 36 | 3300053086 | Ga0500578_0202470 | Ga0500578_0202470_287_898 | 203 |
| 37 | 3300053109 | Ga0500569_027396 | Ga0500569_027396_473_1084 | 203 |
| 38 | iso_pu_bacteria | 2513237094 | 2513643243 | 203 |
| 39 | iso_pu_bacteria | 2513237095 | 2513651032 | 203 |
| 40 | iso_pu_bacteria | 2513237102 | 2513699464 | 203 |
| 41 | iso_pu_bacteria | 2517093001 | 2517104421 | 203 |
| 42 | iso_pu_bacteria | 2816332527 | 2818242252 | 203 |
| 43 | iso_pu_bacteria | 2824617872 | 2824625652 | 203 |
| 44 | iso_pu_bacteria | 2824626560 | 2824633331 | 203 |
| 45 | iso_pu_bacteria | 2824635225 | 2824641844 | 203 |
| 46 | iso_pu_bacteria | 2824644064 | 2824649110 | 203 |
| 47 | iso_pu_bacteria | 2824714736 | 2824721544 | 203 |
| 48 | iso_pu_bacteria | 2824723954 | 2824729372 | 203 |
| 49 | iso_pu_bacteria | 2844315083 | 2844321169 | 203 |
| 50 | iso_pu_bacteria | 2847930680 | 2847932247 | 203 |
| 51 | iso_pu_bacteria | 2874628541 | 2874630912 | 203 |
| 52 | iso_pu_bacteria | 2879083081 | 2879089349 | 203 |
| 53 | iso_pu_bacteria | 2881364244 | 2881371072 | 203 |
| 54 | iso_pu_bacteria | 2888378607 | 2888387451 | 203 |
| 55 | iso_pu_bacteria | 2888388044 | 2888391739 | 203 |
| 56 | iso_pu_bacteria | 2903727486 | 2903728593 | 203 |
| 57 | iso_pu_bacteria | 2906602504 | 2906607784 | 203 |
| 58 | iso_pu_bacteria | 2906626472 | 2906630075 | 203 |
| 59 | iso_pu_bacteria | 2906643746 | 2906649781 | 203 |
| 60 | iso_pu_bacteria | 2908775508 | 2908782772 | 203 |
| 61 | iso_pu_bacteria | 2932794094 | 2932796827 | 203 |
| 62 | iso_pu_bacteria | 2932801729 | 2932802395 | 203 |
| 63 | iso_pu_bacteria | 2935883170 | 2935887169 | 203 |
| 64 | iso_pu_bacteria | 2935959822 | 2935965690 | 203 |
| 65 | iso_pu_bacteria | 2941531003 | 2941537344 | 203 |
| 66 | iso_pu_bacteria | 3005594810 | 3005601499 | 203 |
| 67 | iso_pu_bacteria | 8016583857 | 8016587908 | 203 |
| 68 | iso_pu_bacteria | 8019648815 | 8019653606 | 203 |
| 69 | 3300048924 | Ga0496121_0100455 | Ga0496121_0100455_784_1398 | 204 |
| 70 | 3300005439 | Ga0070711_100398237 | Ga0070711_1003982371 | 205 |
| 71 | 3300005455 | Ga0070663_100369100 | Ga0070663_1003691001 | 205 |
| 72 | 3300005544 | Ga0070686_100138487 | Ga0070686_1001384871 | 205 |
| 73 | 3300005577 | Ga0068857_100130475 | Ga0068857_1001304752 | 205 |
| 74 | 3300005618 | Ga0068864_100016090 | Ga0068864_1000160902 | 205 |
| 75 | 3300005841 | Ga0068863_100437519 | Ga0068863_1004375191 | 205 |
| 76 | 3300007788 | Ga0099795_10250670 | Ga0099795_102506701 | 205 |
| 77 | 3300009551 | Ga0105238_10297957 | Ga0105238_102979572 | 205 |
| 78 | 3300010375 | Ga0105239_10124139 | Ga0105239_101241392 | 205 |
| 79 | 3300013296 | Ga0157374_10428494 | Ga0157374_104284941 | 205 |
| 80 | 3300014325 | Ga0163163_10218870 | Ga0163163_102188703 | 205 |
| 81 | 3300014968 | Ga0157379_10398932 | Ga0157379_103989321 | 205 |
| 82 | 3300014969 | Ga0157376_10114806 | Ga0157376_101148063 | 205 |
| 83 | 3300025916 | Ga0207663_10051060 | Ga0207663_100510603 | 205 |
| 84 | 3300025925 | Ga0207650_10683007 | Ga0207650_106830072 | 205 |
| 85 | 3300025927 | Ga0207687_10109720 | Ga0207687_101097202 | 205 |
| 86 | 3300025933 | Ga0207706_10258587 | Ga0207706_102585871 | 205 |
| 87 | 3300026067 | Ga0207678_10259588 | Ga0207678_102595882 | 205 |
| 88 | 3300026095 | Ga0207676_10035908 | Ga0207676_100359082 | 205 |
| 89 | 3300035083 | Ga0373926_0026762 | Ga0373926_0026762_527_1162 | 205 |
| 90 | 3300035111 | Ga0373923_0004430 | Ga0373923_0004430_1417_2034 | 205 |
| 91 | 3300035113 | Ga0373936_0019613 | Ga0373936_0019613_1110_1745 | 205 |
| 92 | 3300035113 | Ga0373936_0021993 | Ga0373936_0021993_308_925 | 205 |
| 93 | 3300035116 | Ga0373945_0040597 | Ga0373945_0040597_605_1240 | 205 |
| 94 | 3300035170 | Ga0373943_0001395 | Ga0373943_0001395_1448_2083 | 205 |
| 95 | 3300035170 | Ga0373943_0085384 | Ga0373943_0085384_752_1369 | 205 |
| 96 | 3300035172 | Ga0373955_0033119 | Ga0373955_0033119_1189_1824 | 205 |
| 97 | 3300035410 | Ga0373924_0038958 | Ga0373924_0038958_650_1267 | 205 |
| 98 | 3300035691 | Ga0373931_0178503 | Ga0373931_0178503_297_923 | 205 |
| 99 | 3300035692 | Ga0373935_0001273 | Ga0373935_0001273_7650_8285 | 205 |
| 100 | 3300035692 | Ga0373935_0052160 | Ga0373935_0052160_219_836 | 205 |
| 101 | 3300035695 | Ga0373927_0000792 | Ga0373927_0000792_21401_22036 | 205 |
| 102 | 3300035695 | Ga0373927_0064177 | Ga0373927_0064177_661_1278 | 205 |
