F454574

General Info

Members Datasets Scaffolds Average Seq Length
494 190 988 71

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10038544|Ga0182008_100385442
Length 87
Sequence MAQWPGGGKTLARTPAVNRINPRKLLLSKWTAAHPQNREKHFLVTELFRDEDGTVLEIELQAVLTRRTEQCDWHALQDDSRWKMGWR

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
40 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
41 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
81 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
86 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
87 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
88 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
89 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
90 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
91 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
92 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
93 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
94 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
95 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
96 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
97 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
184 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
185 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
186 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
187 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
188 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
189 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
190 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 2.23
Rhizosphere 80.97
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10038544 3300014497 Bacteria 2390
2 JGI25163J39215_1000219 3300002771 Bacteria 21336
3 JGI25164J39214_1000160 3300002772 Bacteria 63841
4 JGI25165J46597_1000290 3300003214 Bacteria 63841
5 rootH1_10184217 3300003323 Bacteria 1526
6 JGI26143J51219_1001913 3300003502 Bacteria 883
7 Ga0055525_1004420 3300003759 Bacteria 1210
8 Ga0055536_1000831 3300003781 Bacteria 20372
9 Ga0055530_10001294 3300003791 Bacteria 18901
10 Ga0055540_1000277 3300003792 Bacteria 46097
11 Ga0055531_10000123 3300003794 Bacteria 86722
12 Ga0065714_10292984 3300005288 Bacteria 705
13 Ga0065714_10324050 3300005288 Bacteria 665
14 Ga0065704_10272377 3300005289 Bacteria 940
15 Ga0065704_10332961 3300005289 Bacteria 835
16 Ga0070669_100016874 3300005353 Bacteria 5213
17 Ga0070663_100643430 3300005455 Bacteria 896
18 Ga0070662_100006388 3300005457 Bacteria 7595
19 Ga0070684_102310428 3300005535 Bacteria 507
20 Ga0070665_100135885 3300005548 Bacteria 2461
21 Ga0068855_102447657 3300005563 Bacteria 520
22 Ga0075432_10333871 3300006058 Bacteria 638
23 Ga0075362_10069147 3300006177 Bacteria 1609
24 Ga0075362_10198328 3300006177 Bacteria 976
25 Ga0075436_100285929 3300006914 Bacteria 1180
26 Ga0105251_10005928 3300009011 Bacteria 7897
27 Ga0105251_10014133 3300009011 Bacteria 4430
28 Ga0105244_10002038 3300009036 Bacteria 15563
29 Ga0105244_10003864 3300009036 Bacteria 10554
30 Ga0105244_10008293 3300009036 Bacteria 6502
31 Ga0105244_10008504 3300009036 Bacteria 6403
32 Ga0105244_10185560 3300009036 Bacteria 985
33 Ga0105244_10244717 3300009036 Bacteria 837
34 Ga0105244_10357175 3300009036 Bacteria 673
35 Ga0105244_10367224 3300009036 Bacteria 663
36 Ga0105250_10000637 3300009092 Bacteria 22489
37 Ga0105250_10002425 3300009092 Bacteria 9368
38 Ga0105250_10004161 3300009092 Bacteria 6711
39 Ga0105250_10007509 3300009092 Bacteria 4678
40 Ga0105250_10016955 3300009092 Bacteria 2963
41 Ga0105247_10789102 3300009101 Bacteria 724
42 Ga0105243_10000335 3300009148 Bacteria 51380
43 Ga0105238_12619295 3300009551 Bacteria 541
44 Ga0105249_10048077 3300009553 Bacteria 3890
45 Ga0105246_10000484 3300011119 Bacteria 21488
46 Ga0157345_1000093 3300012498 Bacteria 18946
47 Ga0157373_10024960 3300013100 Bacteria 4327
48 Ga0157373_10031898 3300013100 Bacteria 3794
49 Ga0157373_10127924 3300013100 Bacteria 1786
50 Ga0157371_10001483 3300013102 Bacteria 24268
51 Ga0157371_10013719 3300013102 Bacteria 6144
52 Ga0157371_10080369 3300013102 Bacteria 2309
53 Ga0157371_10891076 3300013102 Bacteria 674
54 Ga0157370_10082381 3300013104 Bacteria 3026
55 Ga0157370_10275500 3300013104 Bacteria 1554
56 Ga0157370_10371403 3300013104 Bacteria 1318
57 Ga0157370_10812084 3300013104 Bacteria 851
58 Ga0157370_11257937 3300013104 Bacteria 667
59 Ga0157369_10080665 3300013105 Bacteria 3484
60 Ga0157369_11622259 3300013105 Bacteria 658
61 Ga0163162_10420602 3300013306 Bacteria 1469
62 Ga0157372_10005543 3300013307 Bacteria 13421
63 Ga0157375_10002693 3300013308 Bacteria 15384
64 Ga0157375_10207106 3300013308 Bacteria 2118
