F454574
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 494 | 190 | 988 | 71 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10038544|Ga0182008_100385442 |
| Length | 87 |
| Sequence | MAQWPGGGKTLARTPAVNRINPRKLLLSKWTAAHPQNREKHFLVTELFRDEDGTVLEIELQAVLTRRTEQCDWHALQDDSRWKMGWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Metagenome | Rhizosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 21 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 22 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 23 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 32 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 40 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 41 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 42 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 74 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 76 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 77 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 78 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 79 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 80 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 81 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 82 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 83 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 84 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 85 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 86 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 87 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 88 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 89 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 90 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 91 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 92 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 93 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 94 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 95 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 96 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 97 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 182 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 184 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 185 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 186 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 187 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 188 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 189 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 190 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.66 |
| Nodule | 0 |
| Rhizoplane | 2.23 |
| Rhizosphere | 80.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10038544 | 3300014497 | Bacteria | 2390 |
| 2 | JGI25163J39215_1000219 | 3300002771 | Bacteria | 21336 |
| 3 | JGI25164J39214_1000160 | 3300002772 | Bacteria | 63841 |
| 4 | JGI25165J46597_1000290 | 3300003214 | Bacteria | 63841 |
| 5 | rootH1_10184217 | 3300003323 | Bacteria | 1526 |
| 6 | JGI26143J51219_1001913 | 3300003502 | Bacteria | 883 |
| 7 | Ga0055525_1004420 | 3300003759 | Bacteria | 1210 |
| 8 | Ga0055536_1000831 | 3300003781 | Bacteria | 20372 |
| 9 | Ga0055530_10001294 | 3300003791 | Bacteria | 18901 |
| 10 | Ga0055540_1000277 | 3300003792 | Bacteria | 46097 |
| 11 | Ga0055531_10000123 | 3300003794 | Bacteria | 86722 |
| 12 | Ga0065714_10292984 | 3300005288 | Bacteria | 705 |
| 13 | Ga0065714_10324050 | 3300005288 | Bacteria | 665 |
| 14 | Ga0065704_10272377 | 3300005289 | Bacteria | 940 |
| 15 | Ga0065704_10332961 | 3300005289 | Bacteria | 835 |
| 16 | Ga0070669_100016874 | 3300005353 | Bacteria | 5213 |
| 17 | Ga0070663_100643430 | 3300005455 | Bacteria | 896 |
| 18 | Ga0070662_100006388 | 3300005457 | Bacteria | 7595 |
| 19 | Ga0070684_102310428 | 3300005535 | Bacteria | 507 |
| 20 | Ga0070665_100135885 | 3300005548 | Bacteria | 2461 |
| 21 | Ga0068855_102447657 | 3300005563 | Bacteria | 520 |
| 22 | Ga0075432_10333871 | 3300006058 | Bacteria | 638 |
| 23 | Ga0075362_10069147 | 3300006177 | Bacteria | 1609 |
| 24 | Ga0075362_10198328 | 3300006177 | Bacteria | 976 |
| 25 | Ga0075436_100285929 | 3300006914 | Bacteria | 1180 |
| 26 | Ga0105251_10005928 | 3300009011 | Bacteria | 7897 |
| 27 | Ga0105251_10014133 | 3300009011 | Bacteria | 4430 |
| 28 | Ga0105244_10002038 | 3300009036 | Bacteria | 15563 |
| 29 | Ga0105244_10003864 | 3300009036 | Bacteria | 10554 |
| 30 | Ga0105244_10008293 | 3300009036 | Bacteria | 6502 |
| 31 | Ga0105244_10008504 | 3300009036 | Bacteria | 6403 |
| 32 | Ga0105244_10185560 | 3300009036 | Bacteria | 985 |
| 33 | Ga0105244_10244717 | 3300009036 | Bacteria | 837 |
| 34 | Ga0105244_10357175 | 3300009036 | Bacteria | 673 |
| 35 | Ga0105244_10367224 | 3300009036 | Bacteria | 663 |
| 36 | Ga0105250_10000637 | 3300009092 | Bacteria | 22489 |
| 37 | Ga0105250_10002425 | 3300009092 | Bacteria | 9368 |
| 38 | Ga0105250_10004161 | 3300009092 | Bacteria | 6711 |
| 39 | Ga0105250_10007509 | 3300009092 | Bacteria | 4678 |
| 40 | Ga0105250_10016955 | 3300009092 | Bacteria | 2963 |
| 41 | Ga0105247_10789102 | 3300009101 | Bacteria | 724 |
| 42 | Ga0105243_10000335 | 3300009148 | Bacteria | 51380 |
| 43 | Ga0105238_12619295 | 3300009551 | Bacteria | 541 |
| 44 | Ga0105249_10048077 | 3300009553 | Bacteria | 3890 |
| 45 | Ga0105246_10000484 | 3300011119 | Bacteria | 21488 |
| 46 | Ga0157345_1000093 | 3300012498 | Bacteria | 18946 |
| 47 | Ga0157373_10024960 | 3300013100 | Bacteria | 4327 |
| 48 | Ga0157373_10031898 | 3300013100 | Bacteria | 3794 |
| 49 | Ga0157373_10127924 | 3300013100 | Bacteria | 1786 |
| 50 | Ga0157371_10001483 | 3300013102 | Bacteria | 24268 |
| 51 | Ga0157371_10013719 | 3300013102 | Bacteria | 6144 |
| 52 | Ga0157371_10080369 | 3300013102 | Bacteria | 2309 |
| 53 | Ga0157371_10891076 | 3300013102 | Bacteria | 674 |
| 54 | Ga0157370_10082381 | 3300013104 | Bacteria | 3026 |
| 55 | Ga0157370_10275500 | 3300013104 | Bacteria | 1554 |
| 56 | Ga0157370_10371403 | 3300013104 | Bacteria | 1318 |
| 57 | Ga0157370_10812084 | 3300013104 | Bacteria | 851 |
| 58 | Ga0157370_11257937 | 3300013104 | Bacteria | 667 |
| 59 | Ga0157369_10080665 | 3300013105 | Bacteria | 3484 |