| 103 | 3300035725 | Ga0373947_0002479 | Ga0373947_0002479_7011_7646 | 205 |
| 104 | 3300035725 | Ga0373947_0014814 | Ga0373947_0014814_1297_1914 | 205 |
| 105 | 3300037068 | Ga0373925_0007136 | Ga0373925_0007136_5251_5886 | 205 |
| 106 | 3300037068 | Ga0373925_0113735 | Ga0373925_0113735_233_850 | 205 |
| 107 | 3300046454 | Ga0495592_0058249 | Ga0495592_0058249_1979_2614 | 205 |
| 108 | 3300046454 | Ga0495592_0068034 | Ga0495592_0068034_1779_2396 | 205 |
| 109 | 3300046455 | Ga0495603_0003882 | Ga0495603_0003882_7774_8409 | 205 |
| 110 | 3300046459 | Ga0495629_0000236 | Ga0495629_0000236_2911_3546 | 205 |
| 111 | 3300046461 | Ga0495641_0003725 | Ga0495641_0003725_2600_3235 | 205 |
| 112 | 3300046472 | Ga0495580_0019020 | Ga0495580_0019020_3279_3914 | 205 |
| 113 | 3300046472 | Ga0495580_0102441 | Ga0495580_0102441_94_711 | 205 |
| 114 | 3300046473 | Ga0495582_0000084 | Ga0495582_0000084_34771_35406 | 205 |
| 115 | 3300046475 | Ga0495639_0001155 | Ga0495639_0001155_7029_7664 | 205 |
| 116 | 3300046475 | Ga0495639_0085844 | Ga0495639_0085844_326_943 | 205 |
| 117 | 3300046476 | Ga0495662_0000454 | Ga0495662_0000454_17515_18150 | 205 |
| 118 | 3300046477 | Ga0495664_0003578 | Ga0495664_0003578_4116_4751 | 205 |
| 119 | 3300046477 | Ga0495664_0031081 | Ga0495664_0031081_1788_2405 | 205 |
| 120 | 3300046499 | Ga0495594_0001840 | Ga0495594_0001840_2120_2755 | 205 |
| 121 | 3300046511 | Ga0495608_0191726 | Ga0495608_0191726_188_823 | 205 |
| 122 | 3300046514 | Ga0495618_0020851 | Ga0495618_0020851_3285_3902 | 205 |
| 123 | 3300046516 | Ga0495628_0065003 | Ga0495628_0065003_1717_2334 | 205 |
| 124 | 3300046516 | Ga0495628_0080234 | Ga0495628_0080234_1561_2196 | 205 |
| 125 | 3300046517 | Ga0495630_0002622 | Ga0495630_0002622_12_647 | 205 |
| 126 | 3300046517 | Ga0495630_0087384 | Ga0495630_0087384_985_1602 | 205 |
| 127 | 3300046526 | Ga0495666_0020271 | Ga0495666_0020271_558_1193 | 205 |
| 128 | 3300046529 | Ga0495652_0084605 | Ga0495652_0084605_1344_1979 | 205 |
| 129 | 3300046531 | Ga0495665_0001312 | Ga0495665_0001312_8953_9588 | 205 |
| 130 | 3300046531 | Ga0495665_0016204 | Ga0495665_0016204_668_1285 | 205 |
| 131 | 3300046533 | Ga0495640_0011192 | Ga0495640_0011192_738_1373 | 205 |
| 132 | 3300046533 | Ga0495640_0032353 | Ga0495640_0032353_1699_2316 | 205 |
| 133 | 3300046536 | Ga0495587_0123417 | Ga0495587_0123417_76_693 | 205 |
| 134 | 3300046536 | Ga0495587_0189042 | Ga0495587_0189042_81_716 | 205 |
| 135 | 3300046557 | Ga0495622_0003118 | Ga0495622_0003118_907_1542 | 205 |
| 136 | 3300046642 | Ga0495634_0000321 | Ga0495634_0000321_33913_34548 | 205 |
| 137 | 3300046642 | Ga0495634_0056445 | Ga0495634_0056445_1341_1958 | 205 |
| 138 | 3300046663 | Ga0495635_0026028 | Ga0495635_0026028_153_788 | 205 |
| 139 | 3300046663 | Ga0495635_0030431 | Ga0495635_0030431_2617_3234 | 205 |
| 140 | 3300046678 | Ga0495599_0061754 | Ga0495599_0061754_517_1152 | 205 |
| 141 | 3300046679 | Ga0495623_0053900 | Ga0495623_0053900_824_1441 | 205 |
| 142 | 3300046680 | Ga0495646_0029579 | Ga0495646_0029579_1461_2096 | 205 |
| 143 | 3300046681 | Ga0495647_0003687 | Ga0495647_0003687_4126_4761 | 205 |
| 144 | 3300046681 | Ga0495647_0045848 | Ga0495647_0045848_613_1230 | 205 |
| 145 | 3300046683 | Ga0495658_0002077 | Ga0495658_0002077_7516_8151 | 205 |
| 146 | 3300046683 | Ga0495658_0038010 | Ga0495658_0038010_408_1025 | 205 |
| 147 | 3300046689 | Ga0495613_0015877 | Ga0495613_0015877_4484_5119 | 205 |
| 148 | 3300046690 | Ga0495624_0001596 | Ga0495624_0001596_2447_3082 | 205 |
| 149 | 3300047315 | Ga0495581_0000174 | Ga0495581_0000174_21506_22141 | 205 |
| 150 | 3300047315 | Ga0495581_0021346 | Ga0495581_0021346_2332_2949 | 205 |
| 151 | 3300047317 | Ga0495604_0131064 | Ga0495604_0131064_103_720 | 205 |
| 152 | 3300047317 | Ga0495604_0173616 | Ga0495604_0173616_577_1212 | 205 |
| 153 | 3300047319 | Ga0495674_0010664 | Ga0495674_0010664_1558_2175 | 205 |
| 154 | 3300047319 | Ga0495674_0012229 | Ga0495674_0012229_6942_7577 | 205 |
| 155 | 3300047321 | Ga0495676_0052222 | Ga0495676_0052222_503_1138 | 205 |
| 156 | 3300047471 | Ga0495684_0007348 | Ga0495684_0007348_6766_7401 | 205 |
| 157 | 3300047471 | Ga0495684_0150183 | Ga0495684_0150183_630_1247 | 205 |
| 158 | 3300047673 | Ga0495593_0000321 | Ga0495593_0000321_12700_13335 | 205 |
| 159 | 3300047673 | Ga0495593_0069526 | Ga0495593_0069526_981_1598 | 205 |
| 160 | 3300048905 | Ga0496102_0026708 | Ga0496102_0026708_1358_1984 | 205 |