65 Ga0182008_10027585 3300014497 Bacteria 2875
66 Ga0182008_10093506 3300014497 Bacteria 1483
67 Ga0182008_10094922 3300014497 Bacteria 1471
68 Ga0182006_1001263 3300015261 Bacteria 15628
69 Ga0182006_1005730 3300015261 Bacteria 5862
70 Ga0182006_1007576 3300015261 Bacteria 4961
71 Ga0182006_1011993 3300015261 Bacteria 3796
72 Ga0182006_1062211 3300015261 Bacteria 1405
73 Ga0182007_10394185 3300015262 Bacteria 527
74 Ga0182005_1010587 3300015265 Bacteria 2648
75 Ga0182005_1050625 3300015265 Bacteria 1129
76 Ga0182005_1082582 3300015265 Bacteria 888
77 Ga0182005_1084976 3300015265 Bacteria 876
78 Ga0182005_1282369 3300015265 Bacteria 521
79 Ga0163161_10312678 3300017792 Bacteria 1240
80 Ga0163161_10564864 3300017792 Bacteria 934
81 Ga0163161_10866091 3300017792 Bacteria 763
82 Ga0209760_100258 3300025207 Bacteria 21118
83 Ga0209563_100745 3300025230 Bacteria 10006
84 Ga0207427_100007 3300025231 Bacteria 746220
85 Ga0209437_100006 3300025233 Bacteria 1042724
86 Ga0209233_1000059 3300025261 Bacteria 414562
87 Ga0209675_1004773 3300025291 Bacteria 5894
88 Ga0209676_1000010 3300025292 Bacteria 954025
89 Ga0209676_1000350 3300025292 Bacteria 87204
90 Ga0209050_1000019 3300025298 Bacteria 608757
91 Ga0209051_1000383 3300025303 Bacteria 62847
92 Ga0209257_1000357 3300025304 Bacteria 93431
93 Ga0207696_1000138 3300025711 Bacteria 127572
94 Ga0207696_1000213 3300025711 Bacteria 87128
95 Ga0207696_1001517 3300025711 Bacteria 12461
96 Ga0207696_1004910 3300025711 Bacteria 5661
97 Ga0207696_1005878 3300025711 Bacteria 5029
98 Ga0207655_1000954 3300025728 Bacteria 29930
99 Ga0207655_1003342 3300025728 Bacteria 12014
100 Ga0207655_1003350 3300025728 Bacteria 11997
101 Ga0207655_1004455 3300025728 Bacteria 9930
102 Ga0207655_1044087 3300025728 Bacteria 1878
103 Ga0207655_1086263 3300025728 Bacteria 1117
104 Ga0207655_1170114 3300025728 Bacteria 673
105 Ga0207713_1000078 3300025735 Bacteria 175087
106 Ga0207713_1000080 3300025735 Bacteria 168403
107 Ga0207713_1001355 3300025735 Bacteria 19964
108 Ga0207713_1002469 3300025735 Bacteria 13448
109 Ga0207713_1004556 3300025735 Bacteria 8973
110 Ga0207713_1017757 3300025735 Bacteria 3549
111 Ga0207713_1058630 3300025735 Bacteria 1482
112 Ga0207713_1119592 3300025735 Bacteria 885
113 Ga0207681_10002703 3300025923 Bacteria 11237
114 Ga0207694_10318231 3300025924 Bacteria 1284
115 Ga0207690_10783313 3300025932 Bacteria 787
116 Ga0207706_10006616 3300025933 Bacteria 10731
117 Ga0207709_10000189 3300025935 Bacteria 82404
118 Ga0207709_10000872 3300025935 Bacteria 23023
119 Ga0207712_10050565 3300025961 Bacteria 2902
120 Ga0207678_11449954 3300026067 Bacteria 606
121 Ga0209973_1041515 3300027252 Unclassified 675
122 Ga0209371_1000232 3300027312 Bacteria 70412
123 Ga0209996_1000737 3300027395 Bacteria 3902
124 Ga0209995_1004792 3300027471 Bacteria 2173
125 Ga0209968_1089703 3300027526 Bacteria 557
126 Ga0209999_1050007 3300027543 Bacteria 789
127 Ga0209982_1007213 3300027552 Bacteria 1624
128 Ga0209983_1006766 3300027665 Bacteria 2352
129 Ga0209971_1002809 3300027682 Bacteria 4162
130 Ga0209974_10015914 3300027876 Bacteria 2497
131 Ga0207428_10698270 3300027907 Bacteria 726
132 Ga0268266_10023011 3300028379 Bacteria 5303
133 Ga0268256_1000169 3300030500 Bacteria 81272
134 Ga0307511_10082885 3300030521 Bacteria 2238
135 Ga0307511_10264082 3300030521 Bacteria 813
136 Ga0307408_100000020 3300031548 Bacteria 340408
137 Ga0237819_01066 3300038705 Bacteria 8134
138 Ga0436363_0395710 3300039450 Bacteria 2957
139 Ga0439438_011224 3300041405 Bacteria 2799
140 Ga0439447_000778 3300041407 Bacteria 11699
141 Ga0439447_025955 3300041407 Bacteria 1506
142 Ga0439466_0005240 3300041411 Bacteria 4965
143 Ga0439466_0009049 3300041411 Bacteria 3739
144 Ga0439466_0020295 3300041411 Bacteria 2368
145 Ga0439445_0077619 3300042004 Bacteria 925
146 Ga0439432_000220 3300042006 Bacteria 20561
147 Ga0439452_000610 3300042010 Bacteria 18093
148 Ga0439452_009024 3300042010 Bacteria 2965
149 Ga0439455_0241271 3300042012 Bacteria 528
150 Ga0439456_036070 3300042013 Bacteria 1066
151 Ga0439456_127875 3300042013 Bacteria 585
152 Ga0439463_004963 3300042016 Bacteria 3318
153 Ga0439463_019638 3300042016 Bacteria 1683
154 Ga0439463_085001 3300042016 Bacteria 814
155 Ga0450911_001528 3300042115 Bacteria 5252
156 Ga0450902_004872 3300042137 Bacteria 2010
157 Ga0450902_015570 3300042137 Bacteria 1234
158 Ga0450904_002812 3300042139 Bacteria 1983
159 Ga0450905_028469 3300042142 Bacteria 852
160 Ga0439464_0003742 3300042439 Bacteria 3861
161 Ga0439460_0348601 3300042461 Bacteria 522
162 Ga0450893_0001539 3300042532 Bacteria 3543
163 Ga0450901_041431 3300042533 Bacteria 520
164 Ga0495617_008360 3300046452 Bacteria 3570
