F454555

General Info

Members Datasets Scaffolds Average Seq Length
494 285 458 207

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10136402|Ga0099794_101364021
Length 207
Sequence MSKIAFAAVALTAAGFTVSAQAADLYGSRAPYTVNQPLYNAYSWAGPYLGGNIGYAWGSVENNPVNPSGVVGGVQAGYNWQTGPWVFGLEGDLQATGADDTFAPWKFSNPWFGTVRGRAGYAFNNLLVYGTGGLAFGELRGETFGLSESHTNAGWTAGVGAEFGFAQNWSAKVEYLYVDLSSDNFTITGVPNGYHFGVLRAGINYHF

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
3 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
4 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
5 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
6 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
7 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
8 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
9 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
10 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
11 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
12 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
13 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
14 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
15 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
16 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
17 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
18 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
19 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
20 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
21 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
22 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
23 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
24 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
25 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
26 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
27 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
28 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
29 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
30 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
31 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
32 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
33 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
34 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
35 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
255 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
257 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
258 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
259 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
260 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
261 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
262 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
276 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
283 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
284 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
285 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.51
Metatranscriptomes 0.2
Isolates 7.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.92
Nodule 2.63
Rhizoplane 8.7
Rhizosphere 71.46
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000043 3300003203 Bacteria 55866
2 JGI25404J52841_10006527 3300003659 Bacteria 2447
3 JGI25404J52841_10084347 3300003659 Bacteria 664
4 Ga0055543_1017285 3300004625 Bacteria 1359
5 Ga0065165_1005519 3300005262 Bacteria 7067
6 Ga0065715_10360587 3300005293 Bacteria 936
7 Ga0070658_10140542 3300005327 Bacteria 2017
8 Ga0070658_10329989 3300005327 Bacteria 1303
9 Ga0070680_100015508 3300005336 Bacteria 5976
10 Ga0070660_100002476 3300005339 Bacteria 12662
11 Ga0070661_100123382 3300005344 Bacteria 1942
12 Ga0070674_100107727 3300005356 Bacteria 2041
13 Ga0070674_100139838 3300005356 Bacteria 1816
14 Ga0070673_100745570 3300005364 Bacteria 901
15 Ga0070659_100071210 3300005366 Bacteria 2764
16 Ga0070709_10064886 3300005434 Bacteria 2336
17 Ga0070714_100563062 3300005435 Bacteria 1092
18 Ga0070713_100016921 3300005436 Bacteria 5496
19 Ga0070713_100298475 3300005436 Bacteria 1483
20 Ga0070711_100398237 3300005439 Bacteria 1117
21 Ga0070663_100334322 3300005455 Bacteria 1222
22 Ga0070663_100369100 3300005455 Bacteria 1166
23 Ga0070678_100047779 3300005456 Bacteria 3078
24 Ga0070681_10020543 3300005458 Bacteria 6618
25 Ga0070681_10096136 3300005458 Bacteria 2910
26 Ga0070681_10122770 3300005458 Bacteria 2530
27 Ga0068867_100209218 3300005459 Bacteria 1566
28 Ga0070698_101234308 3300005471 Bacteria 697
29 Ga0070679_100144908 3300005530 Bacteria 2353
30 Ga0070679_100813663 3300005530 Bacteria 877
31 Ga0070684_100019396 3300005535 Bacteria 5625
32 Ga0070684_100069141 3300005535 Bacteria 3105
33 Ga0068853_100001656 3300005539 Bacteria 16306
34 Ga0070686_100138487 3300005544 Bacteria 1691
35 Ga0070665_100243818 3300005548 Bacteria 1797
36 Ga0068855_100054227 3300005563 Bacteria 4712
37 Ga0068855_100562686 3300005563 Bacteria 1233
38 Ga0070664_100459958 3300005564 Bacteria 1169
39 Ga0068857_100130475 3300005577 Bacteria 2267
40 Ga0068857_100364785 3300005577 Bacteria 1339
41 Ga0068852_100082890 3300005616 Bacteria 2851
42 Ga0068852_100489574 3300005616 Bacteria 1223
43 Ga0068864_100016090 3300005618 Bacteria 6225
44 Ga0068861_100440514 3300005719 Bacteria 1165
45 Ga0068851_10023151 3300005834 Bacteria 3033
46 Ga0068863_100435837 3300005841 Bacteria 1285
47 Ga0068863_100437519 3300005841 Bacteria 1282
48 Ga0081540_1035294 3300005983 Bacteria 2684
49 Ga0081540_1089171 3300005983 Bacteria 1362
50 Ga0081539_10000324 3300005985 Bacteria 106549
51 Ga0081539_10001968 3300005985 Bacteria 31287
52 Ga0075365_10209539 3300006038 Bacteria 1366
53 Ga0075364_10088895 3300006051 Bacteria 2048
54 Ga0075370_10033413 3300006353 Bacteria 2881
55 Ga0099794_10132452 3300007265 Bacteria 1259
56 Ga0099794_10136402 3300007265 Bacteria 1241
57 Ga0099794_10199537 3300007265 Bacteria 1024
58 Ga0099795_10008203 3300007788 Bacteria 2965
59 Ga0099795_10250670 3300007788 Bacteria 763
60 Ga0105240_10007694 3300009093 Bacteria 15591
61 Ga0105240_10444411 3300009093 Bacteria 1452
62 Ga0105247_10052284 3300009101 Bacteria 2518
63 Ga0105242_10278216 3300009176 Bacteria 1519
64 Ga0105248_10439938 3300009177 Bacteria 1469
65 Ga0105237_10015525 3300009545 Bacteria 7923
66 Ga0105237_10258969 3300009545 Bacteria 1742
67 Ga0105237_10297361 3300009545 Bacteria 1617
68 Ga0105237_10559011 3300009545 Bacteria 1151
69 Ga0105238_10029507 3300009551 Bacteria 5587
70 Ga0105238_10297957 3300009551 Bacteria 1596
71 Ga0099796_10068340 3300010159 Bacteria 1276
72 Ga0105239_10029597 3300010375 Bacteria 6021
73 Ga0105239_10047895 3300010375 Bacteria 4685
74 Ga0105239_10124139 3300010375 Bacteria 2869
75 Ga0157369_10019439 3300013105 Bacteria 7599
76 Ga0157369_10043264 3300013105 Bacteria 4910
77 Ga0157374_10428494 3300013296 Bacteria 1322
78 Ga0157378_11096631 3300013297 Bacteria 833
79 Ga0163162_10369271 3300013306 Bacteria 1568
80 Ga0157372_11351747 3300013307 Bacteria 822
81 Ga0157375_10352162 3300013308 Bacteria 1638
82 Ga0163163_10218870 3300014325 Bacteria 1953