| 161 | 3300048907 | Ga0496104_0021948 | Ga0496104_0021948_1692_2318 | 205 |
| 162 | 3300048908 | Ga0496105_0013476 | Ga0496105_0013476_1872_2498 | 205 |
| 163 | 3300048909 | Ga0496106_0095898 | Ga0496106_0095898_1381_2007 | 205 |
| 164 | 3300048910 | Ga0496107_0018133 | Ga0496107_0018133_2069_2695 | 205 |
| 165 | 3300048913 | Ga0496110_0016246 | Ga0496110_0016246_2221_2847 | 205 |
| 166 | 3300048913 | Ga0496110_0747600 | Ga0496110_0747600_233_862 | 205 |
| 167 | 3300048915 | Ga0496112_0053526 | Ga0496112_0053526_1982_2608 | 205 |
| 168 | 3300048915 | Ga0496112_0745281 | Ga0496112_0745281_74_703 | 205 |
| 169 | 3300048916 | Ga0496113_0072032 | Ga0496113_0072032_129_755 | 205 |
| 170 | 3300053078 | Ga0495612_0005522 | Ga0495612_0005522_3948_4565 | 205 |
| 171 | 3300005458 | Ga0070681_10096136 | Ga0070681_100961363 | 206 |
| 172 | 3300005530 | Ga0070679_100144908 | Ga0070679_1001449082 | 206 |
| 173 | 3300005535 | Ga0070684_100069141 | Ga0070684_1000691412 | 206 |
| 174 | 3300007265 | Ga0099794_10132452 | Ga0099794_101324522 | 206 |
| 175 | 3300007265 | Ga0099794_10136402 | Ga0099794_101364021 | 206 |
| 176 | 3300009093 | Ga0105240_10444411 | Ga0105240_104444111 | 206 |
| 177 | 3300020069 | Ga0197907_10398635 | Ga0197907_103986352 | 206 |
| 178 | 3300021388 | Ga0213875_10077451 | Ga0213875_100774511 | 206 |
| 179 | 3300025302 | Ga0207426_1013780 | Ga0207426_10137805 | 206 |
| 180 | 3300025912 | Ga0207707_10311839 | Ga0207707_103118392 | 206 |
| 181 | 3300025913 | Ga0207695_10126612 | Ga0207695_101266122 | 206 |
| 182 | 3300025921 | Ga0207652_10088917 | Ga0207652_100889172 | 206 |
| 183 | 3300025944 | Ga0207661_10000597 | Ga0207661_1000059713 | 206 |
| 184 | 3300026121 | Ga0207683_10207698 | Ga0207683_102076983 | 206 |
| 185 | 3300037853 | Ga0436364_0994846 | Ga0436364_0994846_1549_2169 | 206 |
| 186 | 3300037853 | Ga0436364_0997941 | Ga0436364_0997941_503_1123 | 206 |
| 187 | 3300039437 | Ga0436365_1077088 | Ga0436365_1077088_33_653 | 206 |
| 188 | 3300039437 | Ga0436365_1444382 | Ga0436365_1444382_354_974 | 206 |
| 189 | 3300041507 | Ga0451851_0123442 | Ga0451851_0123442_133_753 | 206 |
| 190 | 3300046507 | Ga0495606_0017760 | Ga0495606_0017760_3057_3677 | 206 |
| 191 | 3300046529 | Ga0495652_0138489 | Ga0495652_0138489_962_1582 | 206 |
| 192 | 3300046559 | Ga0495667_0240177 | Ga0495667_0240177_439_1059 | 206 |
| 193 | 3300046809 | Ga0495600_0056308 | Ga0495600_0056308_365_985 | 206 |
| 194 | 3300047469 | Ga0495673_0014385 | Ga0495673_0014385_2580_3203 | 206 |
| 195 | 3300047472 | Ga0495686_0026657 | Ga0495686_0026657_1561_2181 | 206 |
| 196 | 3300048088 | Ga0495602_0643521 | Ga0495602_0643521_41_661 | 206 |
| 197 | 3300048922 | Ga0496119_0076280 | Ga0496119_0076280_486_1106 | 206 |
| 198 | 3300053086 | Ga0500578_0201428 | Ga0500578_0201428_25_645 | 206 |
| 199 | 3300053093 | Ga0500651_0013550 | Ga0500651_0013550_2546_3166 | 206 |
| 200 | 3300053098 | Ga0500650_0283029 | Ga0500650_0283029_61_681 | 206 |
| 201 | 3300053118 | Ga0500594_0004879 | Ga0500594_0004879_262_882 | 206 |
| 202 | 3300053119 | Ga0500595_002456 | Ga0500595_002456_6740_7360 | 206 |
| 203 | 3300053130 | Ga0500642_0012128 | Ga0500642_0012128_2346_2966 | 206 |
| 204 | 3300053156 | Ga0500622_0153432 | Ga0500622_0153432_109_729 | 206 |
| 205 | 3300053158 | Ga0500627_0176241 | Ga0500627_0176241_33_653 | 206 |
| 206 | 3300003203 | JGI25406J46586_10000043 | JGI25406J46586_1000004325 | 207 |
| 207 | 3300004625 | Ga0055543_1017285 | Ga0055543_10172852 | 207 |
| 208 | 3300005262 | Ga0065165_1005519 | Ga0065165_10055197 | 207 |
| 209 | 3300005293 | Ga0065715_10360587 | Ga0065715_103605871 | 207 |
| 210 | 3300005327 | Ga0070658_10140542 | Ga0070658_101405421 | 207 |
| 211 | 3300005327 | Ga0070658_10329989 | Ga0070658_103299891 | 207 |
| 212 | 3300005336 | Ga0070680_100015508 | Ga0070680_1000155087 | 207 |
| 213 | 3300005339 | Ga0070660_100002476 | Ga0070660_1000024765 | 207 |
| 214 | 3300005344 | Ga0070661_100123382 | Ga0070661_1001233823 | 207 |
| 215 | 3300005356 | Ga0070674_100107727 | Ga0070674_1001077273 | 207 |
| 216 | 3300005356 | Ga0070674_100139838 | Ga0070674_1001398382 | 207 |
| 217 | 3300005364 | Ga0070673_100745570 | Ga0070673_1007455701 | 207 |
| 218 | 3300005366 | Ga0070659_100071210 | Ga0070659_1000712101 | 207 |
| 219 | 3300005434 | Ga0070709_10064886 | Ga0070709_100648863 | 207 |