| 60 | Ga0157369_11622259 | 3300013105 | Bacteria | 658 |
| 61 | Ga0163162_10420602 | 3300013306 | Bacteria | 1469 |
| 62 | Ga0157372_10005543 | 3300013307 | Bacteria | 13421 |
| 63 | Ga0157375_10002693 | 3300013308 | Bacteria | 15384 |
| 64 | Ga0157375_10207106 | 3300013308 | Bacteria | 2118 |
| 65 | Ga0182008_10027585 | 3300014497 | Bacteria | 2875 |
| 66 | Ga0182008_10093506 | 3300014497 | Bacteria | 1483 |
| 67 | Ga0182008_10094922 | 3300014497 | Bacteria | 1471 |
| 68 | Ga0182006_1001263 | 3300015261 | Bacteria | 15628 |
| 69 | Ga0182006_1005730 | 3300015261 | Bacteria | 5862 |
| 70 | Ga0182006_1007576 | 3300015261 | Bacteria | 4961 |
| 71 | Ga0182006_1011993 | 3300015261 | Bacteria | 3796 |
| 72 | Ga0182006_1062211 | 3300015261 | Bacteria | 1405 |
| 73 | Ga0182007_10394185 | 3300015262 | Bacteria | 527 |
| 74 | Ga0182005_1010587 | 3300015265 | Bacteria | 2648 |
| 75 | Ga0182005_1050625 | 3300015265 | Bacteria | 1129 |
| 76 | Ga0182005_1082582 | 3300015265 | Bacteria | 888 |
| 77 | Ga0182005_1084976 | 3300015265 | Bacteria | 876 |
| 78 | Ga0182005_1282369 | 3300015265 | Bacteria | 521 |
| 79 | Ga0163161_10312678 | 3300017792 | Bacteria | 1240 |
| 80 | Ga0163161_10564864 | 3300017792 | Bacteria | 934 |
| 81 | Ga0163161_10866091 | 3300017792 | Bacteria | 763 |
| 82 | Ga0209760_100258 | 3300025207 | Bacteria | 21118 |
| 83 | Ga0209563_100745 | 3300025230 | Bacteria | 10006 |
| 84 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 85 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 86 | Ga0209233_1000059 | 3300025261 | Bacteria | 414562 |
| 87 | Ga0209675_1004773 | 3300025291 | Bacteria | 5894 |
| 88 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 89 | Ga0209676_1000350 | 3300025292 | Bacteria | 87204 |
| 90 | Ga0209050_1000019 | 3300025298 | Bacteria | 608757 |
| 91 | Ga0209051_1000383 | 3300025303 | Bacteria | 62847 |
| 92 | Ga0209257_1000357 | 3300025304 | Bacteria | 93431 |
| 93 | Ga0207696_1000138 | 3300025711 | Bacteria | 127572 |
| 94 | Ga0207696_1000213 | 3300025711 | Bacteria | 87128 |
| 95 | Ga0207696_1001517 | 3300025711 | Bacteria | 12461 |
| 96 | Ga0207696_1004910 | 3300025711 | Bacteria | 5661 |
| 97 | Ga0207696_1005878 | 3300025711 | Bacteria | 5029 |
| 98 | Ga0207655_1000954 | 3300025728 | Bacteria | 29930 |
| 99 | Ga0207655_1003342 | 3300025728 | Bacteria | 12014 |
| 100 | Ga0207655_1003350 | 3300025728 | Bacteria | 11997 |
| 101 | Ga0207655_1004455 | 3300025728 | Bacteria | 9930 |
| 102 | Ga0207655_1044087 | 3300025728 | Bacteria | 1878 |
| 103 | Ga0207655_1086263 | 3300025728 | Bacteria | 1117 |
| 104 | Ga0207655_1170114 | 3300025728 | Bacteria | 673 |
| 105 | Ga0207713_1000078 | 3300025735 | Bacteria | 175087 |
| 106 | Ga0207713_1000080 | 3300025735 | Bacteria | 168403 |
| 107 | Ga0207713_1001355 | 3300025735 | Bacteria | 19964 |
| 108 | Ga0207713_1002469 | 3300025735 | Bacteria | 13448 |
| 109 | Ga0207713_1004556 | 3300025735 | Bacteria | 8973 |
| 110 | Ga0207713_1017757 | 3300025735 | Bacteria | 3549 |
| 111 | Ga0207713_1058630 | 3300025735 | Bacteria | 1482 |
| 112 | Ga0207713_1119592 | 3300025735 | Bacteria | 885 |
| 113 | Ga0207681_10002703 | 3300025923 | Bacteria | 11237 |
| 114 | Ga0207694_10318231 | 3300025924 | Bacteria | 1284 |
| 115 | Ga0207690_10783313 | 3300025932 | Bacteria | 787 |
| 116 | Ga0207706_10006616 | 3300025933 | Bacteria | 10731 |
| 117 | Ga0207709_10000189 | 3300025935 | Bacteria | 82404 |
| 118 | Ga0207709_10000872 | 3300025935 | Bacteria | 23023 |
| 119 | Ga0207712_10050565 | 3300025961 | Bacteria | 2902 |
| 120 | Ga0207678_11449954 | 3300026067 | Bacteria | 606 |
| 121 | Ga0209973_1041515 | 3300027252 | Unclassified | 675 |
| 122 | Ga0209371_1000232 | 3300027312 | Bacteria | 70412 |
| 123 | Ga0209996_1000737 | 3300027395 | Bacteria | 3902 |
| 124 | Ga0209995_1004792 | 3300027471 | Bacteria | 2173 |
| 125 | Ga0209968_1089703 | 3300027526 | Bacteria | 557 |
| 126 | Ga0209999_1050007 | 3300027543 | Bacteria | 789 |
| 127 | Ga0209982_1007213 | 3300027552 | Bacteria | 1624 |
| 128 | Ga0209983_1006766 | 3300027665 | Bacteria | 2352 |
| 129 | Ga0209971_1002809 | 3300027682 | Bacteria | 4162 |
| 130 | Ga0209974_10015914 | 3300027876 | Bacteria | 2497 |
| 131 | Ga0207428_10698270 | 3300027907 | Bacteria | 726 |
| 132 | Ga0268266_10023011 | 3300028379 | Bacteria | 5303 |
| 133 | Ga0268256_1000169 | 3300030500 | Bacteria | 81272 |
| 134 | Ga0307511_10082885 | 3300030521 | Bacteria | 2238 |
| 135 | Ga0307511_10264082 | 3300030521 | Bacteria | 813 |
| 136 | Ga0307408_100000020 | 3300031548 | Bacteria | 340408 |
| 137 | Ga0237819_01066 | 3300038705 | Bacteria | 8134 |
| 138 | Ga0436363_0395710 | 3300039450 | Bacteria | 2957 |
| 139 | Ga0439438_011224 | 3300041405 | Bacteria | 2799 |
| 140 | Ga0439447_000778 | 3300041407 | Bacteria | 11699 |
| 141 | Ga0439447_025955 | 3300041407 | Bacteria | 1506 |
| 142 | Ga0439466_0005240 | 3300041411 | Bacteria | 4965 |
| 143 | Ga0439466_0009049 | 3300041411 | Bacteria | 3739 |
| 144 | Ga0439466_0020295 | 3300041411 | Bacteria | 2368 |
| 145 | Ga0439445_0077619 | 3300042004 | Bacteria | 925 |
| 146 | Ga0439432_000220 | 3300042006 | Bacteria | 20561 |
| 147 | Ga0439452_000610 | 3300042010 | Bacteria | 18093 |
| 148 | Ga0439452_009024 | 3300042010 | Bacteria | 2965 |
| 149 | Ga0439455_0241271 | 3300042012 | Bacteria | 528 |
| 150 | Ga0439456_036070 | 3300042013 | Bacteria | 1066 |
| 151 | Ga0439456_127875 | 3300042013 | Bacteria | 585 |
| 152 | Ga0439463_004963 | 3300042016 | Bacteria | 3318 |
| 153 | Ga0439463_019638 | 3300042016 | Bacteria | 1683 |
| 154 | Ga0439463_085001 | 3300042016 | Bacteria | 814 |
| 155 | Ga0450911_001528 | 3300042115 | Bacteria | 5252 |
| 156 | Ga0450902_004872 | 3300042137 | Bacteria | 2010 |
| 157 | Ga0450902_015570 | 3300042137 | Bacteria | 1234 |
| 158 | Ga0450904_002812 | 3300042139 | Bacteria | 1983 |
| 159 | Ga0450905_028469 | 3300042142 | Bacteria | 852 |
| 160 | Ga0439464_0003742 | 3300042439 | Bacteria | 3861 |
| 161 | Ga0439460_0348601 | 3300042461 | Bacteria | 522 |
| 162 | Ga0450893_0001539 | 3300042532 | Bacteria | 3543 |
| 163 | Ga0450901_041431 | 3300042533 | Bacteria | 520 |
| 164 | Ga0495617_008360 | 3300046452 | Bacteria | 3570 |
| 165 | Ga0495617_028463 | 3300046452 | Bacteria | 1877 |
| 166 | Ga0495617_062862 | 3300046452 | Bacteria | 1226 |
| 167 | Ga0495617_078257 | 3300046452 | Bacteria | 1084 |
| 168 | Ga0495617_163761 | 3300046452 | Bacteria | 704 |
| 169 | Ga0495627_000953 | 3300046453 | Bacteria | 19856 |
| 170 | Ga0495627_001633 | 3300046453 | Bacteria | 12509 |
| 171 | Ga0495627_001765 | 3300046453 | Bacteria | 11626 |
| 172 | Ga0495627_038206 | 3300046453 | Bacteria | 1485 |
| 173 | Ga0495627_057684 | 3300046453 | Bacteria | 1154 |
| 174 | Ga0495627_157468 | 3300046453 | Bacteria | 632 |
| 175 | Ga0495591_000205 | 3300046458 | Bacteria | 60191 |
| 176 | Ga0495591_001566 | 3300046458 | Bacteria | 13931 |
| 177 | Ga0495591_001624 | 3300046458 | Bacteria | 13596 |
| 178 | Ga0495591_001930 | 3300046458 | Bacteria | 12142 |
| 179 | Ga0495591_003045 | 3300046458 | Bacteria | 8905 |
| 180 | Ga0495591_010727 | 3300046458 | Bacteria | 3525 |
| 181 | Ga0495591_022260 | 3300046458 | Bacteria | 2052 |
| 182 | Ga0495638_0002867 | 3300046460 | Bacteria | 13805 |
| 183 | Ga0495638_0018152 | 3300046460 | Bacteria | 4675 |
| 184 | Ga0495638_0039292 | 3300046460 | Bacteria | 3004 |
| 185 | Ga0495638_0370118 | 3300046460 | Bacteria | 751 |
| 186 | Ga0495653_0026756 | 3300046463 | Bacteria | 4622 |
| 187 | Ga0495653_0033640 | 3300046463 | Bacteria | 4059 |
| 188 | Ga0495650_0002459 | 3300046471 | Bacteria | 14936 |
| 189 | Ga0495650_0002495 | 3300046471 | Bacteria | 14777 |
| 190 | Ga0495650_0019040 | 3300046471 | Bacteria | 3392 |
| 191 | Ga0495650_0019226 | 3300046471 | Bacteria | 3372 |
| 192 | Ga0495650_0051365 | 3300046471 | Bacteria | 1699 |
| 193 | Ga0495650_0097187 | 3300046471 | Bacteria | 1110 |
| 194 | Ga0495605_0000909 | 3300046474 | Bacteria | 20347 |
| 195 | Ga0495605_0002004 | 3300046474 | Bacteria | 12877 |
| 196 | Ga0495605_0107017 | 3300046474 | Bacteria | 1279 |
| 197 | Ga0495584_0035313 | 3300046491 | Bacteria | 2527 |
| 198 | Ga0495584_0111830 | 3300046491 | Bacteria | 1382 |
| 199 | Ga0495584_0175866 | 3300046491 | Bacteria | 1088 |
| 200 | Ga0495584_0238552 | 3300046491 | Bacteria | 924 |
| 201 | Ga0495584_0523008 | 3300046491 | Bacteria | 604 |
| 202 | Ga0495585_0001101 | 3300046492 | Bacteria | 22238 |
| 203 | Ga0495585_0001554 | 3300046492 | Bacteria | 17806 |
| 204 | Ga0495585_0002369 | 3300046492 | Bacteria | 13524 |
| 205 | Ga0495585_0003939 | 3300046492 | Bacteria | 9818 |
| 206 | Ga0495585_0008256 | 3300046492 | Bacteria | 6321 |
| 207 | Ga0495585_0154832 | 3300046492 | Bacteria | 1193 |
| 208 | Ga0495596_0028451 | 3300046500 | Bacteria | 2244 |
| 209 | Ga0495596_0031249 | 3300046500 | Bacteria | 2128 |
| 210 | Ga0495596_0123131 | 3300046500 | Bacteria | 1006 |
| 211 | Ga0495607_0000288 | 3300046501 | Bacteria | 53438 |
| 212 | Ga0495607_0001843 | 3300046501 | Bacteria | 18048 |
| 213 | Ga0495607_0003902 | 3300046501 | Bacteria | 11232 |
| 214 | Ga0495607_0005045 | 3300046501 | Bacteria | 9577 |
| 215 | Ga0495607_0027538 | 3300046501 | Bacteria | 3512 |
| 216 | Ga0495607_0072145 | 3300046501 | Bacteria | 1923 |
| 217 | Ga0495607_0093372 | 3300046501 | Bacteria | 1625 |
| 218 | Ga0495607_0115698 | 3300046501 | Bacteria | 1415 |
| 219 | Ga0495607_0179871 | 3300046501 | Bacteria | 1061 |
| 220 | Ga0495583_0003204 | 3300046506 | Bacteria | 12808 |
| 221 | Ga0495583_0011870 | 3300046506 | Bacteria | 4972 |
| 222 | Ga0495606_0000151 | 3300046507 | Bacteria | 119548 |
| 223 | Ga0495606_0003494 | 3300046507 | Bacteria | 16641 |
| 224 | Ga0495606_0017942 | 3300046507 | Bacteria | 5325 |
| 225 | Ga0495606_0044797 | 3300046507 | Bacteria | 2939 |
| 226 | Ga0495606_0129613 | 3300046507 | Bacteria | 1500 |
| 227 | Ga0495610_0002277 | 3300046512 | Bacteria | 16214 |
| 228 | Ga0495610_0024792 | 3300046512 | Bacteria | 3231 |
| 229 | Ga0495610_0025389 | 3300046512 | Bacteria | 3181 |
| 230 | Ga0495610_0054372 | 3300046512 | Bacteria | 1934 |
| 231 | Ga0495610_0056210 | 3300046512 | Bacteria | 1893 |
| 232 | Ga0495610_0156452 | 3300046512 | Bacteria | 967 |
| 233 | Ga0495616_0001700 | 3300046513 | Bacteria | 15013 |
| 234 | Ga0495616_0001714 | 3300046513 | Bacteria | 14956 |
| 235 | Ga0495616_0011921 | 3300046513 | Bacteria | 4952 |
| 236 | Ga0495616_0399277 | 3300046513 | Bacteria | 565 |
| 237 | Ga0495620_0000454 | 3300046515 | Bacteria | 27182 |
| 238 | Ga0495620_0000851 | 3300046515 | Bacteria | 18847 |
| 239 | Ga0495620_0001961 | 3300046515 | Bacteria | 12055 |
| 240 | Ga0495620_0009088 | 3300046515 | Bacteria | 5302 |
| 241 | Ga0495620_0029795 | 3300046515 | Bacteria | 2521 |
| 242 | Ga0495620_0415860 | 3300046515 | Bacteria | 509 |
| 243 | Ga0495628_0064323 | 3300046516 | Bacteria | 2872 |
| 244 | Ga0495630_0002286 | 3300046517 | Bacteria | 13336 |
| 245 | Ga0495630_0006836 | 3300046517 | Bacteria | 8131 |
| 246 | Ga0495631_0000488 | 3300046518 | Bacteria | 26555 |
| 247 | Ga0495631_0001163 | 3300046518 | Bacteria | 16265 |
| 248 | Ga0495631_0002717 | 3300046518 | Bacteria | 9815 |
| 249 | Ga0495631_0045294 | 3300046518 | Bacteria | 1937 |
| 250 | Ga0495631_0119549 | 3300046518 | Bacteria | 1133 |
| 251 | Ga0495631_0191065 | 3300046518 | Bacteria | 876 |
| 252 | Ga0495632_0001292 | 3300046519 | Bacteria | 21166 |
| 253 | Ga0495632_0005155 | 3300046519 | Bacteria | 8717 |
| 254 | Ga0495632_0010935 | 3300046519 | Bacteria | 5326 |
| 255 | Ga0495632_0016059 | 3300046519 | Bacteria | 4175 |
| 256 | Ga0495632_0016134 | 3300046519 | Bacteria | 4164 |
| 257 | Ga0495632_0040405 | 3300046519 | Bacteria | 2349 |
| 258 | Ga0495632_0085935 | 3300046519 | Bacteria | 1496 |
| 259 | Ga0495632_0105329 | 3300046519 | Bacteria | 1327 |
| 260 | Ga0495632_0117470 | 3300046519 | Bacteria | 1245 |
| 261 | Ga0495632_0128774 | 3300046519 | Bacteria | 1179 |
| 262 | Ga0495632_0235788 | 3300046519 | Bacteria | 824 |
| 263 | Ga0495637_0001989 | 3300046520 | Bacteria | 11563 |
| 264 | Ga0495637_0005094 | 3300046520 | Bacteria | 6741 |
| 265 | Ga0495637_0008309 | 3300046520 | Bacteria | 5104 |
| 266 | Ga0495637_0016433 | 3300046520 | Bacteria | 3458 |
| 267 | Ga0495637_0016709 | 3300046520 | Bacteria | 3428 |
| 268 | Ga0495637_0093469 | 3300046520 | Bacteria | 1183 |
| 269 | Ga0495637_0118538 | 3300046520 | Bacteria | 1020 |
| 270 | Ga0495637_0202656 | 3300046520 | Bacteria | 728 |
| 271 | Ga0495643_0005003 | 3300046522 | Bacteria | 9086 |
| 272 | Ga0495643_0013306 | 3300046522 | Bacteria | 4928 |
| 273 | Ga0495643_0038767 | 3300046522 | Bacteria | 2608 |
| 274 | Ga0495643_0153990 | 3300046522 | Bacteria | 1136 |
| 275 | Ga0495643_0158373 | 3300046522 | Bacteria | 1116 |
| 276 | Ga0495643_0184883 | 3300046522 | Bacteria | 1010 |
| 277 | Ga0495648_0003731 | 3300046524 | Bacteria | 13287 |
| 278 | Ga0495648_0003891 | 3300046524 | Bacteria | 12947 |
| 279 | Ga0495648_0006276 | 3300046524 | Bacteria | 9725 |
| 280 | Ga0495648_0038739 | 3300046524 | Bacteria | 3043 |
| 281 | Ga0495648_0092969 | 3300046524 | Bacteria | 1683 |
| 282 | Ga0495648_0144797 | 3300046524 | Bacteria | 1246 |
| 283 | Ga0495666_0001124 | 3300046526 | Bacteria | 12812 |
| 284 | Ga0495666_0083132 | 3300046526 | Bacteria | 1513 |
| 285 | Ga0495654_0000405 | 3300046530 | Bacteria | 36817 |
| 286 | Ga0495654_0001918 | 3300046530 | Bacteria | 13798 |
| 287 | Ga0495654_0002652 | 3300046530 | Bacteria | 11375 |
| 288 | Ga0495654_0003715 | 3300046530 | Bacteria | 9262 |
| 289 | Ga0495654_0005089 | 3300046530 | Bacteria | 7689 |
| 290 | Ga0495654_0030526 | 3300046530 | Bacteria | 2741 |
| 291 | Ga0495654_0061166 | 3300046530 | Bacteria | 1809 |
| 292 | Ga0495654_0113263 | 3300046530 | Bacteria | 1235 |
| 293 | Ga0495654_0159504 | 3300046530 | Bacteria | 991 |
| 294 | Ga0495654_0237459 | 3300046530 | Bacteria | 764 |
| 295 | Ga0495665_0149609 | 3300046531 | Bacteria | 1219 |
| 296 | Ga0495587_0011114 | 3300046536 | Bacteria | 5710 |
| 297 | Ga0495587_0094872 | 3300046536 | Bacteria | 1722 |
| 298 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 299 | Ga0495609_0001176 | 3300046538 | Bacteria | 18064 |
| 300 | Ga0495609_0008391 | 3300046538 | Bacteria | 5061 |
| 301 | Ga0495609_0010324 | 3300046538 | Bacteria | 4483 |
| 302 | Ga0495609_0011794 | 3300046538 | Bacteria | 4155 |
| 303 | Ga0495609_0079386 | 3300046538 | Bacteria | 1435 |
| 304 | Ga0495609_0145650 | 3300046538 | Bacteria | 1009 |
| 305 | Ga0495609_0316665 | 3300046538 | Bacteria | 633 |
| 306 | Ga0495597_0003333 | 3300046542 | Bacteria | 9467 |
| 307 | Ga0495597_0054361 | 3300046542 | Bacteria | 1759 |
| 308 | Ga0495597_0110888 | 3300046542 | Bacteria | 1150 |
| 309 | Ga0495645_0770889 | 3300046543 | Bacteria | 579 |
| 310 | Ga0495633_0004331 | 3300046558 | Bacteria | 9060 |
| 311 | Ga0495668_0005345 | 3300046616 | Bacteria | 8758 |
| 312 | Ga0495668_0022695 | 3300046616 | Bacteria | 3586 |
| 313 | Ga0495668_0059904 | 3300046616 | Bacteria | 2100 |
| 314 | Ga0495634_0002180 | 3300046642 | Bacteria | 16448 |
| 315 | Ga0495611_0080023 | 3300046648 | Bacteria | 1501 |
| 316 | Ga0495625_0005248 | 3300046660 | Bacteria | 11916 |
| 317 | Ga0495625_0006726 | 3300046660 | Bacteria | 10184 |
| 318 | Ga0495625_0125222 | 3300046660 | Bacteria | 1745 |
| 319 | Ga0495625_0136127 | 3300046660 | Bacteria | 1660 |
| 320 | Ga0495625_0217840 | 3300046660 | Bacteria | 1252 |
| 321 | Ga0495635_0000990 | 3300046663 | Bacteria | 18718 |
| 322 | Ga0495661_0001172 | 3300046665 | Bacteria | 22850 |
| 323 | Ga0495661_0012125 | 3300046665 | Bacteria | 5825 |
| 324 | Ga0495661_0015712 | 3300046665 | Bacteria | 5045 |
| 325 | Ga0495661_0025451 | 3300046665 | Bacteria | 3822 |
| 326 | Ga0495661_0190312 | 3300046665 | Bacteria | 1081 |
| 327 | Ga0495661_0218193 | 3300046665 | Bacteria | 989 |
| 328 | Ga0495657_0030373 | 3300046675 | Bacteria | 3785 |
| 329 | Ga0495599_0105225 | 3300046678 | Bacteria | 1758 |
| 330 | Ga0495623_0001930 | 3300046679 | Bacteria | 13925 |
| 331 | Ga0495623_0005963 | 3300046679 | Bacteria | 7939 |
| 332 | Ga0495646_0021532 | 3300046680 | Bacteria | 4071 |
| 333 | Ga0495613_0095020 | 3300046689 | Bacteria | 2156 |
| 334 | Ga0495624_0775076 | 3300046690 | Bacteria | 567 |
| 335 | Ga0495670_0210594 | 3300046691 | Bacteria | 1031 |
| 336 | Ga0495671_0002745 | 3300046692 | Bacteria | 11024 |
| 337 | Ga0495671_0018697 | 3300046692 | Bacteria | 3674 |
| 338 | Ga0495671_0027476 | 3300046692 | Bacteria | 2939 |
| 339 | Ga0495671_0089641 | 3300046692 | Bacteria | 1506 |
| 340 | Ga0495671_0124778 | 3300046692 | Bacteria | 1255 |
| 341 | Ga0495671_0313712 | 3300046692 | Bacteria | 753 |
| 342 | Ga0495671_0548392 | 3300046692 | Bacteria | 550 |
| 343 | Ga0495671_0613012 | 3300046692 | Bacteria | 517 |
| 344 | Ga0495671_0637218 | 3300046692 | Bacteria | 506 |
| 345 | Ga0495649_0003038 | 3300046694 | Bacteria | 11507 |
| 346 | Ga0495649_0004810 | 3300046694 | Bacteria | 8744 |
| 347 | Ga0495649_0008852 | 3300046694 | Bacteria | 6027 |
| 348 | Ga0495649_0020971 | 3300046694 | Bacteria | 3662 |
| 349 | Ga0495649_0022909 | 3300046694 | Bacteria | 3491 |
| 350 | Ga0495649_0073760 | 3300046694 | Bacteria | 1828 |
| 351 | Ga0495649_0176158 | 3300046694 | Bacteria | 1117 |
| 352 | Ga0495589_0001025 | 3300046794 | Bacteria | 16878 |
| 353 | Ga0495589_0300142 | 3300046794 | Bacteria | 744 |
| 354 | Ga0495600_0102592 | 3300046809 | Bacteria | 1864 |
| 355 | Ga0495600_0715641 | 3300046809 | Bacteria | 601 |
| 356 | Ga0495660_0002035 | 3300046810 | Bacteria | 13141 |
| 357 | Ga0495660_0002728 | 3300046810 | Bacteria | 11144 |
| 358 | Ga0495660_0003972 | 3300046810 | Bacteria | 9028 |
| 359 | Ga0495660_0004059 | 3300046810 | Bacteria | 8941 |
| 360 | Ga0495660_0005931 | 3300046810 | Bacteria | 7276 |
| 361 | Ga0495660_0016581 | 3300046810 | Bacteria | 4247 |
| 362 | Ga0495660_0020852 | 3300046810 | Bacteria | 3756 |
| 363 | Ga0495660_0056103 | 3300046810 | Bacteria | 2130 |
| 364 | Ga0495660_0198847 | 3300046810 | Bacteria | 958 |
| 365 | Ga0495604_0014914 | 3300047317 | Bacteria | 6199 |
| 366 | Ga0495604_0178984 | 3300047317 | Bacteria | 1484 |
| 367 | Ga0495674_0003856 | 3300047319 | Bacteria | 14564 |
| 368 | Ga0495672_0002299 | 3300047320 | Bacteria | 17724 |
| 369 | Ga0495672_0007113 | 3300047320 | Bacteria | 8479 |
| 370 | Ga0495672_0050040 | 3300047320 | Bacteria | 2470 |
| 371 | Ga0495672_0197415 | 3300047320 | Bacteria | 1008 |
| 372 | Ga0495676_0003312 | 3300047321 | Bacteria | 14561 |
| 373 | Ga0495680_0025280 | 3300047322 | Bacteria | 4917 |
| 374 | Ga0495680_0121427 | 3300047322 | Bacteria | 1928 |
| 375 | Ga0495683_0000806 | 3300047323 | Bacteria | 22310 |
| 376 | Ga0495683_0146394 | 3300047323 | Bacteria | 1103 |
| 377 | Ga0495683_0185090 | 3300047323 | Bacteria | 948 |
| 378 | Ga0495675_0081868 | 3300047444 | Bacteria | 2032 |
| 379 | Ga0495679_001860 | 3300047446 | Bacteria | 11364 |
| 380 | Ga0495679_002188 | 3300047446 | Bacteria | 10231 |
| 381 | Ga0495679_003492 | 3300047446 | Bacteria | 7525 |
| 382 | Ga0495679_005331 | 3300047446 | Bacteria | 5716 |
| 383 | Ga0495679_006441 | 3300047446 | Bacteria | 5052 |
| 384 | Ga0495679_067388 | 3300047446 | Bacteria | 1037 |
| 385 | Ga0495673_0001688 | 3300047469 | Bacteria | 16955 |
| 386 | Ga0495673_0003362 | 3300047469 | Bacteria | 10583 |
| 387 | Ga0495673_0004551 | 3300047469 | Bacteria | 8653 |
| 388 | Ga0495673_0004808 | 3300047469 | Bacteria | 8360 |
| 389 | Ga0495673_0007851 | 3300047469 | Bacteria | 6069 |
| 390 | Ga0495673_0009883 | 3300047469 | Bacteria | 5237 |
| 391 | Ga0495673_0103092 | 3300047469 | Bacteria | 1150 |
| 392 | Ga0495673_0149182 | 3300047469 | Bacteria | 905 |
| 393 | Ga0495673_0254076 | 3300047469 | Bacteria | 641 |
| 394 | Ga0495681_0001617 | 3300047470 | Bacteria | 16762 |
| 395 | Ga0495681_0001778 | 3300047470 | Bacteria | 15885 |
| 396 | Ga0495681_0005183 | 3300047470 | Bacteria | 8766 |
| 397 | Ga0495681_0012153 | 3300047470 | Bacteria | 5073 |
| 398 | Ga0495681_0013285 | 3300047470 | Bacteria | 4786 |
| 399 | Ga0495681_0018533 | 3300047470 | Bacteria | 3833 |
| 400 | Ga0495681_0110650 | 3300047470 | Bacteria | 1190 |
| 401 | Ga0495681_0213729 | 3300047470 | Bacteria | 776 |
| 402 | Ga0495681_0393180 | 3300047470 | Bacteria | 520 |
| 403 | Ga0495684_0032714 | 3300047471 | Bacteria | 3994 |
| 404 | Ga0495686_0004004 | 3300047472 | Bacteria | 12328 |
| 405 | Ga0495686_0005736 | 3300047472 | Bacteria | 9706 |
| 406 | Ga0495593_0003875 | 3300047673 | Bacteria | 8939 |
| 407 | Ga0495593_0088352 | 3300047673 | Bacteria | 1597 |
| 408 | Ga0495602_0323493 | 3300048088 | Bacteria | 1121 |
| 409 | Ga0495626_0002705 | 3300048091 | Bacteria | 11975 |
| 410 | Ga0495626_0025110 | 3300048091 | Bacteria | 2916 |
| 411 | Ga0495626_0038765 | 3300048091 | Bacteria | 2257 |
| 412 | Ga0495626_0106584 | 3300048091 | Bacteria | 1217 |
| 413 | Ga0495626_0129897 | 3300048091 | Bacteria | 1076 |
| 414 | Ga0495626_0280265 | 3300048091 | Bacteria | 662 |
| 415 | Ga0495626_0389683 | 3300048091 | Bacteria | 539 |
| 416 | Ga0495626_0389688 | 3300048091 | Bacteria | 539 |
| 417 | Ga0496100_0647955 | 3300048903 | Bacteria | 822 |
| 418 | Ga0496102_0000897 | 3300048905 | Bacteria | 28235 |
| 419 | Ga0496102_0030996 | 3300048905 | Bacteria | 4791 |
| 420 | Ga0496103_0001672 | 3300048906 | Bacteria | 14511 |
| 421 | Ga0496106_0145919 | 3300048909 | Bacteria | 1864 |
| 422 | Ga0496106_0546602 | 3300048909 | Bacteria | 929 |
| 423 | Ga0496110_0793118 | 3300048913 | Bacteria | 851 |
| 424 | Ga0496112_0247958 | 3300048915 | Bacteria | 1732 |
| 425 | Ga0496115_0052124 | 3300048918 | Bacteria | 3282 |
| 426 | Ga0496116_0003051 | 3300048919 | Bacteria | 16928 |
| 427 | Ga0496116_0004738 | 3300048919 | Bacteria | 12845 |
| 428 | Ga0496116_0006230 | 3300048919 | Bacteria | 10884 |
| 429 | Ga0496116_0008850 | 3300048919 | Bacteria | 8666 |
| 430 | Ga0496116_0031227 | 3300048919 | Bacteria | 3818 |
| 431 | Ga0496116_0319835 | 3300048919 | Bacteria | 727 |
| 432 | Ga0496117_0000951 | 3300048920 | Bacteria | 44280 |
| 433 | Ga0496117_0004144 | 3300048920 | Bacteria | 16212 |
| 434 | Ga0496117_0005741 | 3300048920 | Bacteria | 12893 |
| 435 | Ga0496117_0041041 | 3300048920 | Bacteria | 3395 |
| 436 | Ga0496117_0068092 | 3300048920 | Bacteria | 2405 |
| 437 | Ga0496117_0098018 | 3300048920 | Bacteria | 1865 |
| 438 | Ga0496117_0548787 | 3300048920 | Bacteria | 550 |
| 439 | Ga0496118_0009822 | 3300048921 | Bacteria | 9579 |
| 440 | Ga0496118_0010381 | 3300048921 | Bacteria | 9231 |
| 441 | Ga0496118_0011218 | 3300048921 | Bacteria | 8773 |
| 442 | Ga0496118_0024388 | 3300048921 | Bacteria | 5220 |
| 443 | Ga0496118_0329770 | 3300048921 | Bacteria | 823 |
| 444 | Ga0496118_0392202 | 3300048921 | Bacteria | 724 |
| 445 | Ga0496118_0402525 | 3300048921 | Bacteria | 710 |
| 446 | Ga0496118_0553311 | 3300048921 | Bacteria | 560 |
| 447 | Ga0496118_0570411 | 3300048921 | Bacteria | 547 |
| 448 | Ga0496119_0100806 | 3300048922 | Bacteria | 1621 |
| 449 | Ga0496120_0106027 | 3300048923 | Bacteria | 1476 |
| 450 | Ga0496121_0000518 | 3300048924 | Bacteria | 73428 |
| 451 | Ga0496121_0001706 | 3300048924 | Bacteria | 36029 |
| 452 | Ga0496121_0002316 | 3300048924 | Bacteria | 29512 |
| 453 | Ga0496121_0008345 | 3300048924 | Bacteria | 12230 |
| 454 | Ga0496121_0103203 | 3300048924 | Bacteria | 2194 |
| 455 | Ga0496121_0404638 | 3300048924 | Bacteria | 893 |
| 456 | Ga0496121_0557515 | 3300048924 | Bacteria | 715 |
| 457 | Ga0496122_0004139 | 3300048925 | Bacteria | 18319 |
| 458 | Ga0496122_0011827 | 3300048925 | Bacteria | 8775 |
| 459 | Ga0496122_0092796 | 3300048925 | Bacteria | 2050 |
| 460 | Ga0496122_0143126 | 3300048925 | Bacteria | 1491 |
| 461 | Ga0496123_0003178 | 3300048926 | Bacteria | 18749 |
| 462 | Ga0496123_0007295 | 3300048926 | Bacteria | 10487 |
| 463 | Ga0496123_0019576 | 3300048926 | Bacteria | 5331 |
| 464 | Ga0496123_0063397 | 3300048926 | Bacteria | 2361 |
| 465 | Ga0496124_0002322 | 3300048927 | Bacteria | 25089 |
| 466 | Ga0496124_0017209 | 3300048927 | Bacteria | 6823 |
| 467 | Ga0496124_0032254 | 3300048927 | Bacteria | 4627 |
| 468 | Ga0496124_0232404 | 3300048927 | Bacteria | 1377 |
| 469 | Ga0496124_0416324 | 3300048927 | Bacteria | 928 |
| 470 | Ga0496125_0009805 | 3300048928 | Bacteria | 9761 |
| 471 | Ga0496125_0030832 | 3300048928 | Bacteria | 4788 |
| 472 | Ga0496125_0044646 | 3300048928 | Bacteria | 3743 |
| 473 | Ga0496125_0596905 | 3300048928 | Bacteria | 603 |
| 474 | Ga0496126_0265634 | 3300048929 | Bacteria | 1426 |
| 475 | Ga0496126_0429391 | 3300048929 | Bacteria | 1067 |
| 476 | Ga0496126_1388555 | 3300048929 | Bacteria | 507 |
| 477 | Ga0495678_001621 | 3300049459 | Bacteria | 17159 |
| 478 | Ga0495678_002275 | 3300049459 | Bacteria | 13325 |
| 479 | Ga0495678_008845 | 3300049459 | Bacteria | 5035 |
| 480 | Ga0495678_018141 | 3300049459 | Bacteria | 3171 |
| 481 | Ga0495678_090654 | 3300049459 | Bacteria | 1077 |
| 482 | Ga0495682_0001846 | 3300049460 | Bacteria | 10628 |
| 483 | Ga0495682_0010148 | 3300049460 | Bacteria | 3657 |
| 484 | Ga0495682_0064900 | 3300049460 | Bacteria | 1316 |
| 485 | nmdc:mga00v17_976641_c1 | 3300050491 | Bacteria | 534 |
| 486 | nmdc:mga08x19_162920_c1 | 3300050514 | Bacteria | 1515 |
| 487 | Ga0500572_000925 | 3300053111 | Bacteria | 9055 |
| 488 | 2600443358 | 2600254954 | Bacteria | 5100516 |
| 489 | 2602009178 | 2600255389 | Bacteria | 5275336 |
| 490 | 2919501703 | 2919501602 | Bacteria | 5286340 |
| 491 | 2926063376 | 2926063275 | Bacteria | 5285848 |
| 492 | 3007255935 | 3007252601 | Bacteria | 4559114 |
| 493 | 3007319993 | 3007315729 | Bacteria | 5076637 |
| 494 | 8034962950 | 8034962539 | Bacteria | 4884839 |
| 495 | Ga0182008_10038544 | |||
| 496 | JGI25163J39215_1000219 | |||
| 497 | JGI25164J39214_1000160 | |||
| 498 | JGI25165J46597_1000290 | |||
| 499 | rootH1_10184217 | |||
| 500 | JGI26143J51219_1001913 | |||
| 501 | Ga0055525_1004420 | |||
| 502 | Ga0055536_1000831 | |||
| 503 | Ga0055530_10001294 | |||
| 504 | Ga0055540_1000277 | |||
| 505 | Ga0055531_10000123 | |||
| 506 | Ga0065714_10292984 | |||
| 507 | Ga0065714_10324050 | |||
| 508 | Ga0065704_10272377 | |||
| 509 | Ga0065704_10332961 | |||
| 510 | Ga0070669_100016874 | |||
| 511 | Ga0070663_100643430 | |||
| 512 | Ga0070662_100006388 | |||
| 513 | Ga0070684_102310428 | |||
| 514 | Ga0070665_100135885 | |||
| 515 | Ga0068855_102447657 | |||
| 516 | Ga0075432_10333871 | |||
| 517 | Ga0075362_10069147 | |||
| 518 | Ga0075362_10198328 | |||
| 519 | Ga0075436_100285929 | |||
| 520 | Ga0105251_10005928 | |||
| 521 | Ga0105251_10014133 | |||
| 522 | Ga0105244_10002038 | |||
| 523 | Ga0105244_10003864 | |||
| 524 | Ga0105244_10008293 | |||
| 525 | Ga0105244_10008504 | |||
| 526 | Ga0105244_10185560 | |||
| 527 | Ga0105244_10244717 | |||
| 528 | Ga0105244_10357175 | |||
| 529 | Ga0105244_10367224 | |||
| 530 | Ga0105250_10000637 | |||
| 531 | Ga0105250_10002425 | |||
| 532 | Ga0105250_10004161 | |||
| 533 | Ga0105250_10007509 | |||
| 534 | Ga0105250_10016955 | |||
| 535 | Ga0105247_10789102 | |||
| 536 | Ga0105243_10000335 | |||
| 537 | Ga0105238_12619295 | |||
| 538 | Ga0105249_10048077 | |||
| 539 | Ga0105246_10000484 | |||
| 540 | Ga0157345_1000093 | |||
| 541 | Ga0157373_10024960 | |||
| 542 | Ga0157373_10031898 | |||
| 543 | Ga0157373_10127924 | |||
| 544 | Ga0157371_10001483 | |||
| 545 | Ga0157371_10013719 | |||
| 546 | Ga0157371_10080369 | |||
| 547 | Ga0157371_10891076 | |||
| 548 | Ga0157370_10082381 | |||
| 549 | Ga0157370_10275500 | |||
| 550 | Ga0157370_10371403 | |||
| 551 | Ga0157370_10812084 | |||
| 552 | Ga0157370_11257937 | |||
| 553 | Ga0157369_10080665 | |||
| 554 | Ga0157369_11622259 | |||
| 555 | Ga0163162_10420602 | |||
| 556 | Ga0157372_10005543 | |||
| 557 | Ga0157375_10002693 | |||
| 558 | Ga0157375_10207106 | |||
| 559 | Ga0182008_10027585 | |||
| 560 | Ga0182008_10093506 | |||
| 561 | Ga0182008_10094922 | |||
| 562 | Ga0182006_1001263 | |||
| 563 | Ga0182006_1005730 | |||
| 564 | Ga0182006_1007576 | |||
| 565 | Ga0182006_1011993 | |||
| 566 | Ga0182006_1062211 | |||
| 567 | Ga0182007_10394185 | |||
| 568 | Ga0182005_1010587 | |||
| 569 | Ga0182005_1050625 | |||
| 570 | Ga0182005_1082582 | |||
| 571 | Ga0182005_1084976 | |||
| 572 | Ga0182005_1282369 | |||
| 573 | Ga0163161_10312678 | |||
| 574 | Ga0163161_10564864 | |||
| 575 | Ga0163161_10866091 | |||
| 576 | Ga0209760_100258 | |||
| 577 | Ga0209563_100745 | |||
| 578 | Ga0207427_100007 | |||
| 579 | Ga0209437_100006 | |||
| 580 | Ga0209233_1000059 | |||
| 581 | Ga0209675_1004773 | |||
| 582 | Ga0209676_1000010 | |||
| 583 | Ga0209676_1000350 | |||
| 584 | Ga0209050_1000019 | |||
| 585 | Ga0209051_1000383 | |||
| 586 | Ga0209257_1000357 | |||
| 587 | Ga0207696_1000138 | |||
| 588 | Ga0207696_1000213 | |||
| 589 | Ga0207696_1001517 | |||
| 590 | Ga0207696_1004910 | |||
| 591 | Ga0207696_1005878 | |||
| 592 | Ga0207655_1000954 | |||
| 593 | Ga0207655_1003342 | |||
| 594 | Ga0207655_1003350 | |||
| 595 | Ga0207655_1004455 | |||
| 596 | Ga0207655_1044087 | |||
| 597 | Ga0207655_1086263 | |||
| 598 | Ga0207655_1170114 | |||
| 599 | Ga0207713_1000078 | |||
| 600 | Ga0207713_1000080 | |||
| 601 | Ga0207713_1001355 | |||
| 602 | Ga0207713_1002469 | |||
| 603 | Ga0207713_1004556 | |||
| 604 | Ga0207713_1017757 | |||
| 605 | Ga0207713_1058630 | |||
| 606 | Ga0207713_1119592 | |||
| 607 | Ga0207681_10002703 | |||
| 608 | Ga0207694_10318231 | |||
| 609 | Ga0207690_10783313 | |||
| 610 | Ga0207706_10006616 | |||
| 611 | Ga0207709_10000189 | |||
| 612 | Ga0207709_10000872 | |||
| 613 | Ga0207712_10050565 | |||
| 614 | Ga0207678_11449954 | |||
| 615 | Ga0209973_1041515 | |||
| 616 | Ga0209371_1000232 | |||
| 617 | Ga0209996_1000737 | |||
| 618 | Ga0209995_1004792 | |||
| 619 | Ga0209968_1089703 | |||
| 620 | Ga0209999_1050007 | |||
| 621 | Ga0209982_1007213 | |||
| 622 | Ga0209983_1006766 | |||
| 623 | Ga0209971_1002809 | |||
| 624 | Ga0209974_10015914 | |||
| 625 | Ga0207428_10698270 | |||
| 626 | Ga0268266_10023011 | |||
| 627 | Ga0268256_1000169 | |||
| 628 | Ga0307511_10082885 | |||
| 629 | Ga0307511_10264082 | |||
| 630 | Ga0307408_100000020 | |||
| 631 | Ga0237819_01066 | |||
| 632 | Ga0436363_0395710 | |||
| 633 | Ga0439438_011224 | |||
| 634 | Ga0439447_000778 | |||
| 635 | Ga0439447_025955 | |||
| 636 | Ga0439466_0005240 | |||
| 637 | Ga0439466_0009049 | |||
| 638 | Ga0439466_0020295 | |||
| 639 | Ga0439445_0077619 | |||
| 640 | Ga0439432_000220 | |||
| 641 | Ga0439452_000610 | |||
| 642 | Ga0439452_009024 | |||
| 643 | Ga0439455_0241271 | |||
| 644 | Ga0439456_036070 | |||
| 645 | Ga0439456_127875 | |||
| 646 | Ga0439463_004963 | |||
| 647 | Ga0439463_019638 | |||
| 648 | Ga0439463_085001 | |||
| 649 | Ga0450911_001528 | |||
| 650 | Ga0450902_004872 | |||
| 651 | Ga0450902_015570 | |||
| 652 | Ga0450904_002812 | |||
| 653 | Ga0450905_028469 | |||
| 654 | Ga0439464_0003742 | |||
| 655 | Ga0439460_0348601 | |||
| 656 | Ga0450893_0001539 | |||
| 657 | Ga0450901_041431 | |||
| 658 | Ga0495617_008360 | |||
| 659 | Ga0495617_028463 | |||
| 660 | Ga0495617_062862 | |||
| 661 | Ga0495617_078257 | |||
| 662 | Ga0495617_163761 | |||
| 663 | Ga0495627_000953 | |||
| 664 | Ga0495627_001633 | |||
| 665 | Ga0495627_001765 | |||
| 666 | Ga0495627_038206 | |||
| 667 | Ga0495627_057684 | |||
| 668 | Ga0495627_157468 | |||
| 669 | Ga0495591_000205 | |||
| 670 | Ga0495591_001566 | |||
| 671 | Ga0495591_001624 | |||
| 672 | Ga0495591_001930 | |||
| 673 | Ga0495591_003045 | |||
| 674 | Ga0495591_010727 | |||
| 675 | Ga0495591_022260 | |||
| 676 | Ga0495638_0002867 | |||
| 677 | Ga0495638_0018152 | |||
| 678 | Ga0495638_0039292 | |||
| 679 | Ga0495638_0370118 | |||
| 680 | Ga0495653_0026756 | |||
| 681 | Ga0495653_0033640 | |||
| 682 | Ga0495650_0002459 | |||
| 683 | Ga0495650_0002495 | |||
| 684 | Ga0495650_0019040 | |||
| 685 | Ga0495650_0019226 | |||
| 686 | Ga0495650_0051365 | |||
| 687 | Ga0495650_0097187 | |||
| 688 | Ga0495605_0000909 | |||
| 689 | Ga0495605_0002004 | |||
| 690 | Ga0495605_0107017 | |||
| 691 | Ga0495584_0035313 | |||
| 692 | Ga0495584_0111830 | |||
| 693 | Ga0495584_0175866 | |||
| 694 | Ga0495584_0238552 | |||
| 695 | Ga0495584_0523008 | |||
| 696 | Ga0495585_0001101 | |||
| 697 | Ga0495585_0001554 | |||
| 698 | Ga0495585_0002369 | |||
| 699 | Ga0495585_0003939 | |||
| 700 | Ga0495585_0008256 | |||
| 701 | Ga0495585_0154832 | |||
| 702 | Ga0495596_0028451 | |||
| 703 | Ga0495596_0031249 | |||
| 704 | Ga0495596_0123131 | |||
| 705 | Ga0495607_0000288 | |||
| 706 | Ga0495607_0001843 | |||
| 707 | Ga0495607_0003902 | |||
| 708 | Ga0495607_0005045 | |||
| 709 | Ga0495607_0027538 | |||
| 710 | Ga0495607_0072145 | |||
| 711 | Ga0495607_0093372 | |||
| 712 | Ga0495607_0115698 | |||
| 713 | Ga0495607_0179871 | |||
| 714 | Ga0495583_0003204 | |||
| 715 | Ga0495583_0011870 | |||
| 716 | Ga0495606_0000151 | |||
| 717 | Ga0495606_0003494 | |||
| 718 | Ga0495606_0017942 | |||
| 719 | Ga0495606_0044797 | |||
| 720 | Ga0495606_0129613 | |||
| 721 | Ga0495610_0002277 | |||
| 722 | Ga0495610_0024792 | |||
| 723 | Ga0495610_0025389 | |||
| 724 | Ga0495610_0054372 | |||
| 725 | Ga0495610_0056210 | |||
| 726 | Ga0495610_0156452 | |||
| 727 | Ga0495616_0001700 | |||
| 728 | Ga0495616_0001714 | |||
| 729 | Ga0495616_0011921 | |||
| 730 | Ga0495616_0399277 | |||
| 731 | Ga0495620_0000454 | |||
| 732 | Ga0495620_0000851 | |||
| 733 | Ga0495620_0001961 | |||
| 734 | Ga0495620_0009088 | |||
| 735 | Ga0495620_0029795 | |||
| 736 | Ga0495620_0415860 | |||
| 737 | Ga0495628_0064323 | |||
| 738 | Ga0495630_0002286 | |||
| 739 | Ga0495630_0006836 | |||
| 740 | Ga0495631_0000488 | |||
| 741 | Ga0495631_0001163 | |||
| 742 | Ga0495631_0002717 | |||
| 743 | Ga0495631_0045294 | |||
| 744 | Ga0495631_0119549 | |||
| 745 | Ga0495631_0191065 | |||
| 746 | Ga0495632_0001292 | |||
| 747 | Ga0495632_0005155 | |||
| 748 | Ga0495632_0010935 | |||
| 749 | Ga0495632_0016059 | |||
| 750 | Ga0495632_0016134 | |||
| 751 | Ga0495632_0040405 | |||
| 752 | Ga0495632_0085935 | |||
| 753 | Ga0495632_0105329 | |||
| 754 | Ga0495632_0117470 | |||
| 755 | Ga0495632_0128774 | |||
| 756 | Ga0495632_0235788 | |||
| 757 | Ga0495637_0001989 | |||
| 758 | Ga0495637_0005094 | |||
| 759 | Ga0495637_0008309 | |||
| 760 | Ga0495637_0016433 | |||
| 761 | Ga0495637_0016709 | |||
| 762 | Ga0495637_0093469 | |||
| 763 | Ga0495637_0118538 | |||
| 764 | Ga0495637_0202656 | |||
| 765 | Ga0495643_0005003 | |||
| 766 | Ga0495643_0013306 | |||
| 767 | Ga0495643_0038767 | |||
| 768 | Ga0495643_0153990 | |||
| 769 | Ga0495643_0158373 | |||
| 770 | Ga0495643_0184883 | |||
| 771 | Ga0495648_0003731 | |||
| 772 | Ga0495648_0003891 | |||
| 773 | Ga0495648_0006276 | |||
| 774 | Ga0495648_0038739 | |||
| 775 | Ga0495648_0092969 | |||
| 776 | Ga0495648_0144797 | |||
| 777 | Ga0495666_0001124 | |||
| 778 | Ga0495666_0083132 | |||
| 779 | Ga0495654_0000405 | |||
| 780 | Ga0495654_0001918 | |||
| 781 | Ga0495654_0002652 | |||
| 782 | Ga0495654_0003715 | |||
| 783 | Ga0495654_0005089 | |||
| 784 | Ga0495654_0030526 | |||
| 785 | Ga0495654_0061166 | |||
| 786 | Ga0495654_0113263 | |||
| 787 | Ga0495654_0159504 | |||
| 788 | Ga0495654_0237459 | |||
| 789 | Ga0495665_0149609 | |||
| 790 | Ga0495587_0011114 | |||
| 791 | Ga0495587_0094872 | |||
| 792 | Ga0495609_0000006 | |||
| 793 | Ga0495609_0001176 | |||
| 794 | Ga0495609_0008391 | |||
| 795 | Ga0495609_0010324 | |||
| 796 | Ga0495609_0011794 | |||
| 797 | Ga0495609_0079386 | |||
| 798 | Ga0495609_0145650 | |||
| 799 | Ga0495609_0316665 | |||
| 800 | Ga0495597_0003333 | |||
| 801 | Ga0495597_0054361 | |||
| 802 | Ga0495597_0110888 | |||
| 803 | Ga0495645_0770889 | |||
| 804 | Ga0495633_0004331 | |||
| 805 | Ga0495668_0005345 | |||
| 806 | Ga0495668_0022695 | |||
| 807 | Ga0495668_0059904 | |||
| 808 | Ga0495634_0002180 | |||
| 809 | Ga0495611_0080023 | |||
| 810 | Ga0495625_0005248 | |||
| 811 | Ga0495625_0006726 | |||
| 812 | Ga0495625_0125222 | |||
| 813 | Ga0495625_0136127 | |||
| 814 | Ga0495625_0217840 | |||
| 815 | Ga0495635_0000990 | |||
| 816 | Ga0495661_0001172 | |||
| 817 | Ga0495661_0012125 | |||
| 818 | Ga0495661_0015712 | |||
| 819 | Ga0495661_0025451 | |||
| 820 | Ga0495661_0190312 | |||
| 821 | Ga0495661_0218193 | |||
| 822 | Ga0495657_0030373 | |||
| 823 | Ga0495599_0105225 | |||
| 824 | Ga0495623_0001930 | |||
| 825 | Ga0495623_0005963 | |||
| 826 | Ga0495646_0021532 | |||
| 827 | Ga0495613_0095020 | |||
| 828 | Ga0495624_0775076 | |||
| 829 | Ga0495670_0210594 | |||
| 830 | Ga0495671_0002745 | |||
| 831 | Ga0495671_0018697 | |||
| 832 | Ga0495671_0027476 | |||
| 833 | Ga0495671_0089641 | |||
| 834 | Ga0495671_0124778 | |||
| 835 | Ga0495671_0313712 | |||
| 836 | Ga0495671_0548392 | |||
| 837 | Ga0495671_0613012 | |||
| 838 | Ga0495671_0637218 | |||
| 839 | Ga0495649_0003038 | |||
| 840 | Ga0495649_0004810 | |||
| 841 | Ga0495649_0008852 | |||
| 842 | Ga0495649_0020971 | |||
| 843 | Ga0495649_0022909 | |||
| 844 | Ga0495649_0073760 | |||
| 845 | Ga0495649_0176158 | |||
| 846 | Ga0495589_0001025 | |||
| 847 | Ga0495589_0300142 | |||
| 848 | Ga0495600_0102592 | |||
| 849 | Ga0495600_0715641 | |||
| 850 | Ga0495660_0002035 | |||
| 851 | Ga0495660_0002728 | |||
| 852 | Ga0495660_0003972 | |||
| 853 | Ga0495660_0004059 | |||
| 854 | Ga0495660_0005931 | |||
| 855 | Ga0495660_0016581 | |||
| 856 | Ga0495660_0020852 | |||
| 857 | Ga0495660_0056103 | |||
| 858 | Ga0495660_0198847 | |||
| 859 | Ga0495604_0014914 | |||
| 860 | Ga0495604_0178984 | |||
| 861 | Ga0495674_0003856 | |||
| 862 | Ga0495672_0002299 | |||
| 863 | Ga0495672_0007113 | |||
| 864 | Ga0495672_0050040 | |||
| 865 | Ga0495672_0197415 | |||
| 866 | Ga0495676_0003312 | |||
| 867 | Ga0495680_0025280 | |||
| 868 | Ga0495680_0121427 | |||
| 869 | Ga0495683_0000806 | |||
| 870 | Ga0495683_0146394 | |||
| 871 | Ga0495683_0185090 | |||
| 872 | Ga0495675_0081868 | |||
| 873 | Ga0495679_001860 | |||
| 874 | Ga0495679_002188 | |||
| 875 | Ga0495679_003492 | |||
| 876 | Ga0495679_005331 | |||
| 877 | Ga0495679_006441 | |||
| 878 | Ga0495679_067388 | |||
| 879 | Ga0495673_0001688 | |||
| 880 | Ga0495673_0003362 | |||
| 881 | Ga0495673_0004551 | |||
| 882 | Ga0495673_0004808 | |||
| 883 | Ga0495673_0007851 | |||
| 884 | Ga0495673_0009883 | |||
| 885 | Ga0495673_0103092 | |||
| 886 | Ga0495673_0149182 | |||
| 887 | Ga0495673_0254076 | |||
| 888 | Ga0495681_0001617 | |||
| 889 | Ga0495681_0001778 | |||
| 890 | Ga0495681_0005183 | |||
| 891 | Ga0495681_0012153 | |||
| 892 | Ga0495681_0013285 | |||
| 893 | Ga0495681_0018533 | |||
| 894 | Ga0495681_0110650 | |||
| 895 | Ga0495681_0213729 | |||
| 896 | Ga0495681_0393180 | |||
| 897 | Ga0495684_0032714 | |||
| 898 | Ga0495686_0004004 | |||
| 899 | Ga0495686_0005736 | |||
| 900 | Ga0495593_0003875 | |||
| 901 | Ga0495593_0088352 | |||
| 902 | Ga0495602_0323493 | |||
| 903 | Ga0495626_0002705 | |||
| 904 | Ga0495626_0025110 | |||
| 905 | Ga0495626_0038765 | |||
| 906 | Ga0495626_0106584 | |||
| 907 | Ga0495626_0129897 | |||
| 908 | Ga0495626_0280265 | |||
| 909 | Ga0495626_0389683 | |||
| 910 | Ga0495626_0389688 | |||
| 911 | Ga0496100_0647955 | |||
| 912 | Ga0496102_0000897 | |||
| 913 | Ga0496102_0030996 | |||
| 914 | Ga0496103_0001672 | |||
| 915 | Ga0496106_0145919 | |||
| 916 | Ga0496106_0546602 | |||
| 917 | Ga0496110_0793118 | |||
| 918 | Ga0496112_0247958 | |||
| 919 | Ga0496115_0052124 | |||
| 920 | Ga0496116_0003051 | |||
| 921 | Ga0496116_0004738 | |||
| 922 | Ga0496116_0006230 | |||
| 923 | Ga0496116_0008850 | |||
| 924 | Ga0496116_0031227 | |||
| 925 | Ga0496116_0319835 | |||
| 926 | Ga0496117_0000951 | |||
| 927 | Ga0496117_0004144 | |||
| 928 | Ga0496117_0005741 | |||
| 929 | Ga0496117_0041041 | |||
| 930 | Ga0496117_0068092 | |||
| 931 | Ga0496117_0098018 | |||
| 932 | Ga0496117_0548787 | |||
| 933 | Ga0496118_0009822 | |||
| 934 | Ga0496118_0010381 | |||
| 935 | Ga0496118_0011218 | |||
| 936 | Ga0496118_0024388 | |||
| 937 | Ga0496118_0329770 | |||
| 938 | Ga0496118_0392202 | |||
| 939 | Ga0496118_0402525 | |||
| 940 | Ga0496118_0553311 | |||
| 941 | Ga0496118_0570411 | |||
| 942 | Ga0496119_0100806 | |||
| 943 | Ga0496120_0106027 | |||
| 944 | Ga0496121_0000518 | |||
| 945 | Ga0496121_0001706 | |||
| 946 | Ga0496121_0002316 | |||
| 947 | Ga0496121_0008345 | |||
| 948 | Ga0496121_0103203 | |||
| 949 | Ga0496121_0404638 | |||
| 950 | Ga0496121_0557515 | |||
| 951 | Ga0496122_0004139 | |||
| 952 | Ga0496122_0011827 | |||
| 953 | Ga0496122_0092796 | |||
| 954 | Ga0496122_0143126 | |||
| 955 | Ga0496123_0003178 | |||
| 956 | Ga0496123_0007295 | |||
| 957 | Ga0496123_0019576 | |||
| 958 | Ga0496123_0063397 | |||
| 959 | Ga0496124_0002322 | |||
| 960 | Ga0496124_0017209 | |||
| 961 | Ga0496124_0032254 | |||
| 962 | Ga0496124_0232404 | |||
| 963 | Ga0496124_0416324 | |||
| 964 | Ga0496125_0009805 | |||
| 965 | Ga0496125_0030832 | |||
| 966 | Ga0496125_0044646 | |||
| 967 | Ga0496125_0596905 | |||
| 968 | Ga0496126_0265634 | |||
| 969 | Ga0496126_0429391 | |||
| 970 | Ga0496126_1388555 | |||
| 971 | Ga0495678_001621 | |||
| 972 | Ga0495678_002275 | |||
| 973 | Ga0495678_008845 | |||
| 974 | Ga0495678_018141 | |||
| 975 | Ga0495678_090654 | |||
| 976 | Ga0495682_0001846 | |||
| 977 | Ga0495682_0010148 | |||
| 978 | Ga0495682_0064900 | |||
| 979 | nmdc:mga00v17_976641_c1 | |||
| 980 | nmdc:mga08x19_162920_c1 | |||
| 981 | Ga0500572_000925 | |||
| 982 | 2600443358 | |||
| 983 | 2602009178 | |||
| 984 | 2919501703 | |||
| 985 | 2926063376 | |||
| 986 | 3007255935 | |||
| 987 | 3007319993 | |||
| 988 | 8034962950 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c16-assembly1.cif.gz_A | crystal structure of asymmetric ferredoxin/flavodoxin nadp+ oxidoreductase 2 (fnr2) h326v mutant from bacillus cereus | 0.9134 | 26 | 56 |
| 5twb-assembly1.cif.gz_A | oxidoreductase iruo in the reduced form | 0.9006 | 26 | 56 |
| 7ytv-assembly1.cif.gz_A | crystal structure of aspergillus fumigatus thioredoxin reductase in complex with auranofin | 0.9 | 26 | 56 |
| 5uth-assembly1.cif.gz_A | crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad | 0.8976 | 26 | 56 |
| 6bwt-assembly1.cif.gz_A | 2.45 angstrom resolution crystal structure thioredoxin reductase from francisella tularensis. | 0.8935 | 26 | 56 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57681_481_577_3.40.50.800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain | 0.9108 | 40 | 56 | 3.40.50.800 |
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8976 | 26 | 56 | 3.50.50.60 |
| af_Q06817_503_612_3.40.50.800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain | 0.8936 | 40 | 56 | 3.40.50.800 |
| 5u63A02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8894 | 26 | 56 | 3.50.50.60 |
| af_Q4DY51_38_295_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8829 | 28 | 56 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F9UUE0-F1-model_v4 | Uncharacterized protein | 0.949 | 27 | 63 |
|
| AF-A0A4Q7LTH5-F1-model_v4 | TIGR02450 family Trp-rich protein | 0.9367 | 3 | 67 |
|
| AF-A0A1Y2CBG3-F1-model_v4 | BHLH domain-containing protein | 0.9339 | 26 | 56 |
GO:0046983
|
| AF-A0A5S9INN4-F1-model_v4 | TIGR02450 family Trp-rich protein | 0.9315 | 4 | 67 |
|
| AF-A0A358G2L6-F1-model_v4 | deleted | 0.931 | 26 | 56 |
|