83 Ga0163163_10785806 3300014325 Bacteria 1015
84 Ga0157379_10398932 3300014968 Bacteria 1264
85 Ga0157376_10114806 3300014969 Bacteria 2376
86 Ga0197907_10398635 3300020069 Bacteria 1234
87 Ga0213875_10077451 3300021388 Bacteria 1552
88 Ga0209563_103012 3300025230 Bacteria 3612
89 Ga0209677_104064 3300025253 Bacteria 4398
90 Ga0209673_1022322 3300025273 Bacteria 2187
91 Ga0209758_1005318 3300025297 Bacteria 10036
92 Ga0207426_1005781 3300025302 Bacteria 5551
93 Ga0207426_1007382 3300025302 Bacteria 4611
94 Ga0207426_1013780 3300025302 Bacteria 2983
95 Ga0209257_1054008 3300025304 Bacteria 1120
96 Ga0207692_10200510 3300025898 Bacteria 1173
97 Ga0207710_10032876 3300025900 Bacteria 2273
98 Ga0207699_10064392 3300025906 Bacteria 2218
99 Ga0207705_10089755 3300025909 Bacteria 2249
100 Ga0207705_10322001 3300025909 Bacteria 1188
101 Ga0207707_10003102 3300025912 Bacteria 14744
102 Ga0207707_10024022 3300025912 Bacteria 5330
103 Ga0207707_10311839 3300025912 Bacteria 1359
104 Ga0207695_10063410 3300025913 Bacteria 3811
105 Ga0207695_10126612 3300025913 Bacteria 2516
106 Ga0207671_10084122 3300025914 Bacteria 2389
107 Ga0207671_10213861 3300025914 Bacteria 1509
108 Ga0207693_10117582 3300025915 Bacteria 2087
109 Ga0207663_10051060 3300025916 Bacteria 2573
110 Ga0207663_10112086 3300025916 Bacteria 1852
111 Ga0207660_10003607 3300025917 Bacteria 10083
112 Ga0207657_10015320 3300025919 Bacteria 7432
113 Ga0207649_10039938 3300025920 Bacteria 2848
114 Ga0207652_10052496 3300025921 Bacteria 3499
115 Ga0207652_10088917 3300025921 Bacteria 2711
116 Ga0207652_10597403 3300025921 Bacteria 990
117 Ga0207646_10345011 3300025922 Bacteria 1345
118 Ga0207694_10007559 3300025924 Bacteria 8238
119 Ga0207650_10683007 3300025925 Bacteria 867
120 Ga0207659_10222364 3300025926 Bacteria 1519
121 Ga0207687_10109720 3300025927 Bacteria 2045
122 Ga0207700_10024184 3300025928 Bacteria 4200
123 Ga0207664_10033040 3300025929 Bacteria 3972
124 Ga0207664_10118054 3300025929 Bacteria 2216
125 Ga0207706_10258587 3300025933 Bacteria 1520
126 Ga0207669_10100216 3300025937 Bacteria 1913
127 Ga0207661_10000597 3300025944 Bacteria 23061
128 Ga0207661_10470027 3300025944 Bacteria 1147
129 Ga0207667_10001989 3300025949 Bacteria 25637
130 Ga0207667_10640702 3300025949 Bacteria 1069
131 Ga0207651_11038356 3300025960 Bacteria 733
132 Ga0207639_10004121 3300026041 Bacteria 9799
133 Ga0207678_10096823 3300026067 Bacteria 2522
134 Ga0207678_10172161 3300026067 Bacteria 1849
135 Ga0207678_10259588 3300026067 Bacteria 1489
136 Ga0207702_10477579 3300026078 Bacteria 1213
137 Ga0207641_10350473 3300026088 Bacteria 1407
138 Ga0207648_10124448 3300026089 Bacteria 2268
139 Ga0207676_10035908 3300026095 Bacteria 3767
140 Ga0207674_10145484 3300026116 Bacteria 2328
141 Ga0207683_10076908 3300026121 Bacteria 2955
142 Ga0207683_10096708 3300026121 Bacteria 2633
143 Ga0207683_10207698 3300026121 Bacteria 1781
144 Ga0207698_10253026 3300026142 Bacteria 1613
145 Ga0268266_10137558 3300028379 Bacteria 2189
146 Ga0265334_10037283 3300028573 Bacteria 1917
147 Ga0265330_10010904 3300031235 Bacteria 4271
148 Ga0265330_10059220 3300031235 Bacteria 1668
149 Ga0265332_10050591 3300031238 Bacteria 1786
150 Ga0265328_10092146 3300031239 Bacteria 1120
151 Ga0265313_10047266 3300031595 Bacteria 2084
152 Ga0307510_10006233 3300033180 Bacteria 14224
153 Ga0373930_0081805 3300034816 Bacteria 747
154 Ga0373926_0026762 3300035083 Bacteria 2019
155 Ga0373928_0005159 3300035084 Bacteria 2493
156 Ga0373934_0000917 3300035086 Bacteria 10657
157 Ga0373934_0043566 3300035086 Bacteria 1773
158 Ga0373923_0004430 3300035111 Bacteria 4657
159 Ga0373923_0009785 3300035111 Bacteria 3467
160 Ga0373936_0019613 3300035113 Bacteria 2621
161 Ga0373936_0021993 3300035113 Bacteria 2483
162 Ga0373939_0104584 3300035114 Bacteria 977
163 Ga0373941_0033118 3300035115 Bacteria 1551
164 Ga0373945_0040597 3300035116 Bacteria 1680
165 Ga0373945_0276478 3300035116 Bacteria 715
166 Ga0373953_0007777 3300035117 Bacteria 3609
167 Ga0373953_0133001 3300035117 Bacteria 1061
168 Ga0373954_0007560 3300035118 Bacteria 4756
169 Ga0373954_0077586 3300035118 Bacteria 1584
170 Ga0373956_0002486 3300035119 Bacteria 7500
171 Ga0373956_0012134 3300035119 Bacteria 3565
172 Ga0373957_0005552 3300035120 Bacteria 3913
173 Ga0373957_0010606 3300035120 Bacteria 3051
174 Ga0373943_0001395 3300035170 Bacteria 10885
175 Ga0373943_0085384 3300035170 Bacteria 1625
176 Ga0373943_0244985 3300035170 Bacteria 1005
177 Ga0373946_0417340 3300035171 Bacteria 679
178 Ga0373955_0030392 3300035172 Bacteria 2819
179 Ga0373955_0033119 3300035172 Bacteria 2719
180 Ga0373962_0068829 3300035242 Bacteria 1054
181 Ga0373924_0007709 3300035410 Bacteria 3890
182 Ga0373924_0038958 3300035410 Bacteria 1940
183 Ga0373924_0039737 3300035410 Bacteria 1923
184 Ga0373931_0003292 3300035691 Bacteria 7230
185 Ga0373931_0178503 3300035691 Bacteria 1256
186 Ga0373935_0001273 3300035692 Bacteria 13895
187 Ga0373935_0052160 3300035692 Bacteria 2599
188 Ga0373935_0094930 3300035692 Bacteria 1958
189 Ga0373927_0000792 3300035695 Bacteria 24123
190 Ga0373927_0005966 3300035695 Bacteria 8343
191 Ga0373927_0064177 3300035695 Bacteria 2375
192 Ga0373927_0429348 3300035695 Bacteria 872
193 Ga0373933_0000964 3300035724 Bacteria 17534
194 Ga0373933_0004963 3300035724 Bacteria 7255
195 Ga0373947_0002479 3300035725 Bacteria 11100
196 Ga0373947_0014814 3300035725 Bacteria 4474
197 Ga0373947_0066856 3300035725 Bacteria 2194
198 Ga0373937_0100605 3300036401 Bacteria 2682
199 Ga0373937_0202213 3300036401 Bacteria 1867
200 Ga0373937_0280338 3300036401 Bacteria 1574
201 Ga0373925_0007136 3300037068 Bacteria 8166
202 Ga0373925_0082976 3300037068 Bacteria 2440
203 Ga0373925_0113735 3300037068 Bacteria 2093
204 Ga0373925_0248345 3300037068 Bacteria 1427
205 Ga0373925_0474061 3300037068 Bacteria 1026
206 Ga0373925_0557096 3300037068 Bacteria 943
207 Ga0395900_0012938 3300037418 Bacteria 8524
208 Ga0395898_0071507 3300037466 Bacteria 3352
209 Ga0395898_0644608 3300037466 Bacteria 1002
210 Ga0436364_0994846 3300037853 Bacteria 2431
211 Ga0436364_0997941 3300037853 Bacteria 2124
212 Ga0395901_0061423 3300038443 Bacteria 3910
213 Ga0436365_1077088 3300039437 Bacteria 3217
214 Ga0436365_1444382 3300039437 Bacteria 1952
215 Ga0436365_1505691 3300039437 Bacteria 1245
216 Ga0451851_0123442 3300041507 Bacteria 995
217 Ga0466972_0034670 3300044658 Bacteria 2471
218 Ga0466965_0289232 3300044683 Bacteria 887
219 Ga0466968_0065287 3300044735 Bacteria 1575
220 Ga0466960_0029330 3300044901 Bacteria 2524
221 Ga0495592_0002895 3300046454 Bacteria 12206
222 Ga0495592_0023469 3300046454 Bacteria 4691
223 Ga0495592_0058249 3300046454 Bacteria 2850
224 Ga0495592_0066701 3300046454 Bacteria 2633
225 Ga0495592_0068034 3300046454 Bacteria 2601
226 Ga0495603_0003882 3300046455 Bacteria 8902
227 Ga0495629_0000236 3300046459 Bacteria 48386
228 Ga0495629_0011071 3300046459 Bacteria 6553
229 Ga0495629_0021237 3300046459 Bacteria 4634
230 Ga0495638_0040101 3300046460 Bacteria 2968