| 220 | 3300005435 | Ga0070714_100563062 | Ga0070714_1005630621 | 207 |
| 221 | 3300005436 | Ga0070713_100016921 | Ga0070713_1000169216 | 207 |
| 222 | 3300005436 | Ga0070713_100298475 | Ga0070713_1002984752 | 207 |
| 223 | 3300005455 | Ga0070663_100334322 | Ga0070663_1003343222 | 207 |
| 224 | 3300005456 | Ga0070678_100047779 | Ga0070678_1000477792 | 207 |
| 225 | 3300005458 | Ga0070681_10122770 | Ga0070681_101227702 | 207 |
| 226 | 3300005459 | Ga0068867_100209218 | Ga0068867_1002092182 | 207 |
| 227 | 3300005471 | Ga0070698_101234308 | Ga0070698_1012343081 | 207 |
| 228 | 3300005530 | Ga0070679_100813663 | Ga0070679_1008136631 | 207 |
| 229 | 3300005535 | Ga0070684_100019396 | Ga0070684_1000193967 | 207 |
| 230 | 3300005539 | Ga0068853_100001656 | Ga0068853_1000016566 | 207 |
| 231 | 3300005548 | Ga0070665_100243818 | Ga0070665_1002438182 | 207 |
| 232 | 3300005563 | Ga0068855_100054227 | Ga0068855_1000542273 | 207 |
| 233 | 3300005564 | Ga0070664_100459958 | Ga0070664_1004599582 | 207 |
| 234 | 3300005577 | Ga0068857_100364785 | Ga0068857_1003647852 | 207 |
| 235 | 3300005616 | Ga0068852_100082890 | Ga0068852_1000828904 | 207 |
| 236 | 3300005719 | Ga0068861_100440514 | Ga0068861_1004405142 | 207 |
| 237 | 3300005834 | Ga0068851_10023151 | Ga0068851_100231512 | 207 |
| 238 | 3300005841 | Ga0068863_100435837 | Ga0068863_1004358372 | 207 |
| 239 | 3300005985 | Ga0081539_10000324 | Ga0081539_1000032495 | 207 |
| 240 | 3300005985 | Ga0081539_10001968 | Ga0081539_1000196822 | 207 |
| 241 | 3300006038 | Ga0075365_10209539 | Ga0075365_102095392 | 207 |
| 242 | 3300006051 | Ga0075364_10088895 | Ga0075364_100888952 | 207 |
| 243 | 3300006353 | Ga0075370_10033413 | Ga0075370_100334133 | 207 |
| 244 | 3300007788 | Ga0099795_10008203 | Ga0099795_100082033 | 207 |
| 245 | 3300009093 | Ga0105240_10007694 | Ga0105240_100076943 | 207 |
| 246 | 3300009101 | Ga0105247_10052284 | Ga0105247_100522843 | 207 |
| 247 | 3300009176 | Ga0105242_10278216 | Ga0105242_102782162 | 207 |
| 248 | 3300009177 | Ga0105248_10439938 | Ga0105248_104399382 | 207 |
| 249 | 3300009545 | Ga0105237_10015525 | Ga0105237_100155252 | 207 |
| 250 | 3300009545 | Ga0105237_10258969 | Ga0105237_102589692 | 207 |
| 251 | 3300009551 | Ga0105238_10029507 | Ga0105238_100295077 | 207 |
| 252 | 3300010159 | Ga0099796_10068340 | Ga0099796_100683401 | 207 |
| 253 | 3300010375 | Ga0105239_10029597 | Ga0105239_100295975 | 207 |
| 254 | 3300010375 | Ga0105239_10047895 | Ga0105239_100478953 | 207 |
| 255 | 3300013105 | Ga0157369_10019439 | Ga0157369_100194399 | 207 |
| 256 | 3300013297 | Ga0157378_11096631 | Ga0157378_110966311 | 207 |
| 257 | 3300013306 | Ga0163162_10369271 | Ga0163162_103692712 | 207 |
| 258 | 3300013307 | Ga0157372_11351747 | Ga0157372_113517471 | 207 |
| 259 | 3300013308 | Ga0157375_10352162 | Ga0157375_103521622 | 207 |
| 260 | 3300014325 | Ga0163163_10785806 | Ga0163163_107858061 | 207 |
| 261 | 3300025230 | Ga0209563_103012 | Ga0209563_1030124 | 207 |
| 262 | 3300025253 | Ga0209677_104064 | Ga0209677_1040645 | 207 |
| 263 | 3300025273 | Ga0209673_1022322 | Ga0209673_10223221 | 207 |
| 264 | 3300025297 | Ga0209758_1005318 | Ga0209758_10053188 | 207 |
| 265 | 3300025302 | Ga0207426_1005781 | Ga0207426_10057815 | 207 |
| 266 | 3300025302 | Ga0207426_1007382 | Ga0207426_10073823 | 207 |
| 267 | 3300025304 | Ga0209257_1054008 | Ga0209257_10540081 | 207 |
| 268 | 3300025898 | Ga0207692_10200510 | Ga0207692_102005101 | 207 |
| 269 | 3300025900 | Ga0207710_10032876 | Ga0207710_100328763 | 207 |
| 270 | 3300025906 | Ga0207699_10064392 | Ga0207699_100643923 | 207 |
| 271 | 3300025909 | Ga0207705_10089755 | Ga0207705_100897552 | 207 |
| 272 | 3300025909 | Ga0207705_10322001 | Ga0207705_103220012 | 207 |
| 273 | 3300025912 | Ga0207707_10003102 | Ga0207707_1000310211 | 207 |
| 274 | 3300025913 | Ga0207695_10063410 | Ga0207695_100634102 | 207 |
| 275 | 3300025914 | Ga0207671_10084122 | Ga0207671_100841222 | 207 |
| 276 | 3300025914 | Ga0207671_10213861 | Ga0207671_102138611 | 207 |
| 277 | 3300025915 | Ga0207693_10117582 | Ga0207693_101175822 | 207 |
| 278 | 3300025917 | Ga0207660_10003607 | Ga0207660_1000360710 | 207 |
| 279 | 3300025919 | Ga0207657_10015320 | Ga0207657_100153203 | 207 |
| 280 | 3300025920 | Ga0207649_10039938 | Ga0207649_100399384 | 207 |
| 281 | 3300025921 | Ga0207652_10052496 | Ga0207652_100524962 | 207 |
| 282 | 3300025922 | Ga0207646_10345011 | Ga0207646_103450112 | 207 |