165 Ga0495617_028463 3300046452 Bacteria 1877
166 Ga0495617_062862 3300046452 Bacteria 1226
167 Ga0495617_078257 3300046452 Bacteria 1084
168 Ga0495617_163761 3300046452 Bacteria 704
169 Ga0495627_000953 3300046453 Bacteria 19856
170 Ga0495627_001633 3300046453 Bacteria 12509
171 Ga0495627_001765 3300046453 Bacteria 11626
172 Ga0495627_038206 3300046453 Bacteria 1485
173 Ga0495627_057684 3300046453 Bacteria 1154
174 Ga0495627_157468 3300046453 Bacteria 632
175 Ga0495591_000205 3300046458 Bacteria 60191
176 Ga0495591_001566 3300046458 Bacteria 13931
177 Ga0495591_001624 3300046458 Bacteria 13596
178 Ga0495591_001930 3300046458 Bacteria 12142
179 Ga0495591_003045 3300046458 Bacteria 8905
180 Ga0495591_010727 3300046458 Bacteria 3525
181 Ga0495591_022260 3300046458 Bacteria 2052
182 Ga0495638_0002867 3300046460 Bacteria 13805
183 Ga0495638_0018152 3300046460 Bacteria 4675
184 Ga0495638_0039292 3300046460 Bacteria 3004
185 Ga0495638_0370118 3300046460 Bacteria 751
186 Ga0495653_0026756 3300046463 Bacteria 4622
187 Ga0495653_0033640 3300046463 Bacteria 4059
188 Ga0495650_0002459 3300046471 Bacteria 14936
189 Ga0495650_0002495 3300046471 Bacteria 14777
190 Ga0495650_0019040 3300046471 Bacteria 3392
191 Ga0495650_0019226 3300046471 Bacteria 3372
192 Ga0495650_0051365 3300046471 Bacteria 1699
193 Ga0495650_0097187 3300046471 Bacteria 1110
194 Ga0495605_0000909 3300046474 Bacteria 20347
195 Ga0495605_0002004 3300046474 Bacteria 12877
196 Ga0495605_0107017 3300046474 Bacteria 1279
197 Ga0495584_0035313 3300046491 Bacteria 2527
198 Ga0495584_0111830 3300046491 Bacteria 1382
199 Ga0495584_0175866 3300046491 Bacteria 1088
200 Ga0495584_0238552 3300046491 Bacteria 924
201 Ga0495584_0523008 3300046491 Bacteria 604
202 Ga0495585_0001101 3300046492 Bacteria 22238
203 Ga0495585_0001554 3300046492 Bacteria 17806
204 Ga0495585_0002369 3300046492 Bacteria 13524
205 Ga0495585_0003939 3300046492 Bacteria 9818
206 Ga0495585_0008256 3300046492 Bacteria 6321
207 Ga0495585_0154832 3300046492 Bacteria 1193
208 Ga0495596_0028451 3300046500 Bacteria 2244
209 Ga0495596_0031249 3300046500 Bacteria 2128
210 Ga0495596_0123131 3300046500 Bacteria 1006
211 Ga0495607_0000288 3300046501 Bacteria 53438
212 Ga0495607_0001843 3300046501 Bacteria 18048
213 Ga0495607_0003902 3300046501 Bacteria 11232
214 Ga0495607_0005045 3300046501 Bacteria 9577
215 Ga0495607_0027538 3300046501 Bacteria 3512
216 Ga0495607_0072145 3300046501 Bacteria 1923
217 Ga0495607_0093372 3300046501 Bacteria 1625
218 Ga0495607_0115698 3300046501 Bacteria 1415
219 Ga0495607_0179871 3300046501 Bacteria 1061
220 Ga0495583_0003204 3300046506 Bacteria 12808
221 Ga0495583_0011870 3300046506 Bacteria 4972
222 Ga0495606_0000151 3300046507 Bacteria 119548
223 Ga0495606_0003494 3300046507 Bacteria 16641
224 Ga0495606_0017942 3300046507 Bacteria 5325
225 Ga0495606_0044797 3300046507 Bacteria 2939
226 Ga0495606_0129613 3300046507 Bacteria 1500
227 Ga0495610_0002277 3300046512 Bacteria 16214
228 Ga0495610_0024792 3300046512 Bacteria 3231
229 Ga0495610_0025389 3300046512 Bacteria 3181
230 Ga0495610_0054372 3300046512 Bacteria 1934
231 Ga0495610_0056210 3300046512 Bacteria 1893
232 Ga0495610_0156452 3300046512 Bacteria 967
233 Ga0495616_0001700 3300046513 Bacteria 15013
234 Ga0495616_0001714 3300046513 Bacteria 14956
235 Ga0495616_0011921 3300046513 Bacteria 4952
236 Ga0495616_0399277 3300046513 Bacteria 565
237 Ga0495620_0000454 3300046515 Bacteria 27182
238 Ga0495620_0000851 3300046515 Bacteria 18847
239 Ga0495620_0001961 3300046515 Bacteria 12055
240 Ga0495620_0009088 3300046515 Bacteria 5302
241 Ga0495620_0029795 3300046515 Bacteria 2521
242 Ga0495620_0415860 3300046515 Bacteria 509
243 Ga0495628_0064323 3300046516 Bacteria 2872
244 Ga0495630_0002286 3300046517 Bacteria 13336
245 Ga0495630_0006836 3300046517 Bacteria 8131
246 Ga0495631_0000488 3300046518 Bacteria 26555
247 Ga0495631_0001163 3300046518 Bacteria 16265
248 Ga0495631_0002717 3300046518 Bacteria 9815
249 Ga0495631_0045294 3300046518 Bacteria 1937
250 Ga0495631_0119549 3300046518 Bacteria 1133
251 Ga0495631_0191065 3300046518 Bacteria 876
252 Ga0495632_0001292 3300046519 Bacteria 21166
253 Ga0495632_0005155 3300046519 Bacteria 8717
254 Ga0495632_0010935 3300046519 Bacteria 5326
255 Ga0495632_0016059 3300046519 Bacteria 4175
256 Ga0495632_0016134 3300046519 Bacteria 4164
257 Ga0495632_0040405 3300046519 Bacteria 2349
258 Ga0495632_0085935 3300046519 Bacteria 1496
259 Ga0495632_0105329 3300046519 Bacteria 1327
260 Ga0495632_0117470 3300046519 Bacteria 1245
261 Ga0495632_0128774 3300046519 Bacteria 1179
262 Ga0495632_0235788 3300046519 Bacteria 824
263 Ga0495637_0001989 3300046520 Bacteria 11563
264 Ga0495637_0005094 3300046520 Bacteria 6741
265 Ga0495637_0008309 3300046520 Bacteria 5104
266 Ga0495637_0016433 3300046520 Bacteria 3458
267 Ga0495637_0016709 3300046520 Bacteria 3428
268 Ga0495637_0093469 3300046520 Bacteria 1183
269 Ga0495637_0118538 3300046520 Bacteria 1020
270 Ga0495637_0202656 3300046520 Bacteria 728
271 Ga0495643_0005003 3300046522 Bacteria 9086
272 Ga0495643_0013306 3300046522 Bacteria 4928
273 Ga0495643_0038767 3300046522 Bacteria 2608
274 Ga0495643_0153990 3300046522 Bacteria 1136
275 Ga0495643_0158373 3300046522 Bacteria 1116
276 Ga0495643_0184883 3300046522 Bacteria 1010
277 Ga0495648_0003731 3300046524 Bacteria 13287
278 Ga0495648_0003891 3300046524 Bacteria 12947
279 Ga0495648_0006276 3300046524 Bacteria 9725
280 Ga0495648_0038739 3300046524 Bacteria 3043
281 Ga0495648_0092969 3300046524 Bacteria 1683
282 Ga0495648_0144797 3300046524 Bacteria 1246
283 Ga0495666_0001124 3300046526 Bacteria 12812
284 Ga0495666_0083132 3300046526 Bacteria 1513
285 Ga0495654_0000405 3300046530 Bacteria 36817
286 Ga0495654_0001918 3300046530 Bacteria 13798
287 Ga0495654_0002652 3300046530 Bacteria 11375
288 Ga0495654_0003715 3300046530 Bacteria 9262
289 Ga0495654_0005089 3300046530 Bacteria 7689
290 Ga0495654_0030526 3300046530 Bacteria 2741
291 Ga0495654_0061166 3300046530 Bacteria 1809
292 Ga0495654_0113263 3300046530 Bacteria 1235
293 Ga0495654_0159504 3300046530 Bacteria 991
294 Ga0495654_0237459 3300046530 Bacteria 764
295 Ga0495665_0149609 3300046531 Bacteria 1219
296 Ga0495587_0011114 3300046536 Bacteria 5710
297 Ga0495587_0094872 3300046536 Bacteria 1722
298 Ga0495609_0000006 3300046538 Bacteria 431833
299 Ga0495609_0001176 3300046538 Bacteria 18064
300 Ga0495609_0008391 3300046538 Bacteria 5061
301 Ga0495609_0010324 3300046538 Bacteria 4483
302 Ga0495609_0011794 3300046538 Bacteria 4155
303 Ga0495609_0079386 3300046538 Bacteria 1435
304 Ga0495609_0145650 3300046538 Bacteria 1009
305 Ga0495609_0316665 3300046538 Bacteria 633
306 Ga0495597_0003333 3300046542 Bacteria 9467
307 Ga0495597_0054361 3300046542 Bacteria 1759
308 Ga0495597_0110888 3300046542 Bacteria 1150
309 Ga0495645_0770889 3300046543 Bacteria 579
310 Ga0495633_0004331 3300046558 Bacteria 9060
311 Ga0495668_0005345 3300046616 Bacteria 8758
312 Ga0495668_0022695 3300046616 Bacteria 3586
313 Ga0495668_0059904 3300046616 Bacteria 2100
314 Ga0495634_0002180 3300046642 Bacteria 16448
315 Ga0495611_0080023 3300046648 Bacteria 1501
316 Ga0495625_0005248 3300046660 Bacteria 11916
317 Ga0495625_0006726 3300046660 Bacteria 10184
318 Ga0495625_0125222 3300046660 Bacteria 1745
319 Ga0495625_0136127 3300046660 Bacteria 1660
320 Ga0495625_0217840 3300046660 Bacteria 1252
321 Ga0495635_0000990 3300046663 Bacteria 18718
322 Ga0495661_0001172 3300046665 Bacteria 22850
323 Ga0495661_0012125 3300046665 Bacteria 5825
324 Ga0495661_0015712 3300046665 Bacteria 5045
325 Ga0495661_0025451 3300046665 Bacteria 3822
326 Ga0495661_0190312 3300046665 Bacteria 1081
327 Ga0495661_0218193 3300046665 Bacteria 989
328 Ga0495657_0030373 3300046675 Bacteria 3785
329 Ga0495599_0105225 3300046678 Bacteria 1758
330 Ga0495623_0001930 3300046679 Bacteria 13925
331 Ga0495623_0005963 3300046679 Bacteria 7939
332 Ga0495646_0021532 3300046680 Bacteria 4071
333 Ga0495613_0095020 3300046689 Bacteria 2156
334 Ga0495624_0775076 3300046690 Bacteria 567
335 Ga0495670_0210594 3300046691 Bacteria 1031
336 Ga0495671_0002745 3300046692 Bacteria 11024
337 Ga0495671_0018697 3300046692 Bacteria 3674
338 Ga0495671_0027476 3300046692 Bacteria 2939
339 Ga0495671_0089641 3300046692 Bacteria 1506
340 Ga0495671_0124778 3300046692 Bacteria 1255
341 Ga0495671_0313712 3300046692 Bacteria 753
342 Ga0495671_0548392 3300046692 Bacteria 550
343 Ga0495671_0613012 3300046692 Bacteria 517
344 Ga0495671_0637218 3300046692 Bacteria 506
345 Ga0495649_0003038 3300046694 Bacteria 11507
346 Ga0495649_0004810 3300046694 Bacteria 8744
347 Ga0495649_0008852 3300046694 Bacteria 6027
348 Ga0495649_0020971 3300046694 Bacteria 3662
349 Ga0495649_0022909 3300046694 Bacteria 3491
350 Ga0495649_0073760 3300046694 Bacteria 1828
351 Ga0495649_0176158 3300046694 Bacteria 1117
352 Ga0495589_0001025 3300046794 Bacteria 16878
353 Ga0495589_0300142 3300046794 Bacteria 744
354 Ga0495600_0102592 3300046809 Bacteria 1864
355 Ga0495600_0715641 3300046809 Bacteria 601
356 Ga0495660_0002035 3300046810 Bacteria 13141
357 Ga0495660_0002728 3300046810 Bacteria 11144
358 Ga0495660_0003972 3300046810 Bacteria 9028
359 Ga0495660_0004059 3300046810 Bacteria 8941
360 Ga0495660_0005931 3300046810 Bacteria 7276
361 Ga0495660_0016581 3300046810 Bacteria 4247
362 Ga0495660_0020852 3300046810 Bacteria 3756
363 Ga0495660_0056103 3300046810 Bacteria 2130
364 Ga0495660_0198847 3300046810 Bacteria 958
365 Ga0495604_0014914 3300047317 Bacteria 6199
366 Ga0495604_0178984 3300047317 Bacteria 1484
367 Ga0495674_0003856 3300047319 Bacteria 14564
368 Ga0495672_0002299 3300047320 Bacteria 17724
369 Ga0495672_0007113 3300047320 Bacteria 8479
370 Ga0495672_0050040 3300047320 Bacteria 2470
371 Ga0495672_0197415 3300047320 Bacteria 1008
372 Ga0495676_0003312 3300047321 Bacteria 14561
373 Ga0495680_0025280 3300047322 Bacteria 4917
374 Ga0495680_0121427 3300047322 Bacteria 1928
375 Ga0495683_0000806 3300047323 Bacteria 22310
376 Ga0495683_0146394 3300047323 Bacteria 1103
377 Ga0495683_0185090 3300047323 Bacteria 948
378 Ga0495675_0081868 3300047444 Bacteria 2032
379 Ga0495679_001860 3300047446 Bacteria 11364
380 Ga0495679_002188 3300047446 Bacteria 10231
381 Ga0495679_003492 3300047446 Bacteria 7525
382 Ga0495679_005331 3300047446 Bacteria 5716
383 Ga0495679_006441 3300047446 Bacteria 5052
384 Ga0495679_067388 3300047446 Bacteria 1037
385 Ga0495673_0001688 3300047469 Bacteria 16955
386 Ga0495673_0003362 3300047469 Bacteria 10583
387 Ga0495673_0004551 3300047469 Bacteria 8653
388 Ga0495673_0004808 3300047469 Bacteria 8360
389 Ga0495673_0007851 3300047469 Bacteria 6069
390 Ga0495673_0009883 3300047469 Bacteria 5237
391 Ga0495673_0103092 3300047469 Bacteria 1150
392 Ga0495673_0149182 3300047469 Bacteria 905
393 Ga0495673_0254076 3300047469 Bacteria 641
394 Ga0495681_0001617 3300047470 Bacteria 16762
395 Ga0495681_0001778 3300047470 Bacteria 15885
396 Ga0495681_0005183 3300047470 Bacteria 8766
397 Ga0495681_0012153 3300047470 Bacteria 5073
398 Ga0495681_0013285 3300047470 Bacteria 4786
399 Ga0495681_0018533 3300047470 Bacteria 3833
400 Ga0495681_0110650 3300047470 Bacteria 1190
401 Ga0495681_0213729 3300047470 Bacteria 776
402 Ga0495681_0393180 3300047470 Bacteria 520
403 Ga0495684_0032714 3300047471 Bacteria 3994
404 Ga0495686_0004004 3300047472 Bacteria 12328
405 Ga0495686_0005736 3300047472 Bacteria 9706
406 Ga0495593_0003875 3300047673 Bacteria 8939
407 Ga0495593_0088352 3300047673 Bacteria 1597
408 Ga0495602_0323493 3300048088 Bacteria 1121
409 Ga0495626_0002705 3300048091 Bacteria 11975
410 Ga0495626_0025110 3300048091 Bacteria 2916
411 Ga0495626_0038765 3300048091 Bacteria 2257
412 Ga0495626_0106584 3300048091 Bacteria 1217
413 Ga0495626_0129897 3300048091 Bacteria 1076
414 Ga0495626_0280265 3300048091 Bacteria 662
415 Ga0495626_0389683 3300048091 Bacteria 539
416 Ga0495626_0389688 3300048091 Bacteria 539
417 Ga0496100_0647955 3300048903 Bacteria 822
418 Ga0496102_0000897 3300048905 Bacteria 28235
419 Ga0496102_0030996 3300048905 Bacteria 4791
420 Ga0496103_0001672 3300048906 Bacteria 14511
421 Ga0496106_0145919 3300048909 Bacteria 1864
422 Ga0496106_0546602 3300048909 Bacteria 929
423 Ga0496110_0793118 3300048913 Bacteria 851
424 Ga0496112_0247958 3300048915 Bacteria 1732
425 Ga0496115_0052124 3300048918 Bacteria 3282
426 Ga0496116_0003051 3300048919 Bacteria 16928
427 Ga0496116_0004738 3300048919 Bacteria 12845
428 Ga0496116_0006230 3300048919 Bacteria 10884
429 Ga0496116_0008850 3300048919 Bacteria 8666
430 Ga0496116_0031227 3300048919 Bacteria 3818
431 Ga0496116_0319835 3300048919 Bacteria 727
432 Ga0496117_0000951 3300048920 Bacteria 44280
433 Ga0496117_0004144 3300048920 Bacteria 16212
434 Ga0496117_0005741 3300048920 Bacteria 12893
435 Ga0496117_0041041 3300048920 Bacteria 3395
436 Ga0496117_0068092 3300048920 Bacteria 2405
437 Ga0496117_0098018 3300048920 Bacteria 1865
438 Ga0496117_0548787 3300048920 Bacteria 550
439 Ga0496118_0009822 3300048921 Bacteria 9579
440 Ga0496118_0010381 3300048921 Bacteria 9231
441 Ga0496118_0011218 3300048921 Bacteria 8773
442 Ga0496118_0024388 3300048921 Bacteria 5220
443 Ga0496118_0329770 3300048921 Bacteria 823
444 Ga0496118_0392202 3300048921 Bacteria 724
445 Ga0496118_0402525 3300048921 Bacteria 710
446 Ga0496118_0553311 3300048921 Bacteria 560
447 Ga0496118_0570411 3300048921 Bacteria 547
448 Ga0496119_0100806 3300048922 Bacteria 1621
449 Ga0496120_0106027 3300048923 Bacteria 1476
450 Ga0496121_0000518 3300048924 Bacteria 73428
451 Ga0496121_0001706 3300048924 Bacteria 36029
452 Ga0496121_0002316 3300048924 Bacteria 29512
453 Ga0496121_0008345 3300048924 Bacteria 12230
454 Ga0496121_0103203 3300048924 Bacteria 2194
455 Ga0496121_0404638 3300048924 Bacteria 893
456 Ga0496121_0557515 3300048924 Bacteria 715
457 Ga0496122_0004139 3300048925 Bacteria 18319
458 Ga0496122_0011827 3300048925 Bacteria 8775
459 Ga0496122_0092796 3300048925 Bacteria 2050
460 Ga0496122_0143126 3300048925 Bacteria 1491
461 Ga0496123_0003178 3300048926 Bacteria 18749
462 Ga0496123_0007295 3300048926 Bacteria 10487
463 Ga0496123_0019576 3300048926 Bacteria 5331
464 Ga0496123_0063397 3300048926 Bacteria 2361
465 Ga0496124_0002322 3300048927 Bacteria 25089
466 Ga0496124_0017209 3300048927 Bacteria 6823
467 Ga0496124_0032254 3300048927 Bacteria 4627
468 Ga0496124_0232404 3300048927 Bacteria 1377
469 Ga0496124_0416324 3300048927 Bacteria 928
470 Ga0496125_0009805 3300048928 Bacteria 9761
471 Ga0496125_0030832 3300048928 Bacteria 4788
472 Ga0496125_0044646 3300048928 Bacteria 3743
473 Ga0496125_0596905 3300048928 Bacteria 603
474 Ga0496126_0265634 3300048929 Bacteria 1426
475 Ga0496126_0429391 3300048929 Bacteria 1067
476 Ga0496126_1388555 3300048929 Bacteria 507
477 Ga0495678_001621 3300049459 Bacteria 17159
478 Ga0495678_002275 3300049459 Bacteria 13325
479 Ga0495678_008845 3300049459 Bacteria 5035
480 Ga0495678_018141 3300049459 Bacteria 3171
481 Ga0495678_090654 3300049459 Bacteria 1077
482 Ga0495682_0001846 3300049460 Bacteria 10628
483 Ga0495682_0010148 3300049460 Bacteria 3657
484 Ga0495682_0064900 3300049460 Bacteria 1316
485 nmdc:mga00v17_976641_c1 3300050491 Bacteria 534
486 nmdc:mga08x19_162920_c1 3300050514 Bacteria 1515
487 Ga0500572_000925 3300053111 Bacteria 9055
488 2600443358 2600254954 Bacteria 5100516
489 2602009178 2600255389 Bacteria 5275336
490 2919501703 2919501602 Bacteria 5286340
491 2926063376 2926063275 Bacteria 5285848
492 3007255935 3007252601 Bacteria 4559114
493 3007319993 3007315729 Bacteria 5076637
494 8034962950 8034962539 Bacteria 4884839
495 Ga0182008_10038544
496 JGI25163J39215_1000219
497 JGI25164J39214_1000160
498 JGI25165J46597_1000290
499 rootH1_10184217
500 JGI26143J51219_1001913
501 Ga0055525_1004420
502 Ga0055536_1000831
503 Ga0055530_10001294
504 Ga0055540_1000277
505 Ga0055531_10000123
506 Ga0065714_10292984
507 Ga0065714_10324050
508 Ga0065704_10272377
509 Ga0065704_10332961
510 Ga0070669_100016874
511 Ga0070663_100643430
512 Ga0070662_100006388
513 Ga0070684_102310428
514 Ga0070665_100135885
515 Ga0068855_102447657
516 Ga0075432_10333871
517 Ga0075362_10069147
518 Ga0075362_10198328
519 Ga0075436_100285929
520 Ga0105251_10005928
521 Ga0105251_10014133
522 Ga0105244_10002038
523 Ga0105244_10003864
524 Ga0105244_10008293
525 Ga0105244_10008504
526 Ga0105244_10185560
527 Ga0105244_10244717
528 Ga0105244_10357175
529 Ga0105244_10367224
530 Ga0105250_10000637
531 Ga0105250_10002425
532 Ga0105250_10004161
533 Ga0105250_10007509
534 Ga0105250_10016955
535 Ga0105247_10789102
536 Ga0105243_10000335
537 Ga0105238_12619295
538 Ga0105249_10048077
539 Ga0105246_10000484
540 Ga0157345_1000093
541 Ga0157373_10024960
542 Ga0157373_10031898
543 Ga0157373_10127924
544 Ga0157371_10001483
545 Ga0157371_10013719
546 Ga0157371_10080369
547 Ga0157371_10891076
548 Ga0157370_10082381
549 Ga0157370_10275500
550 Ga0157370_10371403
551 Ga0157370_10812084
552 Ga0157370_11257937
553 Ga0157369_10080665
554 Ga0157369_11622259
555 Ga0163162_10420602
556 Ga0157372_10005543
557 Ga0157375_10002693
558 Ga0157375_10207106
559 Ga0182008_10027585
560 Ga0182008_10093506
561 Ga0182008_10094922
562 Ga0182006_1001263
563 Ga0182006_1005730
564 Ga0182006_1007576
565 Ga0182006_1011993
566 Ga0182006_1062211
567 Ga0182007_10394185
568 Ga0182005_1010587
569 Ga0182005_1050625
570 Ga0182005_1082582
571 Ga0182005_1084976
572 Ga0182005_1282369
573 Ga0163161_10312678
574 Ga0163161_10564864
575 Ga0163161_10866091
576 Ga0209760_100258
577 Ga0209563_100745
578 Ga0207427_100007
579 Ga0209437_100006
580 Ga0209233_1000059
581 Ga0209675_1004773
582 Ga0209676_1000010
583 Ga0209676_1000350
584 Ga0209050_1000019
585 Ga0209051_1000383
586 Ga0209257_1000357
587 Ga0207696_1000138
588 Ga0207696_1000213
589 Ga0207696_1001517
590 Ga0207696_1004910
591 Ga0207696_1005878
592 Ga0207655_1000954
593 Ga0207655_1003342
594 Ga0207655_1003350
595 Ga0207655_1004455
596 Ga0207655_1044087
597 Ga0207655_1086263
598 Ga0207655_1170114
599 Ga0207713_1000078
600 Ga0207713_1000080
601 Ga0207713_1001355
602 Ga0207713_1002469
603 Ga0207713_1004556
604 Ga0207713_1017757
605 Ga0207713_1058630
606 Ga0207713_1119592
607 Ga0207681_10002703
608 Ga0207694_10318231
609 Ga0207690_10783313
610 Ga0207706_10006616
611 Ga0207709_10000189
612 Ga0207709_10000872
613 Ga0207712_10050565
614 Ga0207678_11449954
615 Ga0209973_1041515
616 Ga0209371_1000232
617 Ga0209996_1000737
618 Ga0209995_1004792
619 Ga0209968_1089703
620 Ga0209999_1050007
621 Ga0209982_1007213
622 Ga0209983_1006766
623 Ga0209971_1002809
624 Ga0209974_10015914
625 Ga0207428_10698270
626 Ga0268266_10023011
627 Ga0268256_1000169
628 Ga0307511_10082885
629 Ga0307511_10264082
630 Ga0307408_100000020
631 Ga0237819_01066
632 Ga0436363_0395710
633 Ga0439438_011224
634 Ga0439447_000778
635 Ga0439447_025955
636 Ga0439466_0005240
637 Ga0439466_0009049
638 Ga0439466_0020295
639 Ga0439445_0077619
640 Ga0439432_000220
641 Ga0439452_000610
642 Ga0439452_009024
643 Ga0439455_0241271
644 Ga0439456_036070
645 Ga0439456_127875
646 Ga0439463_004963
647 Ga0439463_019638
648 Ga0439463_085001
649 Ga0450911_001528
650 Ga0450902_004872
651 Ga0450902_015570
652 Ga0450904_002812
653 Ga0450905_028469
654 Ga0439464_0003742
655 Ga0439460_0348601
656 Ga0450893_0001539
657 Ga0450901_041431
658 Ga0495617_008360
659 Ga0495617_028463
660 Ga0495617_062862
661 Ga0495617_078257
662 Ga0495617_163761
663 Ga0495627_000953
664 Ga0495627_001633
665 Ga0495627_001765
666 Ga0495627_038206
667 Ga0495627_057684
668 Ga0495627_157468
669 Ga0495591_000205
670 Ga0495591_001566
671 Ga0495591_001624
672 Ga0495591_001930
673 Ga0495591_003045
674 Ga0495591_010727
675 Ga0495591_022260
676 Ga0495638_0002867
677 Ga0495638_0018152
678 Ga0495638_0039292
679 Ga0495638_0370118
680 Ga0495653_0026756
681 Ga0495653_0033640
682 Ga0495650_0002459
683 Ga0495650_0002495
684 Ga0495650_0019040
685 Ga0495650_0019226
686 Ga0495650_0051365
687 Ga0495650_0097187
688 Ga0495605_0000909
689 Ga0495605_0002004
690 Ga0495605_0107017
691 Ga0495584_0035313
692 Ga0495584_0111830
693 Ga0495584_0175866
694 Ga0495584_0238552
695 Ga0495584_0523008
696 Ga0495585_0001101
697 Ga0495585_0001554
698 Ga0495585_0002369
699 Ga0495585_0003939
700 Ga0495585_0008256
701 Ga0495585_0154832
702 Ga0495596_0028451
703 Ga0495596_0031249
704 Ga0495596_0123131
705 Ga0495607_0000288
706 Ga0495607_0001843
707 Ga0495607_0003902
708 Ga0495607_0005045
709 Ga0495607_0027538
710 Ga0495607_0072145
711 Ga0495607_0093372
712 Ga0495607_0115698
713 Ga0495607_0179871
714 Ga0495583_0003204
715 Ga0495583_0011870
716 Ga0495606_0000151
717 Ga0495606_0003494
718 Ga0495606_0017942
719 Ga0495606_0044797
720 Ga0495606_0129613
721 Ga0495610_0002277
722 Ga0495610_0024792
723 Ga0495610_0025389
724 Ga0495610_0054372
725 Ga0495610_0056210
726 Ga0495610_0156452
727 Ga0495616_0001700
728 Ga0495616_0001714
729 Ga0495616_0011921
730 Ga0495616_0399277
731 Ga0495620_0000454
732 Ga0495620_0000851
733 Ga0495620_0001961
734 Ga0495620_0009088
735 Ga0495620_0029795
736 Ga0495620_0415860
737 Ga0495628_0064323
738 Ga0495630_0002286
739 Ga0495630_0006836
740 Ga0495631_0000488
741 Ga0495631_0001163
742 Ga0495631_0002717
743 Ga0495631_0045294
744 Ga0495631_0119549
745 Ga0495631_0191065
746 Ga0495632_0001292
747 Ga0495632_0005155
748 Ga0495632_0010935
749 Ga0495632_0016059
750 Ga0495632_0016134
751 Ga0495632_0040405
752 Ga0495632_0085935
753 Ga0495632_0105329
754 Ga0495632_0117470
755 Ga0495632_0128774
756 Ga0495632_0235788
757 Ga0495637_0001989
758 Ga0495637_0005094
759 Ga0495637_0008309
760 Ga0495637_0016433
761 Ga0495637_0016709
762 Ga0495637_0093469
763 Ga0495637_0118538
764 Ga0495637_0202656
765 Ga0495643_0005003
766 Ga0495643_0013306
767 Ga0495643_0038767
768 Ga0495643_0153990
769 Ga0495643_0158373
770 Ga0495643_0184883
771 Ga0495648_0003731
772 Ga0495648_0003891
773 Ga0495648_0006276
774 Ga0495648_0038739
775 Ga0495648_0092969
776 Ga0495648_0144797
777 Ga0495666_0001124
778 Ga0495666_0083132
779 Ga0495654_0000405
780 Ga0495654_0001918
781 Ga0495654_0002652
782 Ga0495654_0003715
783 Ga0495654_0005089
784 Ga0495654_0030526
785 Ga0495654_0061166
786 Ga0495654_0113263
787 Ga0495654_0159504
788 Ga0495654_0237459
789 Ga0495665_0149609
790 Ga0495587_0011114
791 Ga0495587_0094872
792 Ga0495609_0000006
793 Ga0495609_0001176
794 Ga0495609_0008391
795 Ga0495609_0010324
796 Ga0495609_0011794
797 Ga0495609_0079386
798 Ga0495609_0145650
799 Ga0495609_0316665
800 Ga0495597_0003333
801 Ga0495597_0054361
802 Ga0495597_0110888
803 Ga0495645_0770889
804 Ga0495633_0004331
805 Ga0495668_0005345
806 Ga0495668_0022695
807 Ga0495668_0059904
808 Ga0495634_0002180
809 Ga0495611_0080023
810 Ga0495625_0005248
811 Ga0495625_0006726
812 Ga0495625_0125222
813 Ga0495625_0136127
814 Ga0495625_0217840
815 Ga0495635_0000990
816 Ga0495661_0001172
817 Ga0495661_0012125
818 Ga0495661_0015712
819 Ga0495661_0025451
820 Ga0495661_0190312
821 Ga0495661_0218193
822 Ga0495657_0030373
823 Ga0495599_0105225
824 Ga0495623_0001930
825 Ga0495623_0005963
826 Ga0495646_0021532
827 Ga0495613_0095020
828 Ga0495624_0775076
829 Ga0495670_0210594
830 Ga0495671_0002745
831 Ga0495671_0018697
832 Ga0495671_0027476
833 Ga0495671_0089641
834 Ga0495671_0124778
835 Ga0495671_0313712
836 Ga0495671_0548392
837 Ga0495671_0613012
838 Ga0495671_0637218
839 Ga0495649_0003038
840 Ga0495649_0004810
841 Ga0495649_0008852
842 Ga0495649_0020971
843 Ga0495649_0022909
844 Ga0495649_0073760
845 Ga0495649_0176158
846 Ga0495589_0001025
847 Ga0495589_0300142
848 Ga0495600_0102592
849 Ga0495600_0715641
850 Ga0495660_0002035
851 Ga0495660_0002728
852 Ga0495660_0003972
853 Ga0495660_0004059
854 Ga0495660_0005931
855 Ga0495660_0016581
856 Ga0495660_0020852
857 Ga0495660_0056103
858 Ga0495660_0198847
859 Ga0495604_0014914
860 Ga0495604_0178984
861 Ga0495674_0003856
862 Ga0495672_0002299
863 Ga0495672_0007113
864 Ga0495672_0050040
865 Ga0495672_0197415
866 Ga0495676_0003312
867 Ga0495680_0025280
868 Ga0495680_0121427
869 Ga0495683_0000806
870 Ga0495683_0146394
871 Ga0495683_0185090
872 Ga0495675_0081868
873 Ga0495679_001860
874 Ga0495679_002188
875 Ga0495679_003492
876 Ga0495679_005331
877 Ga0495679_006441
878 Ga0495679_067388
879 Ga0495673_0001688
880 Ga0495673_0003362
881 Ga0495673_0004551
882 Ga0495673_0004808
883 Ga0495673_0007851
884 Ga0495673_0009883
885 Ga0495673_0103092
886 Ga0495673_0149182
887 Ga0495673_0254076
888 Ga0495681_0001617
889 Ga0495681_0001778
890 Ga0495681_0005183
891 Ga0495681_0012153
892 Ga0495681_0013285
893 Ga0495681_0018533
894 Ga0495681_0110650
895 Ga0495681_0213729
896 Ga0495681_0393180
897 Ga0495684_0032714
898 Ga0495686_0004004
899 Ga0495686_0005736
900 Ga0495593_0003875
901 Ga0495593_0088352
902 Ga0495602_0323493
903 Ga0495626_0002705
904 Ga0495626_0025110
905 Ga0495626_0038765
906 Ga0495626_0106584
907 Ga0495626_0129897
908 Ga0495626_0280265
909 Ga0495626_0389683
910 Ga0495626_0389688
911 Ga0496100_0647955
912 Ga0496102_0000897
913 Ga0496102_0030996
914 Ga0496103_0001672
915 Ga0496106_0145919
916 Ga0496106_0546602
917 Ga0496110_0793118
918 Ga0496112_0247958
919 Ga0496115_0052124
920 Ga0496116_0003051
921 Ga0496116_0004738
922 Ga0496116_0006230
923 Ga0496116_0008850
924 Ga0496116_0031227
925 Ga0496116_0319835
926 Ga0496117_0000951
927 Ga0496117_0004144
928 Ga0496117_0005741
929 Ga0496117_0041041
930 Ga0496117_0068092
931 Ga0496117_0098018
932 Ga0496117_0548787
933 Ga0496118_0009822
934 Ga0496118_0010381
935 Ga0496118_0011218
936 Ga0496118_0024388
937 Ga0496118_0329770
938 Ga0496118_0392202
939 Ga0496118_0402525
940 Ga0496118_0553311
941 Ga0496118_0570411
942 Ga0496119_0100806
943 Ga0496120_0106027
944 Ga0496121_0000518
945 Ga0496121_0001706
946 Ga0496121_0002316
947 Ga0496121_0008345
948 Ga0496121_0103203
949 Ga0496121_0404638
950 Ga0496121_0557515
951 Ga0496122_0004139
952 Ga0496122_0011827
953 Ga0496122_0092796
954 Ga0496122_0143126
955 Ga0496123_0003178
956 Ga0496123_0007295
957 Ga0496123_0019576
958 Ga0496123_0063397
959 Ga0496124_0002322
960 Ga0496124_0017209
961 Ga0496124_0032254
962 Ga0496124_0232404
963 Ga0496124_0416324
964 Ga0496125_0009805
965 Ga0496125_0030832
966 Ga0496125_0044646
967 Ga0496125_0596905
968 Ga0496126_0265634
969 Ga0496126_0429391
970 Ga0496126_1388555
971 Ga0495678_001621
972 Ga0495678_002275
973 Ga0495678_008845
974 Ga0495678_018141
975 Ga0495678_090654
976 Ga0495682_0001846
977 Ga0495682_0010148
978 Ga0495682_0064900
979 nmdc:mga00v17_976641_c1
980 nmdc:mga08x19_162920_c1
981 Ga0500572_000925
982 2600443358
983 2602009178
984 2919501703
985 2926063376
986 3007255935
987 3007319993
988 8034962950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09493

DUF2389

Tryptophan-rich protein (DUF2389)

28

87

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c16-assembly1.cif.gz_A crystal structure of asymmetric ferredoxin/flavodoxin nadp+ oxidoreductase 2 (fnr2) h326v mutant from bacillus cereus 0.9134 26 56
5twb-assembly1.cif.gz_A oxidoreductase iruo in the reduced form 0.9006 26 56
7ytv-assembly1.cif.gz_A crystal structure of aspergillus fumigatus thioredoxin reductase in complex with auranofin 0.9 26 56
5uth-assembly1.cif.gz_A crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad 0.8976 26 56
6bwt-assembly1.cif.gz_A 2.45 angstrom resolution crystal structure thioredoxin reductase from francisella tularensis. 0.8935 26 56
ID Description Score Start End Superfamily
af_Q57681_481_577_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.9108 40 56 3.40.50.800
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8976 26 56 3.50.50.60
af_Q06817_503_612_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8936 40 56 3.40.50.800
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8894 26 56 3.50.50.60
af_Q4DY51_38_295_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8829 28 56 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0F9UUE0-F1-model_v4 Uncharacterized protein 0.949 27 63
AF-A0A4Q7LTH5-F1-model_v4 TIGR02450 family Trp-rich protein 0.9367 3 67
AF-A0A1Y2CBG3-F1-model_v4 BHLH domain-containing protein 0.9339 26 56 GO:0046983
AF-A0A5S9INN4-F1-model_v4 TIGR02450 family Trp-rich protein 0.9315 4 67
AF-A0A358G2L6-F1-model_v4 deleted 0.931 26 56

Map