231 Ga0495641_0003725 3300046461 Bacteria 11224
232 Ga0495651_0015634 3300046462 Bacteria 5875
233 Ga0495651_0020175 3300046462 Bacteria 5173
234 Ga0495651_0108523 3300046462 Bacteria 2055
235 Ga0495653_0012185 3300046463 Bacteria 7015
236 Ga0495653_0027945 3300046463 Bacteria 4515
237 Ga0495653_0130007 3300046463 Bacteria 1784
238 Ga0495653_0484958 3300046463 Bacteria 773
239 Ga0495650_0141370 3300046471 Bacteria 871
240 Ga0495580_0019020 3300046472 Bacteria 5107
241 Ga0495580_0102441 3300046472 Bacteria 1990
242 Ga0495582_0000084 3300046473 Bacteria 47752
243 Ga0495582_0077070 3300046473 Bacteria 1849
244 Ga0495639_0001155 3300046475 Bacteria 11924
245 Ga0495639_0033767 3300046475 Bacteria 2286
246 Ga0495639_0085844 3300046475 Bacteria 1471
247 Ga0495639_0096263 3300046475 Bacteria 1394
248 Ga0495639_0190557 3300046475 Bacteria 1001
249 Ga0495662_0000454 3300046476 Bacteria 18465
250 Ga0495662_0213297 3300046476 Bacteria 952
251 Ga0495664_0003578 3300046477 Bacteria 8467
252 Ga0495664_0031081 3300046477 Bacteria 3129
253 Ga0495594_0001840 3300046499 Bacteria 11034
254 Ga0495606_0017760 3300046507 Bacteria 5363
255 Ga0495608_0018513 3300046511 Bacteria 4803
256 Ga0495608_0132895 3300046511 Bacteria 1591
257 Ga0495608_0191726 3300046511 Bacteria 1290
258 Ga0495610_0243704 3300046512 Bacteria 715
259 Ga0495618_0020851 3300046514 Bacteria 4034
260 Ga0495618_0040236 3300046514 Bacteria 2941
261 Ga0495618_0230812 3300046514 Bacteria 1165
262 Ga0495628_0008781 3300046516 Bacteria 8648
263 Ga0495628_0022522 3300046516 Bacteria 5176
264 Ga0495628_0065003 3300046516 Bacteria 2855
265 Ga0495628_0080234 3300046516 Bacteria 2537
266 Ga0495630_0002622 3300046517 Bacteria 12449
267 Ga0495630_0087384 3300046517 Bacteria 2354
268 Ga0495630_0151879 3300046517 Bacteria 1762
269 Ga0495630_0424864 3300046517 Bacteria 1018
270 Ga0495648_0035521 3300046524 Bacteria 3230
271 Ga0495666_0020271 3300046526 Bacteria 3296
272 Ga0495666_0036901 3300046526 Bacteria 2379
273 Ga0495666_0134608 3300046526 Bacteria 1154
274 Ga0495652_0011193 3300046529 Bacteria 8124
275 Ga0495652_0084605 3300046529 Bacteria 2608
276 Ga0495652_0138489 3300046529 Bacteria 1917
277 Ga0495652_0514716 3300046529 Bacteria 828
278 Ga0495665_0001312 3300046531 Bacteria 13267
279 Ga0495665_0016204 3300046531 Bacteria 4016
280 Ga0495640_0006537 3300046533 Bacteria 9213
281 Ga0495640_0011192 3300046533 Bacteria 6907
282 Ga0495640_0032353 3300046533 Bacteria 3726
283 Ga0495640_0280046 3300046533 Bacteria 1039
284 Ga0495587_0016668 3300046536 Bacteria 4570
285 Ga0495587_0026726 3300046536 Bacteria 3516
286 Ga0495587_0123417 3300046536 Bacteria 1483
287 Ga0495587_0189042 3300046536 Bacteria 1166
288 Ga0495645_0049445 3300046543 Bacteria 3062
289 Ga0495645_0098842 3300046543 Bacteria 2077
290 Ga0495645_0114473 3300046543 Bacteria 1906
291 Ga0495645_0390357 3300046543 Bacteria 889
292 Ga0495622_0003118 3300046557 Bacteria 7857
293 Ga0495667_0005125 3300046559 Bacteria 8853
294 Ga0495667_0008101 3300046559 Bacteria 7131
295 Ga0495667_0019089 3300046559 Bacteria 4627
296 Ga0495667_0069957 3300046559 Bacteria 2290
297 Ga0495667_0240177 3300046559 Bacteria 1154
298 Ga0495634_0000321 3300046642 Bacteria 46387
299 Ga0495634_0011437 3300046642 Bacteria 6464
300 Ga0495634_0030658 3300046642 Bacteria 3712
301 Ga0495634_0056445 3300046642 Bacteria 2623
302 Ga0495635_0003139 3300046663 Bacteria 11370
303 Ga0495635_0022784 3300046663 Bacteria 4366
304 Ga0495635_0026028 3300046663 Bacteria 4074
305 Ga0495635_0030431 3300046663 Bacteria 3751
306 Ga0495657_0009754 3300046675 Bacteria 7249
307 Ga0495657_0093493 3300046675 Bacteria 1924
308 Ga0495599_0005351 3300046678 Bacteria 7661
309 Ga0495599_0015612 3300046678 Bacteria 4715
310 Ga0495599_0020314 3300046678 Bacteria 4136
311 Ga0495599_0061754 3300046678 Bacteria 2341
312 Ga0495623_0053900 3300046679 Bacteria 2539
313 Ga0495623_0081457 3300046679 Bacteria 2001
314 Ga0495623_0086541 3300046679 Bacteria 1931
315 Ga0495623_0098545 3300046679 Bacteria 1784
316 Ga0495646_0019568 3300046680 Bacteria 4283
317 Ga0495646_0029579 3300046680 Bacteria 3424
318 Ga0495647_0003687 3300046681 Bacteria 4918
319 Ga0495647_0045848 3300046681 Bacteria 1681
320 Ga0495658_0002077 3300046683 Bacteria 10151
321 Ga0495658_0038010 3300046683 Bacteria 2663
322 Ga0495613_0015877 3300046689 Bacteria 5607
323 Ga0495613_0086687 3300046689 Bacteria 2270
324 Ga0495613_0132420 3300046689 Bacteria 1785
325 Ga0495624_0001596 3300046690 Bacteria 17405
326 Ga0495600_0006764 3300046809 Bacteria 6991
327 Ga0495600_0013900 3300046809 Bacteria 5071
328 Ga0495600_0056308 3300046809 Bacteria 2569
329 Ga0495581_0000174 3300047315 Bacteria 29174
330 Ga0495581_0021346 3300047315 Bacteria 3754
331 Ga0495581_0053479 3300047315 Bacteria 2332
332 Ga0495604_0053959 3300047317 Bacteria 3103
333 Ga0495604_0058569 3300047317 Bacteria 2957
334 Ga0495604_0104500 3300047317 Bacteria 2075
335 Ga0495604_0131064 3300047317 Bacteria 1802
336 Ga0495604_0173616 3300047317 Bacteria 1513
337 Ga0495604_0284070 3300047317 Bacteria 1117
338 Ga0495674_0010664 3300047319 Bacteria 8696
339 Ga0495674_0012229 3300047319 Bacteria 8088
340 Ga0495674_0046885 3300047319 Bacteria 3834
341 Ga0495674_0052543 3300047319 Bacteria 3585
342 Ga0495674_0073997 3300047319 Bacteria 2935
343 Ga0495676_0052222 3300047321 Bacteria 3264
344 Ga0495680_0015403 3300047322 Bacteria 6598
345 Ga0495680_0026093 3300047322 Bacteria 4823
346 Ga0495675_0247476 3300047444 Bacteria 1071
347 Ga0495673_0014385 3300047469 Bacteria 4117
348 Ga0495684_0003361 3300047471 Bacteria 12567
349 Ga0495684_0007348 3300047471 Bacteria 8539
350 Ga0495684_0014558 3300047471 Bacteria 6053
351 Ga0495684_0068439 3300047471 Bacteria 2700
352 Ga0495684_0150183 3300047471 Bacteria 1742
353 Ga0495686_0021905 3300047472 Bacteria 4234
354 Ga0495686_0026657 3300047472 Bacteria 3781
355 Ga0495593_0000321 3300047673 Bacteria 26527
356 Ga0495593_0031420 3300047673 Bacteria 2900
357 Ga0495593_0069526 3300047673 Bacteria 1830
358 Ga0495602_0034315 3300048088 Bacteria 4748
359 Ga0495602_0038535 3300048088 Bacteria 4417
360 Ga0495602_0605162 3300048088 Bacteria 753
361 Ga0495602_0643521 3300048088 Bacteria 725
362 Ga0496100_0082597 3300048903 Bacteria 2173
363 Ga0496101_0117817 3300048904 Bacteria 2005
364 Ga0496102_0026708 3300048905 Bacteria 5153
365 Ga0496102_0054164 3300048905 Bacteria 3657
366 Ga0496103_0027003 3300048906 Bacteria 3476
367 Ga0496104_0021948 3300048907 Bacteria 5864
368 Ga0496104_0060487 3300048907 Bacteria 3588
369 Ga0496104_0111039 3300048907 Bacteria 2628
370 Ga0496104_0157345 3300048907 Bacteria 2180
371 Ga0496105_0013476 3300048908 Bacteria 6491
372 Ga0496105_0038018 3300048908 Bacteria 3965
373 Ga0496105_0199663 3300048908 Bacteria 1632
374 Ga0496106_0016874 3300048909 Bacteria 5403
375 Ga0496106_0018456 3300048909 Bacteria 5158
376 Ga0496106_0095898 3300048909 Bacteria 2295
377 Ga0496107_0002177 3300048910 Bacteria 12590
378 Ga0496107_0018133 3300048910 Bacteria 4953
379 Ga0496107_0153969 3300048910 Bacteria 1701
380 Ga0496108_0003416 3300048911 Bacteria 12751