| 283 | 3300025924 | Ga0207694_10007559 | Ga0207694_100075592 | 207 |
| 284 | 3300025926 | Ga0207659_10222364 | Ga0207659_102223641 | 207 |
| 285 | 3300025928 | Ga0207700_10024184 | Ga0207700_100241843 | 207 |
| 286 | 3300025929 | Ga0207664_10033040 | Ga0207664_100330404 | 207 |
| 287 | 3300025929 | Ga0207664_10118054 | Ga0207664_101180541 | 207 |
| 288 | 3300025937 | Ga0207669_10100216 | Ga0207669_101002161 | 207 |
| 289 | 3300025944 | Ga0207661_10470027 | Ga0207661_104700271 | 207 |
| 290 | 3300025949 | Ga0207667_10001989 | Ga0207667_1000198926 | 207 |
| 291 | 3300025960 | Ga0207651_11038356 | Ga0207651_110383561 | 207 |
| 292 | 3300026041 | Ga0207639_10004121 | Ga0207639_1000412110 | 207 |
| 293 | 3300026067 | Ga0207678_10096823 | Ga0207678_100968233 | 207 |
| 294 | 3300026067 | Ga0207678_10172161 | Ga0207678_101721612 | 207 |
| 295 | 3300026078 | Ga0207702_10477579 | Ga0207702_104775792 | 207 |
| 296 | 3300026088 | Ga0207641_10350473 | Ga0207641_103504731 | 207 |
| 297 | 3300026089 | Ga0207648_10124448 | Ga0207648_101244482 | 207 |
| 298 | 3300026116 | Ga0207674_10145484 | Ga0207674_101454841 | 207 |
| 299 | 3300026121 | Ga0207683_10076908 | Ga0207683_100769083 | 207 |
| 300 | 3300026121 | Ga0207683_10096708 | Ga0207683_100967082 | 207 |
| 301 | 3300026142 | Ga0207698_10253026 | Ga0207698_102530261 | 207 |
| 302 | 3300028379 | Ga0268266_10137558 | Ga0268266_101375583 | 207 |
| 303 | 3300028573 | Ga0265334_10037283 | Ga0265334_100372832 | 207 |
| 304 | 3300031235 | Ga0265330_10010904 | Ga0265330_100109043 | 207 |
| 305 | 3300031235 | Ga0265330_10059220 | Ga0265330_100592202 | 207 |
| 306 | 3300031238 | Ga0265332_10050591 | Ga0265332_100505912 | 207 |
| 307 | 3300031239 | Ga0265328_10092146 | Ga0265328_100921462 | 207 |
| 308 | 3300031595 | Ga0265313_10047266 | Ga0265313_100472662 | 207 |
| 309 | 3300033180 | Ga0307510_10006233 | Ga0307510_1000623312 | 207 |
| 310 | 3300034816 | Ga0373930_0081805 | Ga0373930_0081805_13_636 | 207 |
| 311 | 3300035084 | Ga0373928_0005159 | Ga0373928_0005159_561_1184 | 207 |
| 312 | 3300035086 | Ga0373934_0000917 | Ga0373934_0000917_7211_7834 | 207 |
| 313 | 3300035086 | Ga0373934_0043566 | Ga0373934_0043566_887_1510 | 207 |
| 314 | 3300035111 | Ga0373923_0009785 | Ga0373923_0009785_2500_3123 | 207 |
| 315 | 3300035114 | Ga0373939_0104584 | Ga0373939_0104584_191_814 | 207 |
| 316 | 3300035115 | Ga0373941_0033118 | Ga0373941_0033118_489_1112 | 207 |
| 317 | 3300035117 | Ga0373953_0007777 | Ga0373953_0007777_2907_3530 | 207 |
| 318 | 3300035117 | Ga0373953_0133001 | Ga0373953_0133001_243_866 | 207 |
| 319 | 3300035118 | Ga0373954_0007560 | Ga0373954_0007560_3896_4519 | 207 |
| 320 | 3300035118 | Ga0373954_0077586 | Ga0373954_0077586_808_1431 | 207 |
| 321 | 3300035119 | Ga0373956_0002486 | Ga0373956_0002486_4035_4658 | 207 |
| 322 | 3300035119 | Ga0373956_0012134 | Ga0373956_0012134_665_1288 | 207 |
| 323 | 3300035120 | Ga0373957_0005552 | Ga0373957_0005552_2564_3187 | 207 |
| 324 | 3300035120 | Ga0373957_0010606 | Ga0373957_0010606_1793_2416 | 207 |
| 325 | 3300035170 | Ga0373943_0244985 | Ga0373943_0244985_152_775 | 207 |
| 326 | 3300035172 | Ga0373955_0030392 | Ga0373955_0030392_2032_2655 | 207 |
| 327 | 3300035242 | Ga0373962_0068829 | Ga0373962_0068829_377_1000 | 207 |
| 328 | 3300035410 | Ga0373924_0007709 | Ga0373924_0007709_992_1615 | 207 |
| 329 | 3300035410 | Ga0373924_0039737 | Ga0373924_0039737_792_1415 | 207 |
| 330 | 3300035691 | Ga0373931_0003292 | Ga0373931_0003292_562_1185 | 207 |
| 331 | 3300035692 | Ga0373935_0094930 | Ga0373935_0094930_292_915 | 207 |
| 332 | 3300035695 | Ga0373927_0005966 | Ga0373927_0005966_3694_4317 | 207 |
| 333 | 3300035695 | Ga0373927_0429348 | Ga0373927_0429348_177_800 | 207 |
| 334 | 3300035724 | Ga0373933_0000964 | Ga0373933_0000964_2519_3142 | 207 |
| 335 | 3300035724 | Ga0373933_0004963 | Ga0373933_0004963_4449_5072 | 207 |
| 336 | 3300035725 | Ga0373947_0066856 | Ga0373947_0066856_476_1099 | 207 |
| 337 | 3300036401 | Ga0373937_0100605 | Ga0373937_0100605_270_893 | 207 |
| 338 | 3300036401 | Ga0373937_0280338 | Ga0373937_0280338_693_1316 | 207 |
| 339 | 3300037068 | Ga0373925_0082976 | Ga0373925_0082976_384_1007 | 207 |
| 340 | 3300037068 | Ga0373925_0248345 | Ga0373925_0248345_153_776 | 207 |
| 341 | 3300037068 | Ga0373925_0474061 | Ga0373925_0474061_204_827 | 207 |
| 342 | 3300037418 | Ga0395900_0012938 | Ga0395900_0012938_5399_6022 | 207 |
| 343 | 3300037466 | Ga0395898_0071507 | Ga0395898_0071507_311_934 | 207 |
| 344 | 3300037466 | Ga0395898_0644608 | Ga0395898_0644608_253_879 | 207 |
| 345 | 3300038443 | Ga0395901_0061423 | Ga0395901_0061423_2487_3110 | 207 |
| 346 | 3300046454 | Ga0495592_0002895 | Ga0495592_0002895_3110_3733 | 207 |
| 347 | 3300046454 | Ga0495592_0023469 | Ga0495592_0023469_2820_3443 | 207 |
| 348 | 3300046454 | Ga0495592_0066701 | Ga0495592_0066701_1032_1655 | 207 |
| 349 | 3300046459 | Ga0495629_0011071 | Ga0495629_0011071_2764_3387 | 207 |
| 350 | 3300046459 | Ga0495629_0021237 | Ga0495629_0021237_221_844 | 207 |
| 351 | 3300046460 | Ga0495638_0040101 | Ga0495638_0040101_515_1138 | 207 |
| 352 | 3300046462 | Ga0495651_0015634 | Ga0495651_0015634_2187_2810 | 207 |
| 353 | 3300046462 | Ga0495651_0020175 | Ga0495651_0020175_2571_3194 | 207 |
| 354 | 3300046462 | Ga0495651_0108523 | Ga0495651_0108523_1355_1978 | 207 |
| 355 | 3300046463 | Ga0495653_0012185 | Ga0495653_0012185_3110_3733 | 207 |
| 356 | 3300046463 | Ga0495653_0027945 | Ga0495653_0027945_668_1291 | 207 |
| 357 | 3300046463 | Ga0495653_0130007 | Ga0495653_0130007_200_823 | 207 |
| 358 | 3300046463 | Ga0495653_0484958 | Ga0495653_0484958_15_641 | 207 |
| 359 | 3300046471 | Ga0495650_0141370 | Ga0495650_0141370_176_799 | 207 |
| 360 | 3300046473 | Ga0495582_0077070 | Ga0495582_0077070_114_737 | 207 |
| 361 | 3300046475 | Ga0495639_0033767 | Ga0495639_0033767_82_705 | 207 |
| 362 | 3300046475 | Ga0495639_0096263 | Ga0495639_0096263_609_1232 | 207 |
| 363 | 3300046475 | Ga0495639_0190557 | Ga0495639_0190557_66_689 | 207 |
| 364 | 3300046476 | Ga0495662_0213297 | Ga0495662_0213297_16_639 | 207 |
| 365 | 3300046511 | Ga0495608_0018513 | Ga0495608_0018513_3904_4527 | 207 |
| 366 | 3300046511 | Ga0495608_0132895 | Ga0495608_0132895_288_911 | 207 |
| 367 | 3300046512 | Ga0495610_0243704 | Ga0495610_0243704_25_648 | 207 |
| 368 | 3300046514 | Ga0495618_0040236 | Ga0495618_0040236_2154_2777 | 207 |
| 369 | 3300046514 | Ga0495618_0230812 | Ga0495618_0230812_507_1130 | 207 |
| 370 | 3300046516 | Ga0495628_0008781 | Ga0495628_0008781_5677_6300 | 207 |
| 371 | 3300046516 | Ga0495628_0022522 | Ga0495628_0022522_4401_5024 | 207 |
| 372 | 3300046517 | Ga0495630_0151879 | Ga0495630_0151879_73_696 | 207 |
| 373 | 3300046517 | Ga0495630_0424864 | Ga0495630_0424864_292_915 | 207 |
| 374 | 3300046524 | Ga0495648_0035521 | Ga0495648_0035521_1886_2509 | 207 |
| 375 | 3300046526 | Ga0495666_0134608 | Ga0495666_0134608_273_896 | 207 |
| 376 | 3300046529 | Ga0495652_0011193 | Ga0495652_0011193_3478_4101 | 207 |
| 377 | 3300046529 | Ga0495652_0514716 | Ga0495652_0514716_154_780 | 207 |
| 378 | 3300046533 | Ga0495640_0006537 | Ga0495640_0006537_3753_4376 | 207 |
| 379 | 3300046533 | Ga0495640_0280046 | Ga0495640_0280046_233_856 | 207 |
| 380 | 3300046536 | Ga0495587_0016668 | Ga0495587_0016668_3331_3954 | 207 |
| 381 | 3300046536 | Ga0495587_0026726 | Ga0495587_0026726_1684_2307 | 207 |
| 382 | 3300046543 | Ga0495645_0049445 | Ga0495645_0049445_2275_2898 | 207 |
| 383 | 3300046543 | Ga0495645_0114473 | Ga0495645_0114473_982_1605 | 207 |
| 384 | 3300046543 | Ga0495645_0390357 | Ga0495645_0390357_92_718 | 207 |
| 385 | 3300046559 | Ga0495667_0005125 | Ga0495667_0005125_4897_5520 | 207 |
| 386 | 3300046559 | Ga0495667_0008101 | Ga0495667_0008101_6104_6727 | 207 |
| 387 | 3300046559 | Ga0495667_0019089 | Ga0495667_0019089_3090_3713 | 207 |
| 388 | 3300046642 | Ga0495634_0011437 | Ga0495634_0011437_1014_1637 | 207 |
| 389 | 3300046642 | Ga0495634_0030658 | Ga0495634_0030658_2200_2823 | 207 |
| 390 | 3300046663 | Ga0495635_0003139 | Ga0495635_0003139_9857_10480 | 207 |
| 391 | 3300046663 | Ga0495635_0022784 | Ga0495635_0022784_2792_3415 | 207 |
| 392 | 3300046675 | Ga0495657_0009754 | Ga0495657_0009754_552_1175 | 207 |
| 393 | 3300046675 | Ga0495657_0093493 | Ga0495657_0093493_1219_1842 | 207 |
| 394 | 3300046678 | Ga0495599_0005351 | Ga0495599_0005351_6030_6653 | 207 |
| 395 | 3300046678 | Ga0495599_0015612 | Ga0495599_0015612_352_975 | 207 |
| 396 | 3300046678 | Ga0495599_0020314 | Ga0495599_0020314_3424_4047 | 207 |
| 397 | 3300046679 | Ga0495623_0081457 | Ga0495623_0081457_341_964 | 207 |
| 398 | 3300046679 | Ga0495623_0098545 | Ga0495623_0098545_342_965 | 207 |
| 399 | 3300046680 | Ga0495646_0019568 | Ga0495646_0019568_205_828 | 207 |