381 Ga0496108_0023228 3300048911 Bacteria 5101
382 Ga0496108_0196758 3300048911 Bacteria 1748
383 Ga0496109_0000230 3300048912 Bacteria 54618
384 Ga0496109_0017788 3300048912 Bacteria 6234
385 Ga0496109_0586664 3300048912 Bacteria 1050
386 Ga0496110_0016246 3300048913 Bacteria 6211
387 Ga0496110_0137148 3300048913 Bacteria 2211
388 Ga0496110_0203385 3300048913 Bacteria 1799
389 Ga0496110_0747600 3300048913 Bacteria 881
390 Ga0496111_0023006 3300048914 Bacteria 4370
391 Ga0496111_0067534 3300048914 Bacteria 2597
392 Ga0496111_0119277 3300048914 Bacteria 1948
393 Ga0496112_0009599 3300048915 Bacteria 8727
394 Ga0496112_0025801 3300048915 Bacteria 5645
395 Ga0496112_0053526 3300048915 Bacteria 3964
396 Ga0496112_0055204 3300048915 Bacteria 3905
397 Ga0496112_0745281 3300048915 Bacteria 906
398 Ga0496113_0006600 3300048916 Bacteria 7376
399 Ga0496113_0066885 3300048916 Bacteria 2723
400 Ga0496113_0072032 3300048916 Bacteria 2629
401 Ga0496114_0031540 3300048917 Bacteria 4361
402 Ga0496114_0073302 3300048917 Bacteria 2881
403 Ga0496115_0005259 3300048918 Bacteria 9407
404 Ga0496115_0064029 3300048918 Bacteria 2967
405 Ga0496119_0076280 3300048922 Bacteria 1945
406 Ga0496121_0002915 3300048924 Bacteria 25094
407 Ga0496121_0100455 3300048924 Bacteria 2233
408 Ga0496126_0418186 3300048929 Bacteria 1084
409 Ga0496126_0674358 3300048929 Bacteria 806
410 nmdc:mga0yw44_172735_c1 3300050492 Bacteria 1420
411 Ga0495601_0053666 3300053077 Bacteria 2548
412 Ga0495601_0479686 3300053077 Bacteria 803
413 Ga0495601_0537644 3300053077 Bacteria 753
414 Ga0495612_0005522 3300053078 Bacteria 5227
415 Ga0495612_0008630 3300053078 Bacteria 4131
416 Ga0495595_0014358 3300053084 Bacteria 3359
417 Ga0495595_0017393 3300053084 Bacteria 3093
418 Ga0495595_0070165 3300053084 Bacteria 1655
419 Ga0495619_0004748 3300053085 Bacteria 8643
420 Ga0495619_0037345 3300053085 Bacteria 3164
421 Ga0495619_0097270 3300053085 Bacteria 2000
422 Ga0495619_0188315 3300053085 Bacteria 1428
423 Ga0495619_0667252 3300053085 Bacteria 708
424 Ga0500578_0094579 3300053086 Bacteria 1896
425 Ga0500578_0201428 3300053086 Bacteria 1218
426 Ga0500578_0202470 3300053086 Bacteria 1214
427 Ga0500643_000013 3300053087 Bacteria 324296
428 Ga0500647_0234730 3300053091 Bacteria 814
429 Ga0500651_0013550 3300053093 Bacteria 4969
430 Ga0500566_0084289 3300053094 Bacteria 1764
431 Ga0500640_039162 3300053095 Bacteria 2082
432 Ga0500648_146433 3300053097 Bacteria 1262
433 Ga0500650_0283029 3300053098 Bacteria 737
434 Ga0500555_005779 3300053103 Bacteria 3511
435 Ga0500556_0005933 3300053104 Bacteria 3459
436 Ga0500569_027396 3300053109 Bacteria 1570
437 Ga0500572_006678 3300053111 Bacteria 2648
438 Ga0500594_0004879 3300053118 Bacteria 2966
439 Ga0500595_002456 3300053119 Bacteria 9189
440 Ga0500595_007068 3300053119 Bacteria 4694
441 Ga0500607_033384 3300053121 Bacteria 2819
442 Ga0500608_031942 3300053122 Bacteria 2500
443 Ga0500614_025437 3300053123 Bacteria 1407
444 Ga0500642_0012128 3300053130 Bacteria 3113
445 Ga0500655_060615 3300053133 Bacteria 762
446 Ga0500559_0029270 3300053136 Bacteria 2357
447 Ga0500568_0024528 3300053139 Bacteria 2553
448 Ga0500588_0032160 3300053146 Bacteria 1520
449 Ga0500616_0075077 3300053153 Bacteria 1712
450 Ga0500619_001595 3300053154 Bacteria 4071
451 Ga0500620_001777 3300053155 Bacteria 4110
452 Ga0500622_0153432 3300053156 Bacteria 1086
453 Ga0500624_002308 3300053157 Bacteria 2611
454 Ga0500627_0176241 3300053158 Bacteria 962
455 Ga0500639_092255 3300053163 Bacteria 1506
456 Ga0500636_0000701 3300053177 Bacteria 17989
457 Ga0500599_007270 3300053736 Bacteria 1422
458 Ga0500601_000311 3300053737 Bacteria 9117

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10297361 Ga0105237_102973611 197
2 3300013105 Ga0157369_10043264 Ga0157369_100432644 197
3 3300003659 JGI25404J52841_10006527 JGI25404J52841_100065272 198
4 3300005983 Ga0081540_1035294 Ga0081540_10352943 198
5 3300039437 Ga0436365_1505691 Ga0436365_1505691_558_1166 199
6 3300048929 Ga0496126_0674358 Ga0496126_0674358_12_707 199
7 3300035116 Ga0373945_0276478 Ga0373945_0276478_95_697 200
8 3300035171 Ga0373946_0417340 Ga0373946_0417340_53_655 200
9 3300005458 Ga0070681_10020543 Ga0070681_100205435 201
10 3300005563 Ga0068855_100562686 Ga0068855_1005626861 201
11 3300005616 Ga0068852_100489574 Ga0068852_1004895741 201
12 3300009545 Ga0105237_10559011 Ga0105237_105590112 201
13 3300025912 Ga0207707_10024022 Ga0207707_100240223 201
14 3300025921 Ga0207652_10597403 Ga0207652_105974031 201
15 3300025949 Ga0207667_10640702 Ga0207667_106407021 201
16 3300044683 Ga0466965_0289232 Ga0466965_0289232_199_804 201
17 3300037068 Ga0373925_0557096 Ga0373925_0557096_61_669 202
18 3300046679 Ga0495623_0086541 Ga0495623_0086541_1309_1917 202
19 3300053153 Ga0500616_0075077 Ga0500616_0075077_1091_1699 202
20 iso_pu_bacteria 2824600985 2824607170 202
21 iso_pu_bacteria 2824609381 2824615130 202
22 iso_pu_bacteria 2824653114 2824659901 202
23 iso_pu_bacteria 2885409591 2885412428 202
24 iso_pu_bacteria 2888419890 2888426682 202
25 3300003659 JGI25404J52841_10084347 JGI25404J52841_100843471 203
26 3300005983 Ga0081540_1089171 Ga0081540_10891711 203
27 3300007265 Ga0099794_10199537 Ga0099794_101995371 203
28 3300025916 Ga0207663_10112086 Ga0207663_101120863 203
29 3300036401 Ga0373937_0202213 Ga0373937_0202213_282_893 203
30 3300044658 Ga0466972_0034670 Ga0466972_0034670_714_1325 203
31 3300044735 Ga0466968_0065287 Ga0466968_0065287_922_1533 203
32 3300044901 Ga0466960_0029330 Ga0466960_0029330_24_635 203
33 3300046526 Ga0495666_0036901 Ga0495666_0036901_500_1111 203
34 3300046543 Ga0495645_0098842 Ga0495645_0098842_1069_1680 203
35 3300046559 Ga0495667_0069957 Ga0495667_0069957_317_928 203
36 3300053086 Ga0500578_0202470 Ga0500578_0202470_287_898 203
37 3300053109 Ga0500569_027396 Ga0500569_027396_473_1084 203
38 iso_pu_bacteria 2513237094 2513643243 203
39 iso_pu_bacteria 2513237095 2513651032 203
40 iso_pu_bacteria 2513237102 2513699464 203
41 iso_pu_bacteria 2517093001 2517104421 203
42 iso_pu_bacteria 2816332527 2818242252 203
43 iso_pu_bacteria 2824617872 2824625652 203
44 iso_pu_bacteria 2824626560 2824633331 203
45 iso_pu_bacteria 2824635225 2824641844 203
46 iso_pu_bacteria 2824644064 2824649110 203
47 iso_pu_bacteria 2824714736 2824721544 203
48 iso_pu_bacteria 2824723954 2824729372 203
49 iso_pu_bacteria 2844315083 2844321169 203
50 iso_pu_bacteria 2847930680 2847932247 203
51 iso_pu_bacteria 2874628541 2874630912 203
52 iso_pu_bacteria 2879083081 2879089349 203
53 iso_pu_bacteria 2881364244 2881371072 203
54 iso_pu_bacteria 2888378607 2888387451 203
55 iso_pu_bacteria 2888388044 2888391739 203
56 iso_pu_bacteria 2903727486 2903728593 203
57 iso_pu_bacteria 2906602504 2906607784 203
58 iso_pu_bacteria 2906626472 2906630075 203
59 iso_pu_bacteria 2906643746 2906649781 203
60 iso_pu_bacteria 2908775508 2908782772 203
61 iso_pu_bacteria 2932794094 2932796827 203
62 iso_pu_bacteria 2932801729 2932802395 203
63 iso_pu_bacteria 2935883170 2935887169 203
64 iso_pu_bacteria 2935959822 2935965690 203
65 iso_pu_bacteria 2941531003 2941537344 203
66 iso_pu_bacteria 3005594810 3005601499 203
67 iso_pu_bacteria 8016583857 8016587908 203
68 iso_pu_bacteria 8019648815 8019653606 203
69 3300048924 Ga0496121_0100455 Ga0496121_0100455_784_1398 204
70 3300005439 Ga0070711_100398237 Ga0070711_1003982371 205
71 3300005455 Ga0070663_100369100 Ga0070663_1003691001 205
72 3300005544 Ga0070686_100138487 Ga0070686_1001384871 205
73 3300005577 Ga0068857_100130475 Ga0068857_1001304752 205
74 3300005618 Ga0068864_100016090 Ga0068864_1000160902 205
75 3300005841 Ga0068863_100437519 Ga0068863_1004375191 205
76 3300007788 Ga0099795_10250670 Ga0099795_102506701 205
77 3300009551 Ga0105238_10297957 Ga0105238_102979572 205
78 3300010375 Ga0105239_10124139 Ga0105239_101241392 205
79 3300013296 Ga0157374_10428494 Ga0157374_104284941 205
80 3300014325 Ga0163163_10218870 Ga0163163_102188703 205
81 3300014968 Ga0157379_10398932 Ga0157379_103989321 205
82 3300014969 Ga0157376_10114806 Ga0157376_101148063 205
83 3300025916 Ga0207663_10051060 Ga0207663_100510603 205
84 3300025925 Ga0207650_10683007 Ga0207650_106830072 205
85 3300025927 Ga0207687_10109720 Ga0207687_101097202 205
86 3300025933 Ga0207706_10258587 Ga0207706_102585871 205
87 3300026067 Ga0207678_10259588 Ga0207678_102595882 205
88 3300026095 Ga0207676_10035908 Ga0207676_100359082 205
89 3300035083 Ga0373926_0026762 Ga0373926_0026762_527_1162 205
90 3300035111 Ga0373923_0004430 Ga0373923_0004430_1417_2034 205
91 3300035113 Ga0373936_0019613 Ga0373936_0019613_1110_1745 205
92 3300035113 Ga0373936_0021993 Ga0373936_0021993_308_925 205
93 3300035116 Ga0373945_0040597 Ga0373945_0040597_605_1240 205
94 3300035170 Ga0373943_0001395 Ga0373943_0001395_1448_2083 205
95 3300035170 Ga0373943_0085384 Ga0373943_0085384_752_1369 205
96 3300035172 Ga0373955_0033119 Ga0373955_0033119_1189_1824 205
97 3300035410 Ga0373924_0038958 Ga0373924_0038958_650_1267 205
98 3300035691 Ga0373931_0178503 Ga0373931_0178503_297_923 205
99 3300035692 Ga0373935_0001273 Ga0373935_0001273_7650_8285 205
100 3300035692 Ga0373935_0052160 Ga0373935_0052160_219_836 205
101 3300035695 Ga0373927_0000792 Ga0373927_0000792_21401_22036 205
102 3300035695 Ga0373927_0064177 Ga0373927_0064177_661_1278 205
103 3300035725 Ga0373947_0002479 Ga0373947_0002479_7011_7646 205
104 3300035725 Ga0373947_0014814 Ga0373947_0014814_1297_1914 205
105 3300037068 Ga0373925_0007136 Ga0373925_0007136_5251_5886 205
106 3300037068 Ga0373925_0113735 Ga0373925_0113735_233_850 205
107 3300046454 Ga0495592_0058249 Ga0495592_0058249_1979_2614 205
108 3300046454 Ga0495592_0068034 Ga0495592_0068034_1779_2396 205
109 3300046455 Ga0495603_0003882 Ga0495603_0003882_7774_8409 205
110 3300046459 Ga0495629_0000236 Ga0495629_0000236_2911_3546 205
111 3300046461 Ga0495641_0003725 Ga0495641_0003725_2600_3235 205
112 3300046472 Ga0495580_0019020 Ga0495580_0019020_3279_3914 205
113 3300046472 Ga0495580_0102441 Ga0495580_0102441_94_711 205
114 3300046473 Ga0495582_0000084 Ga0495582_0000084_34771_35406 205
115 3300046475 Ga0495639_0001155 Ga0495639_0001155_7029_7664 205
116 3300046475 Ga0495639_0085844 Ga0495639_0085844_326_943 205
117 3300046476 Ga0495662_0000454 Ga0495662_0000454_17515_18150 205
118 3300046477 Ga0495664_0003578 Ga0495664_0003578_4116_4751 205
119 3300046477 Ga0495664_0031081 Ga0495664_0031081_1788_2405 205
120 3300046499 Ga0495594_0001840 Ga0495594_0001840_2120_2755 205
121 3300046511 Ga0495608_0191726 Ga0495608_0191726_188_823 205
122 3300046514 Ga0495618_0020851 Ga0495618_0020851_3285_3902 205
123 3300046516 Ga0495628_0065003 Ga0495628_0065003_1717_2334 205
124 3300046516 Ga0495628_0080234 Ga0495628_0080234_1561_2196 205
125 3300046517 Ga0495630_0002622 Ga0495630_0002622_12_647 205
126 3300046517 Ga0495630_0087384 Ga0495630_0087384_985_1602 205
127 3300046526 Ga0495666_0020271 Ga0495666_0020271_558_1193 205
128 3300046529 Ga0495652_0084605 Ga0495652_0084605_1344_1979 205
129 3300046531 Ga0495665_0001312 Ga0495665_0001312_8953_9588 205
130 3300046531 Ga0495665_0016204 Ga0495665_0016204_668_1285 205
131 3300046533 Ga0495640_0011192 Ga0495640_0011192_738_1373 205
132 3300046533 Ga0495640_0032353 Ga0495640_0032353_1699_2316 205
133 3300046536 Ga0495587_0123417 Ga0495587_0123417_76_693 205
134 3300046536 Ga0495587_0189042 Ga0495587_0189042_81_716 205
135 3300046557 Ga0495622_0003118 Ga0495622_0003118_907_1542 205
136 3300046642 Ga0495634_0000321 Ga0495634_0000321_33913_34548 205
137 3300046642 Ga0495634_0056445 Ga0495634_0056445_1341_1958 205
138 3300046663 Ga0495635_0026028 Ga0495635_0026028_153_788 205
139 3300046663 Ga0495635_0030431 Ga0495635_0030431_2617_3234 205
140 3300046678 Ga0495599_0061754 Ga0495599_0061754_517_1152 205
141 3300046679 Ga0495623_0053900 Ga0495623_0053900_824_1441 205
142 3300046680 Ga0495646_0029579 Ga0495646_0029579_1461_2096 205
143 3300046681 Ga0495647_0003687 Ga0495647_0003687_4126_4761 205
144 3300046681 Ga0495647_0045848 Ga0495647_0045848_613_1230 205
145 3300046683 Ga0495658_0002077 Ga0495658_0002077_7516_8151 205
146 3300046683 Ga0495658_0038010 Ga0495658_0038010_408_1025 205
147 3300046689 Ga0495613_0015877 Ga0495613_0015877_4484_5119 205
148 3300046690 Ga0495624_0001596 Ga0495624_0001596_2447_3082 205
149 3300047315 Ga0495581_0000174 Ga0495581_0000174_21506_22141 205
150 3300047315 Ga0495581_0021346 Ga0495581_0021346_2332_2949 205
151 3300047317 Ga0495604_0131064 Ga0495604_0131064_103_720 205
152 3300047317 Ga0495604_0173616 Ga0495604_0173616_577_1212 205
153 3300047319 Ga0495674_0010664 Ga0495674_0010664_1558_2175 205
154 3300047319 Ga0495674_0012229 Ga0495674_0012229_6942_7577 205
155 3300047321 Ga0495676_0052222 Ga0495676_0052222_503_1138 205
156 3300047471 Ga0495684_0007348 Ga0495684_0007348_6766_7401 205
157 3300047471 Ga0495684_0150183 Ga0495684_0150183_630_1247 205
158 3300047673 Ga0495593_0000321 Ga0495593_0000321_12700_13335 205
159 3300047673 Ga0495593_0069526 Ga0495593_0069526_981_1598 205
160 3300048905 Ga0496102_0026708 Ga0496102_0026708_1358_1984 205
161 3300048907 Ga0496104_0021948 Ga0496104_0021948_1692_2318 205
162 3300048908 Ga0496105_0013476 Ga0496105_0013476_1872_2498 205
163 3300048909 Ga0496106_0095898 Ga0496106_0095898_1381_2007 205
164 3300048910 Ga0496107_0018133 Ga0496107_0018133_2069_2695 205
165 3300048913 Ga0496110_0016246 Ga0496110_0016246_2221_2847 205
166 3300048913 Ga0496110_0747600 Ga0496110_0747600_233_862 205
167 3300048915 Ga0496112_0053526 Ga0496112_0053526_1982_2608 205
168 3300048915 Ga0496112_0745281 Ga0496112_0745281_74_703 205
169 3300048916 Ga0496113_0072032 Ga0496113_0072032_129_755 205
170 3300053078 Ga0495612_0005522 Ga0495612_0005522_3948_4565 205
171 3300005458 Ga0070681_10096136 Ga0070681_100961363 206
172 3300005530 Ga0070679_100144908 Ga0070679_1001449082 206
173 3300005535 Ga0070684_100069141 Ga0070684_1000691412 206
174 3300007265 Ga0099794_10132452 Ga0099794_101324522 206
175 3300007265 Ga0099794_10136402 Ga0099794_101364021 206
176 3300009093 Ga0105240_10444411 Ga0105240_104444111 206
177 3300020069 Ga0197907_10398635 Ga0197907_103986352 206
178 3300021388 Ga0213875_10077451 Ga0213875_100774511 206
179 3300025302 Ga0207426_1013780 Ga0207426_10137805 206
180 3300025912 Ga0207707_10311839 Ga0207707_103118392 206
181 3300025913 Ga0207695_10126612 Ga0207695_101266122 206
182 3300025921 Ga0207652_10088917 Ga0207652_100889172 206
183 3300025944 Ga0207661_10000597 Ga0207661_1000059713 206
184 3300026121 Ga0207683_10207698 Ga0207683_102076983 206
185 3300037853 Ga0436364_0994846 Ga0436364_0994846_1549_2169 206
186 3300037853 Ga0436364_0997941 Ga0436364_0997941_503_1123 206
187 3300039437 Ga0436365_1077088 Ga0436365_1077088_33_653 206
188 3300039437 Ga0436365_1444382 Ga0436365_1444382_354_974 206
189 3300041507 Ga0451851_0123442 Ga0451851_0123442_133_753 206
190 3300046507 Ga0495606_0017760 Ga0495606_0017760_3057_3677 206
191 3300046529 Ga0495652_0138489 Ga0495652_0138489_962_1582 206
192 3300046559 Ga0495667_0240177 Ga0495667_0240177_439_1059 206
193 3300046809 Ga0495600_0056308 Ga0495600_0056308_365_985 206
194 3300047469 Ga0495673_0014385 Ga0495673_0014385_2580_3203 206
195 3300047472 Ga0495686_0026657 Ga0495686_0026657_1561_2181 206
196 3300048088 Ga0495602_0643521 Ga0495602_0643521_41_661 206
197 3300048922 Ga0496119_0076280 Ga0496119_0076280_486_1106 206
198 3300053086 Ga0500578_0201428 Ga0500578_0201428_25_645 206
199 3300053093 Ga0500651_0013550 Ga0500651_0013550_2546_3166 206
200 3300053098 Ga0500650_0283029 Ga0500650_0283029_61_681 206
201 3300053118 Ga0500594_0004879 Ga0500594_0004879_262_882 206
202 3300053119 Ga0500595_002456 Ga0500595_002456_6740_7360 206
203 3300053130 Ga0500642_0012128 Ga0500642_0012128_2346_2966 206
204 3300053156 Ga0500622_0153432 Ga0500622_0153432_109_729 206
205 3300053158 Ga0500627_0176241 Ga0500627_0176241_33_653 206
206 3300003203 JGI25406J46586_10000043 JGI25406J46586_1000004325 207
207 3300004625 Ga0055543_1017285 Ga0055543_10172852 207
208 3300005262 Ga0065165_1005519 Ga0065165_10055197 207
209 3300005293 Ga0065715_10360587 Ga0065715_103605871 207
210 3300005327 Ga0070658_10140542 Ga0070658_101405421 207
211 3300005327 Ga0070658_10329989 Ga0070658_103299891 207
212 3300005336 Ga0070680_100015508 Ga0070680_1000155087 207
213 3300005339 Ga0070660_100002476 Ga0070660_1000024765 207
214 3300005344 Ga0070661_100123382 Ga0070661_1001233823 207
215 3300005356 Ga0070674_100107727 Ga0070674_1001077273 207
216 3300005356 Ga0070674_100139838 Ga0070674_1001398382 207
217 3300005364 Ga0070673_100745570 Ga0070673_1007455701 207
218 3300005366 Ga0070659_100071210 Ga0070659_1000712101 207
219 3300005434 Ga0070709_10064886 Ga0070709_100648863 207
220 3300005435 Ga0070714_100563062 Ga0070714_1005630621 207
221 3300005436 Ga0070713_100016921 Ga0070713_1000169216 207
222 3300005436 Ga0070713_100298475 Ga0070713_1002984752 207
223 3300005455 Ga0070663_100334322 Ga0070663_1003343222 207
224 3300005456 Ga0070678_100047779 Ga0070678_1000477792 207
225 3300005458 Ga0070681_10122770 Ga0070681_101227702 207
226 3300005459 Ga0068867_100209218 Ga0068867_1002092182 207
227 3300005471 Ga0070698_101234308 Ga0070698_1012343081 207
228 3300005530 Ga0070679_100813663 Ga0070679_1008136631 207
229 3300005535 Ga0070684_100019396 Ga0070684_1000193967 207
230 3300005539 Ga0068853_100001656 Ga0068853_1000016566 207
231 3300005548 Ga0070665_100243818 Ga0070665_1002438182 207
232 3300005563 Ga0068855_100054227 Ga0068855_1000542273 207
233 3300005564 Ga0070664_100459958 Ga0070664_1004599582 207
234 3300005577 Ga0068857_100364785 Ga0068857_1003647852 207
235 3300005616 Ga0068852_100082890 Ga0068852_1000828904 207
236 3300005719 Ga0068861_100440514 Ga0068861_1004405142 207
237 3300005834 Ga0068851_10023151 Ga0068851_100231512 207
238 3300005841 Ga0068863_100435837 Ga0068863_1004358372 207
239 3300005985 Ga0081539_10000324 Ga0081539_1000032495 207
240 3300005985 Ga0081539_10001968 Ga0081539_1000196822 207
241 3300006038 Ga0075365_10209539 Ga0075365_102095392 207
242 3300006051 Ga0075364_10088895 Ga0075364_100888952 207
243 3300006353 Ga0075370_10033413 Ga0075370_100334133 207
244 3300007788 Ga0099795_10008203 Ga0099795_100082033 207
245 3300009093 Ga0105240_10007694 Ga0105240_100076943 207
246 3300009101 Ga0105247_10052284 Ga0105247_100522843 207
247 3300009176 Ga0105242_10278216 Ga0105242_102782162 207
248 3300009177 Ga0105248_10439938 Ga0105248_104399382 207
249 3300009545 Ga0105237_10015525 Ga0105237_100155252 207
250 3300009545 Ga0105237_10258969 Ga0105237_102589692 207
251 3300009551 Ga0105238_10029507 Ga0105238_100295077 207
252 3300010159 Ga0099796_10068340 Ga0099796_100683401 207
253 3300010375 Ga0105239_10029597 Ga0105239_100295975 207
254 3300010375 Ga0105239_10047895 Ga0105239_100478953 207
255 3300013105 Ga0157369_10019439 Ga0157369_100194399 207
256 3300013297 Ga0157378_11096631 Ga0157378_110966311 207
257 3300013306 Ga0163162_10369271 Ga0163162_103692712 207
258 3300013307 Ga0157372_11351747 Ga0157372_113517471 207
259 3300013308 Ga0157375_10352162 Ga0157375_103521622 207
260 3300014325 Ga0163163_10785806 Ga0163163_107858061 207
261 3300025230 Ga0209563_103012 Ga0209563_1030124 207
262 3300025253 Ga0209677_104064 Ga0209677_1040645 207
263 3300025273 Ga0209673_1022322 Ga0209673_10223221 207
264 3300025297 Ga0209758_1005318 Ga0209758_10053188 207
265 3300025302 Ga0207426_1005781 Ga0207426_10057815 207
266 3300025302 Ga0207426_1007382 Ga0207426_10073823 207
267 3300025304 Ga0209257_1054008 Ga0209257_10540081 207
268 3300025898 Ga0207692_10200510 Ga0207692_102005101 207
269 3300025900 Ga0207710_10032876 Ga0207710_100328763 207
270 3300025906 Ga0207699_10064392 Ga0207699_100643923 207
271 3300025909 Ga0207705_10089755 Ga0207705_100897552 207
272 3300025909 Ga0207705_10322001 Ga0207705_103220012 207
273 3300025912 Ga0207707_10003102 Ga0207707_1000310211 207
274 3300025913 Ga0207695_10063410 Ga0207695_100634102 207
275 3300025914 Ga0207671_10084122 Ga0207671_100841222 207
276 3300025914 Ga0207671_10213861 Ga0207671_102138611 207
277 3300025915 Ga0207693_10117582 Ga0207693_101175822 207
278 3300025917 Ga0207660_10003607 Ga0207660_1000360710 207
279 3300025919 Ga0207657_10015320 Ga0207657_100153203 207
280 3300025920 Ga0207649_10039938 Ga0207649_100399384 207
281 3300025921 Ga0207652_10052496 Ga0207652_100524962 207
282 3300025922 Ga0207646_10345011 Ga0207646_103450112 207
283 3300025924 Ga0207694_10007559 Ga0207694_100075592 207
284 3300025926 Ga0207659_10222364 Ga0207659_102223641 207
285 3300025928 Ga0207700_10024184 Ga0207700_100241843 207
286 3300025929 Ga0207664_10033040 Ga0207664_100330404 207
287 3300025929 Ga0207664_10118054 Ga0207664_101180541 207
288 3300025937 Ga0207669_10100216 Ga0207669_101002161 207
289 3300025944 Ga0207661_10470027 Ga0207661_104700271 207
290 3300025949 Ga0207667_10001989 Ga0207667_1000198926 207
291 3300025960 Ga0207651_11038356 Ga0207651_110383561 207
292 3300026041 Ga0207639_10004121 Ga0207639_1000412110 207
293 3300026067 Ga0207678_10096823 Ga0207678_100968233 207
294 3300026067 Ga0207678_10172161 Ga0207678_101721612 207
295 3300026078 Ga0207702_10477579 Ga0207702_104775792 207
296 3300026088 Ga0207641_10350473 Ga0207641_103504731 207
297 3300026089 Ga0207648_10124448 Ga0207648_101244482 207
298 3300026116 Ga0207674_10145484 Ga0207674_101454841 207
299 3300026121 Ga0207683_10076908 Ga0207683_100769083 207
300 3300026121 Ga0207683_10096708 Ga0207683_100967082 207
301 3300026142 Ga0207698_10253026 Ga0207698_102530261 207
302 3300028379 Ga0268266_10137558 Ga0268266_101375583 207
303 3300028573 Ga0265334_10037283 Ga0265334_100372832 207
304 3300031235 Ga0265330_10010904 Ga0265330_100109043 207
305 3300031235 Ga0265330_10059220 Ga0265330_100592202 207
306 3300031238 Ga0265332_10050591 Ga0265332_100505912 207
307 3300031239 Ga0265328_10092146 Ga0265328_100921462 207
308 3300031595 Ga0265313_10047266 Ga0265313_100472662 207
309 3300033180 Ga0307510_10006233 Ga0307510_1000623312 207
310 3300034816 Ga0373930_0081805 Ga0373930_0081805_13_636 207
311 3300035084 Ga0373928_0005159 Ga0373928_0005159_561_1184 207
312 3300035086 Ga0373934_0000917 Ga0373934_0000917_7211_7834 207
313 3300035086 Ga0373934_0043566 Ga0373934_0043566_887_1510 207
314 3300035111 Ga0373923_0009785 Ga0373923_0009785_2500_3123 207
315 3300035114 Ga0373939_0104584 Ga0373939_0104584_191_814 207
316 3300035115 Ga0373941_0033118 Ga0373941_0033118_489_1112 207
317 3300035117 Ga0373953_0007777 Ga0373953_0007777_2907_3530 207
318 3300035117 Ga0373953_0133001 Ga0373953_0133001_243_866 207
319 3300035118 Ga0373954_0007560 Ga0373954_0007560_3896_4519 207
320 3300035118 Ga0373954_0077586 Ga0373954_0077586_808_1431 207
321 3300035119 Ga0373956_0002486 Ga0373956_0002486_4035_4658 207
322 3300035119 Ga0373956_0012134 Ga0373956_0012134_665_1288 207
323 3300035120 Ga0373957_0005552 Ga0373957_0005552_2564_3187 207
324 3300035120 Ga0373957_0010606 Ga0373957_0010606_1793_2416 207
325 3300035170 Ga0373943_0244985 Ga0373943_0244985_152_775 207
326 3300035172 Ga0373955_0030392 Ga0373955_0030392_2032_2655 207
327 3300035242 Ga0373962_0068829 Ga0373962_0068829_377_1000 207
328 3300035410 Ga0373924_0007709 Ga0373924_0007709_992_1615 207
329 3300035410 Ga0373924_0039737 Ga0373924_0039737_792_1415 207
330 3300035691 Ga0373931_0003292 Ga0373931_0003292_562_1185 207
331 3300035692 Ga0373935_0094930 Ga0373935_0094930_292_915 207
332 3300035695 Ga0373927_0005966 Ga0373927_0005966_3694_4317 207
333 3300035695 Ga0373927_0429348 Ga0373927_0429348_177_800 207
334 3300035724 Ga0373933_0000964 Ga0373933_0000964_2519_3142 207
335 3300035724 Ga0373933_0004963 Ga0373933_0004963_4449_5072 207
336 3300035725 Ga0373947_0066856 Ga0373947_0066856_476_1099 207
337 3300036401 Ga0373937_0100605 Ga0373937_0100605_270_893 207
338 3300036401 Ga0373937_0280338 Ga0373937_0280338_693_1316 207
339 3300037068 Ga0373925_0082976 Ga0373925_0082976_384_1007 207
340 3300037068 Ga0373925_0248345 Ga0373925_0248345_153_776 207
341 3300037068 Ga0373925_0474061 Ga0373925_0474061_204_827 207
342 3300037418 Ga0395900_0012938 Ga0395900_0012938_5399_6022 207
343 3300037466 Ga0395898_0071507 Ga0395898_0071507_311_934 207
344 3300037466 Ga0395898_0644608 Ga0395898_0644608_253_879 207
345 3300038443 Ga0395901_0061423 Ga0395901_0061423_2487_3110 207
346 3300046454 Ga0495592_0002895 Ga0495592_0002895_3110_3733 207
347 3300046454 Ga0495592_0023469 Ga0495592_0023469_2820_3443 207
348 3300046454 Ga0495592_0066701 Ga0495592_0066701_1032_1655 207
349 3300046459 Ga0495629_0011071 Ga0495629_0011071_2764_3387 207
350 3300046459 Ga0495629_0021237 Ga0495629_0021237_221_844 207
351 3300046460 Ga0495638_0040101 Ga0495638_0040101_515_1138 207
352 3300046462 Ga0495651_0015634 Ga0495651_0015634_2187_2810 207
353 3300046462 Ga0495651_0020175 Ga0495651_0020175_2571_3194 207
354 3300046462 Ga0495651_0108523 Ga0495651_0108523_1355_1978 207
355 3300046463 Ga0495653_0012185 Ga0495653_0012185_3110_3733 207
356 3300046463 Ga0495653_0027945 Ga0495653_0027945_668_1291 207
357 3300046463 Ga0495653_0130007 Ga0495653_0130007_200_823 207
358 3300046463 Ga0495653_0484958 Ga0495653_0484958_15_641 207
359 3300046471 Ga0495650_0141370 Ga0495650_0141370_176_799 207
360 3300046473 Ga0495582_0077070 Ga0495582_0077070_114_737 207
361 3300046475 Ga0495639_0033767 Ga0495639_0033767_82_705 207
362 3300046475 Ga0495639_0096263 Ga0495639_0096263_609_1232 207
363 3300046475 Ga0495639_0190557 Ga0495639_0190557_66_689 207
364 3300046476 Ga0495662_0213297 Ga0495662_0213297_16_639 207
365 3300046511 Ga0495608_0018513 Ga0495608_0018513_3904_4527 207
366 3300046511 Ga0495608_0132895 Ga0495608_0132895_288_911 207
367 3300046512 Ga0495610_0243704 Ga0495610_0243704_25_648 207
368 3300046514 Ga0495618_0040236 Ga0495618_0040236_2154_2777 207
369 3300046514 Ga0495618_0230812 Ga0495618_0230812_507_1130 207
370 3300046516 Ga0495628_0008781 Ga0495628_0008781_5677_6300 207
371 3300046516 Ga0495628_0022522 Ga0495628_0022522_4401_5024 207
372 3300046517 Ga0495630_0151879 Ga0495630_0151879_73_696 207
373 3300046517 Ga0495630_0424864 Ga0495630_0424864_292_915 207
374 3300046524 Ga0495648_0035521 Ga0495648_0035521_1886_2509 207
375 3300046526 Ga0495666_0134608 Ga0495666_0134608_273_896 207
376 3300046529 Ga0495652_0011193 Ga0495652_0011193_3478_4101 207
377 3300046529 Ga0495652_0514716 Ga0495652_0514716_154_780 207
378 3300046533 Ga0495640_0006537 Ga0495640_0006537_3753_4376 207
379 3300046533 Ga0495640_0280046 Ga0495640_0280046_233_856 207
380 3300046536 Ga0495587_0016668 Ga0495587_0016668_3331_3954 207
381 3300046536 Ga0495587_0026726 Ga0495587_0026726_1684_2307 207
382 3300046543 Ga0495645_0049445 Ga0495645_0049445_2275_2898 207
383 3300046543 Ga0495645_0114473 Ga0495645_0114473_982_1605 207
384 3300046543 Ga0495645_0390357 Ga0495645_0390357_92_718 207
385 3300046559 Ga0495667_0005125 Ga0495667_0005125_4897_5520 207
386 3300046559 Ga0495667_0008101 Ga0495667_0008101_6104_6727 207
387 3300046559 Ga0495667_0019089 Ga0495667_0019089_3090_3713 207
388 3300046642 Ga0495634_0011437 Ga0495634_0011437_1014_1637 207
389 3300046642 Ga0495634_0030658 Ga0495634_0030658_2200_2823 207
390 3300046663 Ga0495635_0003139 Ga0495635_0003139_9857_10480 207
391 3300046663 Ga0495635_0022784 Ga0495635_0022784_2792_3415 207
392 3300046675 Ga0495657_0009754 Ga0495657_0009754_552_1175 207
393 3300046675 Ga0495657_0093493 Ga0495657_0093493_1219_1842 207
394 3300046678 Ga0495599_0005351 Ga0495599_0005351_6030_6653 207
395 3300046678 Ga0495599_0015612 Ga0495599_0015612_352_975 207
396 3300046678 Ga0495599_0020314 Ga0495599_0020314_3424_4047 207
397 3300046679 Ga0495623_0081457 Ga0495623_0081457_341_964 207
398 3300046679 Ga0495623_0098545 Ga0495623_0098545_342_965 207
399 3300046680 Ga0495646_0019568 Ga0495646_0019568_205_828 207
400 3300046689 Ga0495613_0086687 Ga0495613_0086687_1501_2124 207
401 3300046689 Ga0495613_0132420 Ga0495613_0132420_664_1287 207
402 3300046809 Ga0495600_0006764 Ga0495600_0006764_3892_4515 207
403 3300046809 Ga0495600_0013900 Ga0495600_0013900_3284_3907 207
404 3300047315 Ga0495581_0053479 Ga0495581_0053479_248_871 207
405 3300047317 Ga0495604_0053959 Ga0495604_0053959_2223_2846 207
406 3300047317 Ga0495604_0058569 Ga0495604_0058569_2058_2681 207
407 3300047317 Ga0495604_0104500 Ga0495604_0104500_413_1036 207
408 3300047317 Ga0495604_0284070 Ga0495604_0284070_289_912 207
409 3300047319 Ga0495674_0046885 Ga0495674_0046885_1126_1749 207
410 3300047319 Ga0495674_0052543 Ga0495674_0052543_523_1146 207
411 3300047319 Ga0495674_0073997 Ga0495674_0073997_2198_2821 207
412 3300047322 Ga0495680_0015403 Ga0495680_0015403_3226_3849 207
413 3300047322 Ga0495680_0026093 Ga0495680_0026093_2143_2766 207
414 3300047444 Ga0495675_0247476 Ga0495675_0247476_53_676 207
415 3300047471 Ga0495684_0003361 Ga0495684_0003361_9340_9963 207
416 3300047471 Ga0495684_0014558 Ga0495684_0014558_2667_3290 207
417 3300047471 Ga0495684_0068439 Ga0495684_0068439_897_1520 207
418 3300047472 Ga0495686_0021905 Ga0495686_0021905_3273_3896 207
419 3300047673 Ga0495593_0031420 Ga0495593_0031420_243_866 207
420 3300048088 Ga0495602_0034315 Ga0495602_0034315_1900_2523 207
421 3300048088 Ga0495602_0038535 Ga0495602_0038535_95_718 207
422 3300048088 Ga0495602_0605162 Ga0495602_0605162_19_642 207
423 3300048903 Ga0496100_0082597 Ga0496100_0082597_891_1514 207
424 3300048904 Ga0496101_0117817 Ga0496101_0117817_724_1347 207
425 3300048905 Ga0496102_0054164 Ga0496102_0054164_1556_2179 207
426 3300048906 Ga0496103_0027003 Ga0496103_0027003_2136_2759 207
427 3300048907 Ga0496104_0060487 Ga0496104_0060487_57_680 207
428 3300048907 Ga0496104_0111039 Ga0496104_0111039_318_941 207
429 3300048907 Ga0496104_0157345 Ga0496104_0157345_513_1136 207
430 3300048908 Ga0496105_0038018 Ga0496105_0038018_831_1454 207
431 3300048908 Ga0496105_0199663 Ga0496105_0199663_816_1439 207
432 3300048909 Ga0496106_0016874 Ga0496106_0016874_3791_4414 207
433 3300048909 Ga0496106_0018456 Ga0496106_0018456_996_1619 207
434 3300048910 Ga0496107_0002177 Ga0496107_0002177_11590_12213 207
435 3300048910 Ga0496107_0153969 Ga0496107_0153969_938_1561 207
436 3300048911 Ga0496108_0003416 Ga0496108_0003416_8864_9487 207
437 3300048911 Ga0496108_0023228 Ga0496108_0023228_3212_3835 207
438 3300048911 Ga0496108_0196758 Ga0496108_0196758_675_1298 207
439 3300048912 Ga0496109_0000230 Ga0496109_0000230_16413_17036 207
440 3300048912 Ga0496109_0017788 Ga0496109_0017788_882_1505 207
441 3300048912 Ga0496109_0586664 Ga0496109_0586664_195_818 207
442 3300048913 Ga0496110_0137148 Ga0496110_0137148_798_1421 207
443 3300048913 Ga0496110_0203385 Ga0496110_0203385_334_957 207
444 3300048914 Ga0496111_0023006 Ga0496111_0023006_3411_4034 207
445 3300048914 Ga0496111_0067534 Ga0496111_0067534_1716_2339 207
446 3300048914 Ga0496111_0119277 Ga0496111_0119277_1067_1690 207
447 3300048915 Ga0496112_0009599 Ga0496112_0009599_6492_7115 207
448 3300048915 Ga0496112_0025801 Ga0496112_0025801_243_866 207
449 3300048915 Ga0496112_0055204 Ga0496112_0055204_777_1400 207
450 3300048916 Ga0496113_0006600 Ga0496113_0006600_4685_5308 207
451 3300048916 Ga0496113_0066885 Ga0496113_0066885_1715_2338 207
452 3300048917 Ga0496114_0031540 Ga0496114_0031540_2338_2961 207
453 3300048917 Ga0496114_0073302 Ga0496114_0073302_471_1094 207
454 3300048918 Ga0496115_0005259 Ga0496115_0005259_5010_5633 207
455 3300048918 Ga0496115_0064029 Ga0496115_0064029_1745_2368 207
456 3300048924 Ga0496121_0002915 Ga0496121_0002915_9590_10213 207
457 3300048929 Ga0496126_0418186 Ga0496126_0418186_384_1007 207
458 3300050492 nmdc:mga0yw44_172735_c1 nmdc:mga0yw44_172735_c1_703_1335 207
459 3300053077 Ga0495601_0053666 Ga0495601_0053666_204_827 207
460 3300053077 Ga0495601_0479686 Ga0495601_0479686_144_770 207
461 3300053077 Ga0495601_0537644 Ga0495601_0537644_36_659 207
462 3300053078 Ga0495612_0008630 Ga0495612_0008630_2828_3451 207
463 3300053084 Ga0495595_0014358 Ga0495595_0014358_2152_2775 207
464 3300053084 Ga0495595_0017393 Ga0495595_0017393_2166_2789 207
465 3300053084 Ga0495595_0070165 Ga0495595_0070165_837_1460 207
466 3300053085 Ga0495619_0004748 Ga0495619_0004748_2993_3616 207
467 3300053085 Ga0495619_0037345 Ga0495619_0037345_1677_2300 207
468 3300053085 Ga0495619_0097270 Ga0495619_0097270_897_1574 207
469 3300053085 Ga0495619_0188315 Ga0495619_0188315_477_1100 207
470 3300053085 Ga0495619_0667252 Ga0495619_0667252_40_663 207
471 3300053086 Ga0500578_0094579 Ga0500578_0094579_1132_1755 207
472 3300053087 Ga0500643_000013 Ga0500643_000013_265744_266367 207
473 3300053091 Ga0500647_0234730 Ga0500647_0234730_35_658 207
474 3300053094 Ga0500566_0084289 Ga0500566_0084289_221_844 207
475 3300053095 Ga0500640_039162 Ga0500640_039162_696_1319 207
476 3300053097 Ga0500648_146433 Ga0500648_146433_124_747 207
477 3300053103 Ga0500555_005779 Ga0500555_005779_1571_2194 207
478 3300053104 Ga0500556_0005933 Ga0500556_0005933_2659_3282 207
479 3300053111 Ga0500572_006678 Ga0500572_006678_1015_1638 207
480 3300053119 Ga0500595_007068 Ga0500595_007068_2813_3436 207
481 3300053121 Ga0500607_033384 Ga0500607_033384_31_654 207
482 3300053122 Ga0500608_031942 Ga0500608_031942_479_1102 207
483 3300053123 Ga0500614_025437 Ga0500614_025437_181_804 207
484 3300053133 Ga0500655_060615 Ga0500655_060615_79_702 207
485 3300053136 Ga0500559_0029270 Ga0500559_0029270_157_780 207
486 3300053139 Ga0500568_0024528 Ga0500568_0024528_1870_2493 207
487 3300053146 Ga0500588_0032160 Ga0500588_0032160_708_1331 207
488 3300053154 Ga0500619_001595 Ga0500619_001595_1860_2483 207
489 3300053155 Ga0500620_001777 Ga0500620_001777_2186_2809 207
490 3300053157 Ga0500624_002308 Ga0500624_002308_842_1465 207
491 3300053163 Ga0500639_092255 Ga0500639_092255_764_1387 207
492 3300053177 Ga0500636_0000701 Ga0500636_0000701_6639_7262 207
493 3300053736 Ga0500599_007270 Ga0500599_007270_774_1397 207
494 3300053737 Ga0500601_000311 Ga0500601_000311_8456_9079 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

8

207

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.753 45 207
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.7363 45 207
1bxw-assembly1.cif.gz_A outer membrane protein a (ompa) transmembrane domain 0.7094 45 207
1qj8-assembly1.cif.gz_A crystal structure of the outer membrane protein ompx from escherichia coli 0.6946 48 207
1qj8-assembly1.cif.gz_A crystal structure of the outer membrane protein ompx from escherichia coli 0.6869 48 207
ID Description Score Start End Superfamily
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.753 45 207 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.7363 45 207 2.40.160.20
3qrcB00 Mainly Beta;Beta Barrel;Porin; 0.6418 46 207 2.40.160.20
4rlcA00 Mainly Beta;Beta Barrel;Porin; 0.6401 50 205 2.40.160.20
3qrcB00 Mainly Beta;Beta Barrel;Porin; 0.6351 46 207 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A7U3E5R6-F1-model_v4 deleted 0.876 27 207
AF-A0A833LGP2-F1-model_v4 Porin family protein 0.8706 24 207 GO:0009279
AF-Q45321-F1-model_v4 25 kDa outer-membrane immunogenic protein 0.8699 25 207 GO:0009279
GO:0044384
AF-A0A8A8ZLG3-F1-model_v4 deleted 0.8614 24 207
AF-A0A258KAR2-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8607 28 207 GO:0009279

Feature Viewer

pLDDT pTM Quality
66.97 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map