| 400 | 3300046689 | Ga0495613_0086687 | Ga0495613_0086687_1501_2124 | 207 |
| 401 | 3300046689 | Ga0495613_0132420 | Ga0495613_0132420_664_1287 | 207 |
| 402 | 3300046809 | Ga0495600_0006764 | Ga0495600_0006764_3892_4515 | 207 |
| 403 | 3300046809 | Ga0495600_0013900 | Ga0495600_0013900_3284_3907 | 207 |
| 404 | 3300047315 | Ga0495581_0053479 | Ga0495581_0053479_248_871 | 207 |
| 405 | 3300047317 | Ga0495604_0053959 | Ga0495604_0053959_2223_2846 | 207 |
| 406 | 3300047317 | Ga0495604_0058569 | Ga0495604_0058569_2058_2681 | 207 |
| 407 | 3300047317 | Ga0495604_0104500 | Ga0495604_0104500_413_1036 | 207 |
| 408 | 3300047317 | Ga0495604_0284070 | Ga0495604_0284070_289_912 | 207 |
| 409 | 3300047319 | Ga0495674_0046885 | Ga0495674_0046885_1126_1749 | 207 |
| 410 | 3300047319 | Ga0495674_0052543 | Ga0495674_0052543_523_1146 | 207 |
| 411 | 3300047319 | Ga0495674_0073997 | Ga0495674_0073997_2198_2821 | 207 |
| 412 | 3300047322 | Ga0495680_0015403 | Ga0495680_0015403_3226_3849 | 207 |
| 413 | 3300047322 | Ga0495680_0026093 | Ga0495680_0026093_2143_2766 | 207 |
| 414 | 3300047444 | Ga0495675_0247476 | Ga0495675_0247476_53_676 | 207 |
| 415 | 3300047471 | Ga0495684_0003361 | Ga0495684_0003361_9340_9963 | 207 |
| 416 | 3300047471 | Ga0495684_0014558 | Ga0495684_0014558_2667_3290 | 207 |
| 417 | 3300047471 | Ga0495684_0068439 | Ga0495684_0068439_897_1520 | 207 |
| 418 | 3300047472 | Ga0495686_0021905 | Ga0495686_0021905_3273_3896 | 207 |
| 419 | 3300047673 | Ga0495593_0031420 | Ga0495593_0031420_243_866 | 207 |
| 420 | 3300048088 | Ga0495602_0034315 | Ga0495602_0034315_1900_2523 | 207 |
| 421 | 3300048088 | Ga0495602_0038535 | Ga0495602_0038535_95_718 | 207 |
| 422 | 3300048088 | Ga0495602_0605162 | Ga0495602_0605162_19_642 | 207 |
| 423 | 3300048903 | Ga0496100_0082597 | Ga0496100_0082597_891_1514 | 207 |
| 424 | 3300048904 | Ga0496101_0117817 | Ga0496101_0117817_724_1347 | 207 |
| 425 | 3300048905 | Ga0496102_0054164 | Ga0496102_0054164_1556_2179 | 207 |
| 426 | 3300048906 | Ga0496103_0027003 | Ga0496103_0027003_2136_2759 | 207 |
| 427 | 3300048907 | Ga0496104_0060487 | Ga0496104_0060487_57_680 | 207 |
| 428 | 3300048907 | Ga0496104_0111039 | Ga0496104_0111039_318_941 | 207 |
| 429 | 3300048907 | Ga0496104_0157345 | Ga0496104_0157345_513_1136 | 207 |
| 430 | 3300048908 | Ga0496105_0038018 | Ga0496105_0038018_831_1454 | 207 |
| 431 | 3300048908 | Ga0496105_0199663 | Ga0496105_0199663_816_1439 | 207 |
| 432 | 3300048909 | Ga0496106_0016874 | Ga0496106_0016874_3791_4414 | 207 |
| 433 | 3300048909 | Ga0496106_0018456 | Ga0496106_0018456_996_1619 | 207 |
| 434 | 3300048910 | Ga0496107_0002177 | Ga0496107_0002177_11590_12213 | 207 |
| 435 | 3300048910 | Ga0496107_0153969 | Ga0496107_0153969_938_1561 | 207 |
| 436 | 3300048911 | Ga0496108_0003416 | Ga0496108_0003416_8864_9487 | 207 |
| 437 | 3300048911 | Ga0496108_0023228 | Ga0496108_0023228_3212_3835 | 207 |
| 438 | 3300048911 | Ga0496108_0196758 | Ga0496108_0196758_675_1298 | 207 |
| 439 | 3300048912 | Ga0496109_0000230 | Ga0496109_0000230_16413_17036 | 207 |
| 440 | 3300048912 | Ga0496109_0017788 | Ga0496109_0017788_882_1505 | 207 |
| 441 | 3300048912 | Ga0496109_0586664 | Ga0496109_0586664_195_818 | 207 |
| 442 | 3300048913 | Ga0496110_0137148 | Ga0496110_0137148_798_1421 | 207 |
| 443 | 3300048913 | Ga0496110_0203385 | Ga0496110_0203385_334_957 | 207 |
| 444 | 3300048914 | Ga0496111_0023006 | Ga0496111_0023006_3411_4034 | 207 |
| 445 | 3300048914 | Ga0496111_0067534 | Ga0496111_0067534_1716_2339 | 207 |
| 446 | 3300048914 | Ga0496111_0119277 | Ga0496111_0119277_1067_1690 | 207 |
| 447 | 3300048915 | Ga0496112_0009599 | Ga0496112_0009599_6492_7115 | 207 |
| 448 | 3300048915 | Ga0496112_0025801 | Ga0496112_0025801_243_866 | 207 |
| 449 | 3300048915 | Ga0496112_0055204 | Ga0496112_0055204_777_1400 | 207 |
| 450 | 3300048916 | Ga0496113_0006600 | Ga0496113_0006600_4685_5308 | 207 |
| 451 | 3300048916 | Ga0496113_0066885 | Ga0496113_0066885_1715_2338 | 207 |
| 452 | 3300048917 | Ga0496114_0031540 | Ga0496114_0031540_2338_2961 | 207 |
| 453 | 3300048917 | Ga0496114_0073302 | Ga0496114_0073302_471_1094 | 207 |
| 454 | 3300048918 | Ga0496115_0005259 | Ga0496115_0005259_5010_5633 | 207 |
| 455 | 3300048918 | Ga0496115_0064029 | Ga0496115_0064029_1745_2368 | 207 |
| 456 | 3300048924 | Ga0496121_0002915 | Ga0496121_0002915_9590_10213 | 207 |
| 457 | 3300048929 | Ga0496126_0418186 | Ga0496126_0418186_384_1007 | 207 |
| 458 | 3300050492 | nmdc:mga0yw44_172735_c1 | nmdc:mga0yw44_172735_c1_703_1335 | 207 |
| 459 | 3300053077 | Ga0495601_0053666 | Ga0495601_0053666_204_827 | 207 |
| 460 | 3300053077 | Ga0495601_0479686 | Ga0495601_0479686_144_770 | 207 |
| 461 | 3300053077 | Ga0495601_0537644 | Ga0495601_0537644_36_659 | 207 |
| 462 | 3300053078 | Ga0495612_0008630 | Ga0495612_0008630_2828_3451 | 207 |
| 463 | 3300053084 | Ga0495595_0014358 | Ga0495595_0014358_2152_2775 | 207 |
| 464 | 3300053084 | Ga0495595_0017393 | Ga0495595_0017393_2166_2789 | 207 |
| 465 | 3300053084 | Ga0495595_0070165 | Ga0495595_0070165_837_1460 | 207 |
| 466 | 3300053085 | Ga0495619_0004748 | Ga0495619_0004748_2993_3616 | 207 |
| 467 | 3300053085 | Ga0495619_0037345 | Ga0495619_0037345_1677_2300 | 207 |
| 468 | 3300053085 | Ga0495619_0097270 | Ga0495619_0097270_897_1574 | 207 |
| 469 | 3300053085 | Ga0495619_0188315 | Ga0495619_0188315_477_1100 | 207 |
| 470 | 3300053085 | Ga0495619_0667252 | Ga0495619_0667252_40_663 | 207 |
| 471 | 3300053086 | Ga0500578_0094579 | Ga0500578_0094579_1132_1755 | 207 |
| 472 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_265744_266367 | 207 |
| 473 | 3300053091 | Ga0500647_0234730 | Ga0500647_0234730_35_658 | 207 |
| 474 | 3300053094 | Ga0500566_0084289 | Ga0500566_0084289_221_844 | 207 |
| 475 | 3300053095 | Ga0500640_039162 | Ga0500640_039162_696_1319 | 207 |
| 476 | 3300053097 | Ga0500648_146433 | Ga0500648_146433_124_747 | 207 |
| 477 | 3300053103 | Ga0500555_005779 | Ga0500555_005779_1571_2194 | 207 |
| 478 | 3300053104 | Ga0500556_0005933 | Ga0500556_0005933_2659_3282 | 207 |
| 479 | 3300053111 | Ga0500572_006678 | Ga0500572_006678_1015_1638 | 207 |
| 480 | 3300053119 | Ga0500595_007068 | Ga0500595_007068_2813_3436 | 207 |
| 481 | 3300053121 | Ga0500607_033384 | Ga0500607_033384_31_654 | 207 |
| 482 | 3300053122 | Ga0500608_031942 | Ga0500608_031942_479_1102 | 207 |
| 483 | 3300053123 | Ga0500614_025437 | Ga0500614_025437_181_804 | 207 |
| 484 | 3300053133 | Ga0500655_060615 | Ga0500655_060615_79_702 | 207 |
| 485 | 3300053136 | Ga0500559_0029270 | Ga0500559_0029270_157_780 | 207 |
| 486 | 3300053139 | Ga0500568_0024528 | Ga0500568_0024528_1870_2493 | 207 |
| 487 | 3300053146 | Ga0500588_0032160 | Ga0500588_0032160_708_1331 | 207 |
| 488 | 3300053154 | Ga0500619_001595 | Ga0500619_001595_1860_2483 | 207 |
| 489 | 3300053155 | Ga0500620_001777 | Ga0500620_001777_2186_2809 | 207 |
| 490 | 3300053157 | Ga0500624_002308 | Ga0500624_002308_842_1465 | 207 |
| 491 | 3300053163 | Ga0500639_092255 | Ga0500639_092255_764_1387 | 207 |
| 492 | 3300053177 | Ga0500636_0000701 | Ga0500636_0000701_6639_7262 | 207 |
| 493 | 3300053736 | Ga0500599_007270 | Ga0500599_007270_774_1397 | 207 |
| 494 | 3300053737 | Ga0500601_000311 | Ga0500601_000311_8456_9079 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1p4t-assembly1.cif.gz_A | crystal structure of neisserial surface protein a (nspa) | 0.753 | 45 | 207 |
| 1p4t-assembly1.cif.gz_A | crystal structure of neisserial surface protein a (nspa) | 0.7363 | 45 | 207 |
| 1bxw-assembly1.cif.gz_A | outer membrane protein a (ompa) transmembrane domain | 0.7094 | 45 | 207 |
| 1qj8-assembly1.cif.gz_A | crystal structure of the outer membrane protein ompx from escherichia coli | 0.6946 | 48 | 207 |
| 1qj8-assembly1.cif.gz_A | crystal structure of the outer membrane protein ompx from escherichia coli | 0.6869 | 48 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1p4tA00 | Mainly Beta;Beta Barrel;Porin; | 0.753 | 45 | 207 | 2.40.160.20 |
| 1p4tA00 | Mainly Beta;Beta Barrel;Porin; | 0.7363 | 45 | 207 | 2.40.160.20 |
| 3qrcB00 | Mainly Beta;Beta Barrel;Porin; | 0.6418 | 46 | 207 | 2.40.160.20 |
| 4rlcA00 | Mainly Beta;Beta Barrel;Porin; | 0.6401 | 50 | 205 | 2.40.160.20 |
| 3qrcB00 | Mainly Beta;Beta Barrel;Porin; | 0.6351 | 46 | 207 | 2.40.160.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U3E5R6-F1-model_v4 | deleted | 0.876 | 27 | 207 |
|
| AF-A0A833LGP2-F1-model_v4 | Porin family protein | 0.8706 | 24 | 207 |
GO:0009279
|
| AF-Q45321-F1-model_v4 | 25 kDa outer-membrane immunogenic protein | 0.8699 | 25 | 207 |
GO:0009279
GO:0044384 |
| AF-A0A8A8ZLG3-F1-model_v4 | deleted | 0.8614 | 24 | 207 |
|
| AF-A0A258KAR2-F1-model_v4 | Outer membrane protein beta-barrel domain-containing protein | 0.8607 | 28 | 207 |
GO:0009279
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar