F454575

General Info

Members Datasets Scaffolds Average Seq Length
494 281 988 211

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10315792|Ga0182008_103157921
Length 235
Sequence MSDTIGIADISNISDTSRIEGIAAALPTPNLDTDQIMPKQFLRGIDKTGLDQGLLYDLRHDADHRLRPDFVLNQSAYQGASIIVAGSNFGCGSSREHAVWGLQQFGIRAVIAPSFGEIFYSNAMNNRLLLVMLPETDVQRIIEDVSDPLASKVLIDVNSMTVRSRSVEAAFSLSARHRRMFLEGLDVIGATLSLQDEISAFQQQHWQRRPWLHDIAHATRARINASSPAKPSGNR

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
80 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
159 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
160 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
221 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
246 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
254 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
255 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
256 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
257 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
258 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
259 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
260 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
261 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
262 2738541337 Pelomonas sp. BT06 Isolate Unclassified
263 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
264 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
265 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
266 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
267 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
268 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
269 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
270 2831864461 Roseateles noduli HZ7 Isolate Nodule
271 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
272 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
273 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
274 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
275 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
276 2909042592 Labrys sp. LIt4 Isolate Nodule
277 2928058823 Ralstonia sp. 1138 Isolate Unclassified
278 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
279 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
280 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
281 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.93
Metatranscriptomes 0.2
Isolates 5.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.71
Nodule 1.01
Rhizoplane 1.42
Rhizosphere 57.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10315792 3300014497 Bacteria 821
2 JGI24741J21665_1000056 3300001915 Bacteria 27413
3 JGI24740J21852_10000472 3300001979 Bacteria 17311
4 JGI24740J21852_10000969 3300001979 Bacteria 12785
5 JGI24739J22299_10001406 3300001989 Bacteria 9065
6 JGI24735J21928_10003222 3300002067 Bacteria 5578
7 JGI25155J39150_1000096 3300002704 Bacteria 49227
8 JGI25155J39150_1000135 3300002704 Bacteria 34998
9 JGI25156J39149_1000274 3300002705 Bacteria 35007
10 JGI25156J39149_1008194 3300002705 Bacteria 2658
11 JGI25156J39149_1010258 3300002705 Bacteria 2213
12 JGI25154J39366_1000129 3300002738 Bacteria 59399
13 JGI25154J39366_1000146 3300002738 Bacteria 55646
14 JGI25154J39366_1000248 3300002738 Bacteria 34998
15 JGI25157J39369_1000225 3300002741 Bacteria 44469
16 JGI25159J45721_1001971 3300002987 Bacteria 8179
17 JGI25151J46595_10001449 3300003187 Bacteria 16081
18 JGI25151J46595_10013163 3300003187 Bacteria 3732
19 JGI25151J46595_10024749 3300003187 Bacteria 2453
20 JGI25153J46596_10020082 3300003215 Bacteria 2536
21 rootH2_10037016 3300003320 Bacteria 4604
22 rootL2_10001457 3300003322 Bacteria 117785
23 rootH1_10020269 3300003323 Bacteria 14185
24 rootH1_10148185 3300003323 Bacteria 2248
25 Ga0055538_1000059 3300003751 Bacteria 112508
26 Ga0055539_1000034 3300003752 Bacteria 223400
27 Ga0055539_1000089 3300003752 Bacteria 112508
28 Ga0055533_1000098 3300003756 Bacteria 112508
29 Ga0055533_1001791 3300003756 Bacteria 5412
30 Ga0055532_1000002 3300003758 Bacteria 576000
31 Ga0055532_1000015 3300003758 Bacteria 340197
32 Ga0055525_1000130 3300003759 Bacteria 112508
33 Ga0055525_1000285 3300003759 Bacteria 46348
34 Ga0055527_1001388 3300003760 Bacteria 5144
35 Ga0055542_1000724 3300003762 Bacteria 25809
36 Ga0055529_1000028 3300003763 Bacteria 287650
37 Ga0055526_1000917 3300003771 Bacteria 21919
38 Ga0055526_1002371 3300003771 Bacteria 12763
39 Ga0055526_1002634 3300003771 Bacteria 11990
40 Ga0055526_1008492 3300003771 Bacteria 5117
41 Ga0055526_1013063 3300003771 Bacteria 3550
42 Ga0055537_1005786 3300003773 Bacteria 3248
43 Ga0055524_1000310 3300003775 Bacteria 46341
44 Ga0055524_1000557 3300003775 Bacteria 28144
45 Ga0055536_1000031 3300003781 Bacteria 151112
46 Ga0055534_1001179 3300003784 Bacteria 10987
47 Ga0055534_1011103 3300003784 Bacteria 1848
48 Ga0055530_10000039 3300003791 Bacteria 115587
49 Ga0055540_1044499 3300003792 Bacteria 942
50 Ga0055531_10003703 3300003794 Bacteria 9618
51 Ga0055541_1000061 3300003841 Bacteria 112508
52 Ga0055541_1000327 3300003841 Bacteria 15408
53 Ga0055543_1004116 3300004625 Bacteria 4054
54 Ga0055543_1007411 3300004625 Bacteria 2539
55 Ga0055543_1014303 3300004625 Bacteria 1549
56 Ga0065165_1000007 3300005262 Bacteria 337871
57 Ga0065165_1000170 3300005262 Bacteria 115389
58 Ga0065165_1000950 3300005262 Bacteria 36689
59 Ga0065165_1000951 3300005262 Bacteria 36549
60 Ga0070658_10365950 3300005327 Bacteria 1235
61 Ga0070670_100724611 3300005331 Bacteria 895
62 Ga0070680_100084521 3300005336 Bacteria 2621
63 Ga0070682_100072227 3300005337 Bacteria 2211
64 Ga0070661_100000063 3300005344 Bacteria 85407
65 Ga0070669_100514187 3300005353 Bacteria 995
66 Ga0070659_100002495 3300005366 Bacteria 13070
67 Ga0070663_100000006 3300005455 Bacteria 208068
68 Ga0070681_10052839 3300005458 Bacteria 4052
69 Ga0070679_100114848 3300005530 Bacteria 2678
70 Ga0068853_100001980 3300005539 Bacteria 15101
71 Ga0068853_100133720 3300005539 Bacteria 2222
72 Ga0068855_100242651 3300005563 Bacteria 2012
73 Ga0070664_100000002 3300005564 Bacteria 458815
74 Ga0068857_100016053 3300005577 Bacteria 6561
75 Ga0068854_100000093 3300005578 Bacteria 63395
76 Ga0068856_100000028 3300005614 Bacteria 131498
77 Ga0068856_100448500 3300005614 Bacteria 1311
78 Ga0068856_100715232 3300005614 Bacteria 1022
79 Ga0070702_100566021 3300005615 Bacteria 846
80 Ga0068852_100973083 3300005616 Bacteria 867
81 Ga0070717_10001896 3300006028 Bacteria 14628
82 Ga0070717_10208306 3300006028 Bacteria 1715
83 Ga0075365_10035446 3300006038 Bacteria 3228
84 Ga0075364_10019655 3300006051 Bacteria 4240
85 Ga0075364_10103295 3300006051 Bacteria 1898
86 Ga0075364_10413323 3300006051 Bacteria 921
87 Ga0075367_10139219 3300006178 Bacteria 1503
88 Ga0075366_10015095 3300006195 Bacteria 4419
89 Ga0075366_10027013 3300006195 Bacteria 3366
90 Ga0075430_100154152 3300006846 Bacteria 1913
91 Ga0075429_100004508 3300006880 Bacteria 11984
92 Ga0099824_1052383 3300006942 Bacteria 737
93 Ga0099823_1000176 3300006944 Bacteria 35142
94 Ga0105251_10000032 3300009011 Bacteria 120825
95 Ga0105250_10000241 3300009092 Bacteria 45446
96 Ga0105240_10001507 3300009093 Bacteria 39670
97 Ga0105240_10003721 3300009093 Bacteria 23562
98 Ga0105240_10007856 3300009093 Bacteria 15393
99 Ga0105240_10034772 3300009093 Bacteria 6497
100 Ga0105245_10775263 3300009098 Bacteria 996
101 Ga0105241_10124890 3300009174 Bacteria 2077
102 Ga0105238_10257564 3300009551 Bacteria 1724
103 Ga0105238_10420570 3300009551 Bacteria 1331
104 Ga0105238_10446268 3300009551 Bacteria 1290
105 Ga0105238_10653355 3300009551 Bacteria 1062
106 Ga0105239_10000164 3300010375 Bacteria 95286
107 Ga0157319_1000003 3300012497 Bacteria 397199
108 Ga0157373_10003150 3300013100 Bacteria 12461
109 Ga0157371_10000123 3300013102 Bacteria 118119
110 Ga0157370_10000013 3300013104 Bacteria 198861
111 Ga0157369_10001233 3300013105 Bacteria 31886
112 Ga0157374_10021590 3300013296 Bacteria 5732
113 Ga0157374_11132978 3300013296 Bacteria 803
114 Ga0182008_10024918 3300014497 Bacteria 3042
115 Ga0182008_10046782 3300014497 Bacteria 2150
116 Ga0157379_10539055 3300014968 Bacteria 1085
117 Ga0182006_1000825 3300015261 Bacteria 20755
118 Ga0182006_1031139 3300015261 Bacteria 2152
119 Ga0154015_1060010 3300020610 Bacteria 7487
120 Ga0213872_10003175 3300021361 Bacteria 9221
121 Ga0213872_10008282 3300021361 Bacteria 5036
122 Ga0213872_10044591 3300021361 Bacteria 2018
123 Ga0209435_100021 3300025206 Bacteria 223961
124 Ga0209435_100057 3300025206 Bacteria 82390
125 Ga0209784_100003 3300025224 Bacteria 1379451
126 Ga0209784_100018 3300025224 Bacteria 456816
127 Ga0209784_100605 3300025224 Bacteria 11539
128 Ga0209784_101097 3300025224 Bacteria 4506
129 Ga0209566_100002 3300025225 Bacteria 2614868
130 Ga0209566_100016 3300025225 Bacteria 456824
131 Ga0209566_100639 3300025225 Bacteria 21283
132 Ga0209566_101900 3300025225 Bacteria 4630
133 Ga0209674_100008 3300025226 Bacteria 1076909
134 Ga0209674_100030 3300025226 Bacteria 456824
135 Ga0209674_100135 3300025226 Bacteria 113826
136 Ga0209674_105961 3300025226 Bacteria 1724
137 Ga0209672_101335 3300025228 Bacteria 9350
138 Ga0209147_100002 3300025229 Bacteria 2158988
139 Ga0209147_100004 3300025229 Bacteria 1371850
140 Ga0209563_100004 3300025230 Bacteria 1814108
141 Ga0209563_100034 3300025230 Bacteria 456824
142 Ga0207427_100551 3300025231 Bacteria 19055
143 Ga0209258_100002 3300025242 Bacteria 2158988
144 Ga0209258_100083 3300025242 Bacteria 246008
145 Ga0209646_1000027 3300025246 Bacteria 395141
146 Ga0209646_1000061 3300025246 Bacteria 255495
147 Ga0209646_1000074 3300025246 Bacteria 223961
148 Ga0209026_1000058 3300025250 Bacteria 228656
149 Ga0209026_1000462 3300025250 Bacteria 31297
150 Ga0209026_1003042 3300025250 Bacteria 5766
151 Ga0209677_100009 3300025253 Bacteria 749530
152 Ga0209677_100019 3300025253 Bacteria 456824
153 Ga0209677_104663 3300025253 Bacteria 3871
154 Ga0209148_1000019 3300025254 Bacteria 748518
155 Ga0209148_1013294 3300025254 Bacteria 1484
156 Ga0209759_1000046 3300025256 Bacteria 230149
157 Ga0209759_1000371 3300025256 Bacteria 56139
158 Ga0209759_1001486 3300025256 Bacteria 13022
159 Ga0209759_1006799 3300025256 Bacteria 3790
160 Ga0209759_1008760 3300025256 Bacteria 3125
161 Ga0209565_1000374 3300025263 Bacteria 38256
162 Ga0209565_1019667 3300025263 Bacteria 1438
163 Ga0209455_1000021 3300025272 Bacteria 699993
164 Ga0209673_1009477 3300025273 Bacteria 4210
165 Ga0209673_1053365 3300025273 Bacteria 1055
166 Ga0209130_1000047 3300025284 Bacteria 234691
167 Ga0209130_1000116 3300025284 Bacteria 129549
168 Ga0209130_1001008 3300025284 Bacteria 21864
169 Ga0209130_1017285 3300025284 Bacteria 1722
170 Ga0209675_1000231 3300025291 Bacteria 56755
171 Ga0209675_1000557 3300025291 Bacteria 27014
172 Ga0209675_1004819 3300025291 Bacteria 5853
173 Ga0209675_1035446 3300025291 Bacteria 1137
174 Ga0209676_1000036 3300025292 Bacteria 457623
175 Ga0209676_1003002 3300025292 Bacteria 10969
176 Ga0209025_1000345 3300025294 Bacteria 100876
177 Ga0209025_1000371 3300025294 Bacteria 94612
178 Ga0209025_1001077 3300025294 Bacteria 39567
179 Ga0209564_1000003 3300025295 Bacteria 1585848
180 Ga0209564_1000878 3300025295 Bacteria 39964
181 Ga0209564_1001207 3300025295 Bacteria 29501
182 Ga0209564_1001260 3300025295 Bacteria 27874
183 Ga0209564_1013356 3300025295 Bacteria 3497
184 Ga0209758_1000885 3300025297 Bacteria 41066
185 Ga0209758_1044704 3300025297 Bacteria 1615
186 Ga0209050_1000073 3300025298 Bacteria 292046
187 Ga0209050_1008757 3300025298 Bacteria 5324
188 Ga0209050_1009014 3300025298 Bacteria 5196
189 Ga0209050_1058260 3300025298 Bacteria 929
190 Ga0209256_1000061 3300025299 Bacteria 260890
191 Ga0209256_1000150 3300025299 Bacteria 146086
192 Ga0209256_1000846 3300025299 Bacteria 38261
193 Ga0209256_1024631 3300025299 Bacteria 1768
194 Ga0207426_1023407 3300025302 Bacteria 2108
195 Ga0207426_1063916 3300025302 Bacteria 1048
196 Ga0209051_1065246 3300025303 Bacteria 1124
197 Ga0209257_1000099 3300025304 Bacteria 255304
198 Ga0209257_1000318 3300025304 Bacteria 101186
199 Ga0209257_1017235 3300025304 Bacteria 2860
200 Ga0207696_1000363 3300025711 Bacteria 45454
201 Ga0207713_1000020 3300025735 Bacteria 359258
202 Ga0207699_10480746 3300025906 Bacteria 894
203 Ga0207654_10217616 3300025911 Bacteria 1265
204 Ga0207707_10046024 3300025912 Bacteria 3800
205 Ga0207695_10000437 3300025913 Bacteria 91491
206 Ga0207695_10004043 3300025913 Bacteria 20183
207 Ga0207695_10031413 3300025913 Bacteria 5824
208 Ga0207695_10039598 3300025913 Bacteria 5065
209 Ga0207660_10082493 3300025917 Bacteria 2365
210 Ga0207657_10227990 3300025919 Bacteria 1491
211 Ga0207652_10188094 3300025921 Bacteria 1857
212 Ga0207681_10509892 3300025923 Bacteria 986
213 Ga0207650_10794462 3300025925 Bacteria 802
214 Ga0207690_10003536 3300025932 Bacteria 9310
215 Ga0207679_10000001 3300025945 Bacteria 777444
216 Ga0207640_10000113 3300025981 Bacteria 60850
217 Ga0207639_10009334 3300026041 Bacteria 6765
218 Ga0207639_10061581 3300026041 Bacteria 2899
219 Ga0207678_10000001 3300026067 Bacteria 433184
220 Ga0207678_10336928 3300026067 Bacteria 1299
221 Ga0207702_10000009 3300026078 Bacteria 305906
222 Ga0207702_10243162 3300026078 Bacteria 1687
223 Ga0207702_11108935 3300026078 Bacteria 785
224 Ga0207674_10001809 3300026116 Bacteria 27292
225 Ga0207698_10605455 3300026142 Bacteria 1081
226 Ga0209371_1016267 3300027312 Bacteria 1969
227 Ga0265334_10011529 3300028573 Bacteria 3720
228 Ga0265318_10055555 3300028577 Bacteria 1481
229 Ga0265336_10011731 3300028666 Bacteria 2968
230 Ga0307515_10005239 3300028794 Bacteria 26356
231 Ga0307515_10006245 3300028794 Bacteria 23915
232 Ga0265338_10130778 3300028800 Bacteria 1982
233 Ga0265338_10326192 3300028800 Bacteria 1110
234 Ga0268256_1018079 3300030500 Bacteria 1969
235 Ga0265330_10000123 3300031235 Bacteria 63356
236 Ga0265332_10019026 3300031238 Bacteria 3032
237 Ga0265328_10009371 3300031239 Bacteria 3990
238 Ga0265320_10009485 3300031240 Bacteria 5867
239 Ga0265325_10075417 3300031241 Bacteria 1684
240 Ga0265329_10014101 3300031242 Bacteria 2829
241 Ga0265340_10004286 3300031247 Bacteria 7998
242 Ga0265340_10049319 3300031247 Bacteria 2045
243 Ga0265339_10007645 3300031249 Bacteria 6959
244 Ga0265331_10013355 3300031250 Bacteria 4420
245 Ga0265331_10041723 3300031250 Bacteria 2229
246 Ga0265316_10006591 3300031344 Bacteria 11068
247 Ga0265316_10028078 3300031344 Bacteria 4646
248 Ga0307513_10103580 3300031456 Bacteria 2861
249 Ga0307513_10436067 3300031456 Bacteria 1037
250 Ga0265313_10005125 3300031595 Bacteria 9757
251 Ga0265313_10061021 3300031595 Bacteria 1766
252 Ga0307514_10001051 3300031649 Bacteria 39603
253 Ga0307514_10003111 3300031649 Bacteria 16325
254 Ga0265314_10001814 3300031711 Bacteria 23024
255 Ga0265342_10008363 3300031712 Bacteria 7427
256 Ga0265342_10012811 3300031712 Bacteria 5660
257 Ga0307412_10505949 3300031911 Bacteria 1006
258 Ga0307510_10169582 3300033180 Bacteria 1764
259 Ga0395899_0000598 3300037312 Bacteria 37911
260 Ga0395899_0129385 3300037312 Bacteria 1804
261 Ga0395900_0003747 3300037418 Bacteria 16332
262 Ga0395900_0058275 3300037418 Bacteria 3976
263 Ga0395905_0255252 3300037471 Bacteria 1638
264 Ga0395905_0769692 3300037471 Bacteria 865
265 Ga0395901_0705967 3300038443 Bacteria 1006
266 Ga0436361_0459515 3300039447 Bacteria 8317
267 Ga0436361_0674317 3300039447 Bacteria 1257
268 Ga0436361_0755803 3300039447 Bacteria 16014
269 Ga0436361_0988282 3300039447 Bacteria 919
270 Ga0436361_1185595 3300039447 Bacteria 3727
271 Ga0439459_0000524 3300042438 Bacteria 5062
272 Ga0466969_0001355 3300044656 Bacteria 13213
273 Ga0466969_0030196 3300044656 Bacteria 2762
274 Ga0466969_0063323 3300044656 Bacteria 1793
275 Ga0466972_0000262 3300044658 Bacteria 34359
276 Ga0466972_0066469 3300044658 Bacteria 1723
277 Ga0466972_0117040 3300044658 Bacteria 1257
278 Ga0466973_0021554 3300044659 Bacteria 6168
279 Ga0466977_0142860 3300044666 Bacteria 1555
280 Ga0466982_0009788 3300044672 Bacteria 4934
281 Ga0466965_0007291 3300044683 Bacteria 5071
282 Ga0466965_0028094 3300044683 Bacteria 2731
283 Ga0466965_0049862 3300044683 Bacteria 2075
284 Ga0466965_0064687 3300044683 Bacteria 1831
285 Ga0466965_0109008 3300044683 Bacteria 1422
286 Ga0466966_0004556 3300044684 Bacteria 9132
287 Ga0466966_0007057 3300044684 Bacteria 7442
288 Ga0466966_0011599 3300044684 Bacteria 5841
289 Ga0466966_0018076 3300044684 Bacteria 4654
290 Ga0466961_0000026 3300044693 Bacteria 92667
291 Ga0466961_0044431 3300044693 Bacteria 2842
292 Ga0466961_0046031 3300044693 Bacteria 2791
293 Ga0466963_0005157 3300044694 Bacteria 7628
294 Ga0466963_0046471 3300044694 Bacteria 2863
295 Ga0466963_0082779 3300044694 Bacteria 2176
296 Ga0466963_0126652 3300044694 Bacteria 1761
297 Ga0466964_0059771 3300044706 Bacteria 1583
298 Ga0466964_0080062 3300044706 Bacteria 1400
299 Ga0466971_0000370 3300044719 Bacteria 17315
300 Ga0466971_0019804 3300044719 Bacteria 2988
301 Ga0466971_0041696 3300044719 Bacteria 2062
302 Ga0466971_0049236 3300044719 Bacteria 1896
303 Ga0466971_0231198 3300044719 Bacteria 878
304 Ga0466968_0006335 3300044735 Bacteria 4457
305 Ga0466968_0012372 3300044735 Bacteria 3340
306 Ga0466970_0000060 3300044765 Bacteria 42753
307 Ga0466970_0014898 3300044765 Bacteria 3998
308 Ga0466970_0015516 3300044765 Bacteria 3919
309 Ga0466970_0030993 3300044765 Bacteria 2822
310 Ga0466970_0121706 3300044765 Bacteria 1430
311 Ga0466970_0679154 3300044765 Bacteria 600
312 Ga0466957_0005548 3300044842 Bacteria 7087
313 Ga0466957_0008336 3300044842 Bacteria 5893
314 Ga0466957_0070213 3300044842 Bacteria 2164
315 Ga0466957_0078687 3300044842 Bacteria 2050
316 Ga0466957_0096877 3300044842 Bacteria 1854
317 Ga0466957_0143670 3300044842 Bacteria 1539
318 Ga0466960_0005490 3300044901 Bacteria 5027
319 Ga0466960_0035225 3300044901 Bacteria 2337
320 Ga0466959_0000129 3300045049 Bacteria 48753
321 Ga0466959_0010455 3300045049 Bacteria 6638
322 Ga0466958_0007619 3300045836 Bacteria 5963
323 Ga0466958_0018682 3300045836 Bacteria 4027
324 Ga0466958_0085077 3300045836 Bacteria 1951
325 Ga0466958_0157297 3300045836 Bacteria 1435
326 Ga0466967_0078753 3300045976 Bacteria 2969
327 Ga0466967_0258982 3300045976 Bacteria 1664
328 Ga0495592_0102794 3300046454 Bacteria 2034
329 Ga0495590_0056921 3300046457 Bacteria 1366
330 Ga0495591_007902 3300046458 Bacteria 4436
331 Ga0495638_0022191 3300046460 Bacteria 4170
332 Ga0495638_0192722 3300046460 Bacteria 1156
333 Ga0495650_0000319 3300046471 Bacteria 86032
334 Ga0495650_0012554 3300046471 Bacteria 4549
335 Ga0495605_0004116 3300046474 Bacteria 8575
336 Ga0495605_0007989 3300046474 Bacteria 5990
337 Ga0495605_0008250 3300046474 Bacteria 5891
338 Ga0495605_0194643 3300046474 Bacteria 886
339 Ga0495664_0081483 3300046477 Bacteria 1940
340 Ga0495584_0001679 3300046491 Bacteria 12982
341 Ga0495584_0004394 3300046491 Bacteria 7590
342 Ga0495584_0079221 3300046491 Bacteria 1653
343 Ga0495585_0036172 3300046492 Bacteria 2787
344 Ga0495596_0001148 3300046500 Bacteria 15580
345 Ga0495596_0004622 3300046500 Bacteria 6666
346 Ga0495596_0008967 3300046500 Bacteria 4419
347 Ga0495596_0022198 3300046500 Bacteria 2585
348 Ga0495596_0028863 3300046500 Bacteria 2225
349 Ga0495607_0005309 3300046501 Bacteria 9263
350 Ga0495607_0211302 3300046501 Bacteria 955
351 Ga0495606_0000070 3300046507 Bacteria 177343
352 Ga0495610_0007512 3300046512 Bacteria 7237
353 Ga0495616_0008939 3300046513 Bacteria 5887
354 Ga0495616_0152057 3300046513 Bacteria 1046
355 Ga0495631_0021112 3300046518 Bacteria 3034
356 Ga0495631_0094288 3300046518 Bacteria 1288
357 Ga0495632_0021928 3300046519 Bacteria 3432
358 Ga0495632_0033371 3300046519 Bacteria 2643
359 Ga0495643_0022469 3300046522 Bacteria 3599
360 Ga0495643_0026955 3300046522 Bacteria 3235
361 Ga0495643_0068851 3300046522 Bacteria 1862
362 Ga0495644_0023122 3300046523 Bacteria 2367
363 Ga0495648_0003509 3300046524 Bacteria 13748
364 Ga0495648_0008764 3300046524 Bacteria 7918
365 Ga0495648_0050914 3300046524 Bacteria 2527
366 Ga0495663_0000857 3300046525 Bacteria 10304
367 Ga0495666_0031026 3300046526 Bacteria 2620
368 Ga0495642_0004145 3300046528 Bacteria 5653
369 Ga0495642_0024392 3300046528 Bacteria 2392
370 Ga0495642_0073131 3300046528 Bacteria 1436
371 Ga0495665_0063667 3300046531 Bacteria 1947
372 Ga0495586_0114630 3300046535 Bacteria 1502
373 Ga0495609_0020049 3300046538 Bacteria 3090
374 Ga0495621_0001901 3300046539 Bacteria 5486
375 Ga0495633_0016088 3300046558 Bacteria 3868
376 Ga0495656_0022528 3300046615 Bacteria 2468
377 Ga0495656_0470881 3300046615 Bacteria 664
378 Ga0495668_0000020 3300046616 Bacteria 411641
379 Ga0495668_0075944 3300046616 Bacteria 1845
380 Ga0495668_0086716 3300046616 Bacteria 1717
381 Ga0495611_0007822 3300046648 Bacteria 4537
382 Ga0495625_0008511 3300046660 Bacteria 8746
383 Ga0495625_0012981 3300046660 Bacteria 6721
384 Ga0495625_0281019 3300046660 Bacteria 1071
385 Ga0495661_0004430 3300046665 Bacteria 10138
386 Ga0495661_0005278 3300046665 Bacteria 9185
387 Ga0495661_0014046 3300046665 Bacteria 5367
388 Ga0495661_0082038 3300046665 Bacteria 1857
389 Ga0495661_0153898 3300046665 Bacteria 1240
390 Ga0495588_0000563 3300046674 Bacteria 17722
391 Ga0495623_0276310 3300046679 Bacteria 936
392 Ga0495646_0239154 3300046680 Bacteria 976
393 Ga0495669_0032434 3300046684 Bacteria 2296
394 Ga0495669_0080372 3300046684 Bacteria 1496
395 Ga0495670_0086720 3300046691 Bacteria 1599
396 Ga0495649_0001856 3300046694 Bacteria 15480
397 Ga0495649_0008012 3300046694 Bacteria 6384
398 Ga0495649_0027491 3300046694 Bacteria 3157
399 Ga0495589_0006168 3300046794 Bacteria 6328
400 Ga0495660_0004028 3300046810 Bacteria 8971
401 Ga0495660_0015670 3300046810 Bacteria 4377
402 Ga0495660_0192440 3300046810 Bacteria 979
403 Ga0495674_0492238 3300047319 Bacteria 982
404 Ga0495676_0000092 3300047321 Bacteria 66361
405 Ga0495683_0013463 3300047323 Bacteria 4278
406 Ga0495687_032014 3300047443 Bacteria 2406
407 Ga0495687_077735 3300047443 Bacteria 1309
408 Ga0495675_0115471 3300047444 Bacteria 1674
409 Ga0495677_0041977 3300047445 Bacteria 1675
410 Ga0495673_0000008 3300047469 Bacteria 752462
411 Ga0495673_0006697 3300047469 Bacteria 6746
412 Ga0495681_0252752 3300047470 Bacteria 695
413 Ga0495686_0000337 3300047472 Bacteria 77142
414 Ga0495686_0000479 3300047472 Bacteria 59585
415 Ga0495686_0003533 3300047472 Bacteria 13466
416 Ga0495615_0000493 3300048090 Bacteria 5672
417 Ga0495626_0046517 3300048091 Bacteria 2021
418 Ga0496102_0007285 3300048905 Bacteria 9441
419 Ga0496114_0004013 3300048917 Bacteria 11374
420 Ga0496116_0180479 3300048919 Bacteria 1131
421 Ga0496116_0305649 3300048919 Bacteria 754
422 Ga0496117_0064092 3300048920 Bacteria 2508
423 Ga0496117_0097773 3300048920 Bacteria 1868
424 Ga0496118_0105378 3300048921 Bacteria 1890
425 Ga0496121_0000072 3300048924 Bacteria 244975
426 Ga0496121_0002477 3300048924 Bacteria 28134
427 Ga0496121_0010557 3300048924 Bacteria 10389
428 Ga0496122_0161493 3300048925 Bacteria 1366
429 Ga0496124_0010449 3300048927 Bacteria 9396
430 Ga0496124_0075763 3300048927 Bacteria 2779
431 Ga0496124_0250150 3300048927 Bacteria 1311
432 Ga0496125_0003735 3300048928 Bacteria 18132
433 Ga0496125_0015215 3300048928 Bacteria 7450
434 Ga0496125_0057128 3300048928 Bacteria 3163
435 Ga0496126_0003963 3300048929 Bacteria 18091
436 Ga0496126_0007972 3300048929 Bacteria 11505
437 Ga0496126_0773111 3300048929 Bacteria 739
438 Ga0495678_009040 3300049459 Bacteria 4973
439 Ga0495678_010050 3300049459 Bacteria 4622
440 Ga0495682_0000874 3300049460 Bacteria 18715
441 Ga0495682_0002198 3300049460 Bacteria 9440
442 Ga0501034_0000447 3300049571 Bacteria 68166
443 Ga0501034_0327768 3300049571 Bacteria 1463
444 Ga0501269_000543 3300049766 Bacteria 7315
445 nmdc:mga00v17_11474_c1 3300050491 Bacteria 4868
446 nmdc:mga00v17_352163_c1 3300050491 Bacteria 957
447 nmdc:mga0yw44_23085_c1 3300050492 Bacteria 3500
448 nmdc:mga0k408_36503_c1 3300050493 Bacteria 2821
449 nmdc:mga0k408_46363_c2 3300050493 Bacteria 2164
450 nmdc:mga06z11_460229_c1 3300050494 Bacteria 769
451 nmdc:mga09592_1310_c1 3300050508 Bacteria 19982
452 nmdc:mga0qj67_234237_c1 3300050509 Bacteria 1490
453 Ga0500643_001268 3300053087 Bacteria 14923
454 Ga0500594_0012334 3300053118 Bacteria 2012
455 Ga0500618_000044 3300053125 Bacteria 110159
456 Ga0500658_0009651 3300053134 Bacteria 3560
457 Ga0500622_0000070 3300053156 Bacteria 115284
458 Ga0500622_0005338 3300053156 Bacteria 7742
459 Ga0500622_0008407 3300053156 Bacteria 5775
460 Ga0500622_0110425 3300053156 Bacteria 1344
461 Ga0500634_0024337 3300053161 Bacteria 3293
462 Ga0500645_008492 3300053730 Bacteria 3504
463 Ga0466962_0003687 3300061719 Bacteria 7302
464 Ga0466962_0008488 3300061719 Bacteria 4922
465 Ga0466962_0036490 3300061719 Bacteria 2353
466 2511248399 2511231003 Bacteria 5606035
467 2599445499 2599185178 Bacteria 5365746
468 2599904316 2599185292 Bacteria 6290804
469 2599941294 2599185302 Bacteria 5954930
470 2599953186 2599185304 Bacteria 5951361
471 2738746902 2738541281 Bacteria 5112672
472 2738819988 2738541296 Bacteria 7285013
473 2738832468 2738541298 Bacteria 7286732
474 2738873995 2738541306 Bacteria 7284992
475 2739057205 2738541337 Bacteria 6183410
476 2739185625 2738543002 Bacteria 7284546
477 2739220593 2738543008 Bacteria 7282815
478 2739356132 2738543032 Bacteria 5115625
479 2794597991 2791355520 Bacteria 5948615
480 2819592261 2818991445 Bacteria 4955017
481 2819617852 2818991449 Bacteria 5518009
482 2821448378 2821443989 Bacteria 7658172
483 2831865099 2831864461 Bacteria 6502356
484 2834643548 2834641062 Bacteria 5559922
485 2886849118 2886848708 Bacteria 5632523
486 2887377398 2887375801 Bacteria 5334027
487 2900581114 2900577576 Bacteria 5438534
488 2901307943 2901300506 Bacteria 8463898
489 2909044372 2909042592 Bacteria 6499737
490 2928062832 2928058823 Bacteria 5520022
491 2945935544 2945934425 Bacteria 7444609
492 642422061 641736151 Bacteria 7477263
493 643600761 643348564 Bacteria 8839022
494 8003405286 8003400568 Bacteria 5535898
495 Ga0182008_10315792
496 JGI24741J21665_1000056
497 JGI24740J21852_10000472
498 JGI24740J21852_10000969
499 JGI24739J22299_10001406
500 JGI24735J21928_10003222
501 JGI25155J39150_1000096
502 JGI25155J39150_1000135
503 JGI25156J39149_1000274
504 JGI25156J39149_1008194
505 JGI25156J39149_1010258
506 JGI25154J39366_1000129
507 JGI25154J39366_1000146
508 JGI25154J39366_1000248
509 JGI25157J39369_1000225
510 JGI25159J45721_1001971
511 JGI25151J46595_10001449
512 JGI25151J46595_10013163
513 JGI25151J46595_10024749
514 JGI25153J46596_10020082
515 rootH2_10037016
516 rootL2_10001457
517 rootH1_10020269
518 rootH1_10148185
519 Ga0055538_1000059
520 Ga0055539_1000034
521 Ga0055539_1000089
522 Ga0055533_1000098
523 Ga0055533_1001791
524 Ga0055532_1000002
525 Ga0055532_1000015
526 Ga0055525_1000130
527 Ga0055525_1000285
528 Ga0055527_1001388
529 Ga0055542_1000724
530 Ga0055529_1000028
531 Ga0055526_1000917
532 Ga0055526_1002371
533 Ga0055526_1002634
534 Ga0055526_1008492
535 Ga0055526_1013063
536 Ga0055537_1005786
537 Ga0055524_1000310
538 Ga0055524_1000557
539 Ga0055536_1000031
540 Ga0055534_1001179
541 Ga0055534_1011103
542 Ga0055530_10000039
543 Ga0055540_1044499
544 Ga0055531_10003703
545 Ga0055541_1000061
546 Ga0055541_1000327
547 Ga0055543_1004116
548 Ga0055543_1007411
549 Ga0055543_1014303
550 Ga0065165_1000007
551 Ga0065165_1000170
552 Ga0065165_1000950
553 Ga0065165_1000951
554 Ga0070658_10365950
555 Ga0070670_100724611
556 Ga0070680_100084521
557 Ga0070682_100072227
558 Ga0070661_100000063
559 Ga0070669_100514187
560 Ga0070659_100002495
561 Ga0070663_100000006
562 Ga0070681_10052839
563 Ga0070679_100114848
564 Ga0068853_100001980
565 Ga0068853_100133720
566 Ga0068855_100242651
567 Ga0070664_100000002
568 Ga0068857_100016053
569 Ga0068854_100000093
570 Ga0068856_100000028
571 Ga0068856_100448500
572 Ga0068856_100715232
573 Ga0070702_100566021
574 Ga0068852_100973083
575 Ga0070717_10001896
576 Ga0070717_10208306
577 Ga0075365_10035446
578 Ga0075364_10019655
579 Ga0075364_10103295
580 Ga0075364_10413323
581 Ga0075367_10139219
582 Ga0075366_10015095
583 Ga0075366_10027013
584 Ga0075430_100154152
585 Ga0075429_100004508
586 Ga0099824_1052383
587 Ga0099823_1000176
588 Ga0105251_10000032
589 Ga0105250_10000241
590 Ga0105240_10001507
591 Ga0105240_10003721
592 Ga0105240_10007856
593 Ga0105240_10034772
594 Ga0105245_10775263
595 Ga0105241_10124890
596 Ga0105238_10257564
597 Ga0105238_10420570
598 Ga0105238_10446268
599 Ga0105238_10653355
600 Ga0105239_10000164
601 Ga0157319_1000003
602 Ga0157373_10003150
603 Ga0157371_10000123
604 Ga0157370_10000013
605 Ga0157369_10001233
606 Ga0157374_10021590
607 Ga0157374_11132978
608 Ga0182008_10024918
609 Ga0182008_10046782
610 Ga0157379_10539055
611 Ga0182006_1000825
612 Ga0182006_1031139
613 Ga0154015_1060010
614 Ga0213872_10003175
615 Ga0213872_10008282
616 Ga0213872_10044591
617 Ga0209435_100021
618 Ga0209435_100057
619 Ga0209784_100003
620 Ga0209784_100018
621 Ga0209784_100605
622 Ga0209784_101097
623 Ga0209566_100002
624 Ga0209566_100016
625 Ga0209566_100639
626 Ga0209566_101900
627 Ga0209674_100008
628 Ga0209674_100030
629 Ga0209674_100135
630 Ga0209674_105961
631 Ga0209672_101335
632 Ga0209147_100002
633 Ga0209147_100004
634 Ga0209563_100004
635 Ga0209563_100034
636 Ga0207427_100551
637 Ga0209258_100002
638 Ga0209258_100083
639 Ga0209646_1000027
640 Ga0209646_1000061
641 Ga0209646_1000074
642 Ga0209026_1000058
643 Ga0209026_1000462
644 Ga0209026_1003042
645 Ga0209677_100009
646 Ga0209677_100019
647 Ga0209677_104663
648 Ga0209148_1000019
649 Ga0209148_1013294
650 Ga0209759_1000046
651 Ga0209759_1000371
652 Ga0209759_1001486
653 Ga0209759_1006799
654 Ga0209759_1008760
655 Ga0209565_1000374
656 Ga0209565_1019667
657 Ga0209455_1000021
658 Ga0209673_1009477
659 Ga0209673_1053365
660 Ga0209130_1000047
661 Ga0209130_1000116
662 Ga0209130_1001008
663 Ga0209130_1017285
664 Ga0209675_1000231
665 Ga0209675_1000557
666 Ga0209675_1004819
667 Ga0209675_1035446
668 Ga0209676_1000036
669 Ga0209676_1003002
670 Ga0209025_1000345
671 Ga0209025_1000371
672 Ga0209025_1001077
673 Ga0209564_1000003
674 Ga0209564_1000878
675 Ga0209564_1001207
676 Ga0209564_1001260
677 Ga0209564_1013356
678 Ga0209758_1000885
679 Ga0209758_1044704
680 Ga0209050_1000073
681 Ga0209050_1008757
682 Ga0209050_1009014
683 Ga0209050_1058260
684 Ga0209256_1000061
685 Ga0209256_1000150
686 Ga0209256_1000846
687 Ga0209256_1024631
688 Ga0207426_1023407
689 Ga0207426_1063916
690 Ga0209051_1065246
691 Ga0209257_1000099
692 Ga0209257_1000318
693 Ga0209257_1017235
694 Ga0207696_1000363
695 Ga0207713_1000020
696 Ga0207699_10480746
697 Ga0207654_10217616
698 Ga0207707_10046024
699 Ga0207695_10000437
700 Ga0207695_10004043
701 Ga0207695_10031413
702 Ga0207695_10039598
703 Ga0207660_10082493
704 Ga0207657_10227990
705 Ga0207652_10188094
706 Ga0207681_10509892
707 Ga0207650_10794462
708 Ga0207690_10003536
709 Ga0207679_10000001
710 Ga0207640_10000113
711 Ga0207639_10009334
712 Ga0207639_10061581
713 Ga0207678_10000001
714 Ga0207678_10336928
715 Ga0207702_10000009
716 Ga0207702_10243162
717 Ga0207702_11108935
718 Ga0207674_10001809
719 Ga0207698_10605455
720 Ga0209371_1016267
721 Ga0265334_10011529
722 Ga0265318_10055555
723 Ga0265336_10011731
724 Ga0307515_10005239
725 Ga0307515_10006245
726 Ga0265338_10130778
727 Ga0265338_10326192
728 Ga0268256_1018079
729 Ga0265330_10000123
730 Ga0265332_10019026
731 Ga0265328_10009371
732 Ga0265320_10009485
733 Ga0265325_10075417
734 Ga0265329_10014101
735 Ga0265340_10004286
736 Ga0265340_10049319
737 Ga0265339_10007645
738 Ga0265331_10013355
739 Ga0265331_10041723
740 Ga0265316_10006591
741 Ga0265316_10028078
742 Ga0307513_10103580
743 Ga0307513_10436067
744 Ga0265313_10005125
745 Ga0265313_10061021
746 Ga0307514_10001051
747 Ga0307514_10003111
748 Ga0265314_10001814
749 Ga0265342_10008363
750 Ga0265342_10012811
751 Ga0307412_10505949
752 Ga0307510_10169582
753 Ga0395899_0000598
754 Ga0395899_0129385
755 Ga0395900_0003747
756 Ga0395900_0058275
757 Ga0395905_0255252
758 Ga0395905_0769692
759 Ga0395901_0705967
760 Ga0436361_0459515
761 Ga0436361_0674317
762 Ga0436361_0755803
763 Ga0436361_0988282
764 Ga0436361_1185595
765 Ga0439459_0000524
766 Ga0466969_0001355
767 Ga0466969_0030196
768 Ga0466969_0063323
769 Ga0466972_0000262
770 Ga0466972_0066469
771 Ga0466972_0117040
772 Ga0466973_0021554
773 Ga0466977_0142860
774 Ga0466982_0009788
775 Ga0466965_0007291
776 Ga0466965_0028094
777 Ga0466965_0049862
778 Ga0466965_0064687
779 Ga0466965_0109008
780 Ga0466966_0004556
781 Ga0466966_0007057
782 Ga0466966_0011599
783 Ga0466966_0018076
784 Ga0466961_0000026
785 Ga0466961_0044431
786 Ga0466961_0046031
787 Ga0466963_0005157
788 Ga0466963_0046471
789 Ga0466963_0082779
790 Ga0466963_0126652
791 Ga0466964_0059771
792 Ga0466964_0080062
793 Ga0466971_0000370
794 Ga0466971_0019804
795 Ga0466971_0041696
796 Ga0466971_0049236
797 Ga0466971_0231198
798 Ga0466968_0006335
799 Ga0466968_0012372
800 Ga0466970_0000060
801 Ga0466970_0014898
802 Ga0466970_0015516
803 Ga0466970_0030993
804 Ga0466970_0121706
805 Ga0466970_0679154
806 Ga0466957_0005548
807 Ga0466957_0008336
808 Ga0466957_0070213
809 Ga0466957_0078687
810 Ga0466957_0096877
811 Ga0466957_0143670
812 Ga0466960_0005490
813 Ga0466960_0035225
814 Ga0466959_0000129
815 Ga0466959_0010455
816 Ga0466958_0007619
817 Ga0466958_0018682
818 Ga0466958_0085077
819 Ga0466958_0157297
820 Ga0466967_0078753
821 Ga0466967_0258982
822 Ga0495592_0102794
823 Ga0495590_0056921
824 Ga0495591_007902
825 Ga0495638_0022191
826 Ga0495638_0192722
827 Ga0495650_0000319
828 Ga0495650_0012554
829 Ga0495605_0004116
830 Ga0495605_0007989
831 Ga0495605_0008250
832 Ga0495605_0194643
833 Ga0495664_0081483
834 Ga0495584_0001679
835 Ga0495584_0004394
836 Ga0495584_0079221
837 Ga0495585_0036172
838 Ga0495596_0001148
839 Ga0495596_0004622
840 Ga0495596_0008967
841 Ga0495596_0022198
842 Ga0495596_0028863
843 Ga0495607_0005309
844 Ga0495607_0211302
845 Ga0495606_0000070
846 Ga0495610_0007512
847 Ga0495616_0008939
848 Ga0495616_0152057
849 Ga0495631_0021112
850 Ga0495631_0094288
851 Ga0495632_0021928
852 Ga0495632_0033371
853 Ga0495643_0022469
854 Ga0495643_0026955
855 Ga0495643_0068851
856 Ga0495644_0023122
857 Ga0495648_0003509
858 Ga0495648_0008764
859 Ga0495648_0050914
860 Ga0495663_0000857
861 Ga0495666_0031026
862 Ga0495642_0004145
863 Ga0495642_0024392
864 Ga0495642_0073131
865 Ga0495665_0063667
866 Ga0495586_0114630
867 Ga0495609_0020049
868 Ga0495621_0001901
869 Ga0495633_0016088
870 Ga0495656_0022528
871 Ga0495656_0470881
872 Ga0495668_0000020
873 Ga0495668_0075944
874 Ga0495668_0086716
875 Ga0495611_0007822
876 Ga0495625_0008511
877 Ga0495625_0012981
878 Ga0495625_0281019
879 Ga0495661_0004430
880 Ga0495661_0005278
881 Ga0495661_0014046
882 Ga0495661_0082038
883 Ga0495661_0153898
884 Ga0495588_0000563
885 Ga0495623_0276310
886 Ga0495646_0239154
887 Ga0495669_0032434
888 Ga0495669_0080372
889 Ga0495670_0086720
890 Ga0495649_0001856
891 Ga0495649_0008012
892 Ga0495649_0027491
893 Ga0495589_0006168
894 Ga0495660_0004028
895 Ga0495660_0015670
896 Ga0495660_0192440
897 Ga0495674_0492238
898 Ga0495676_0000092
899 Ga0495683_0013463
900 Ga0495687_032014
901 Ga0495687_077735
902 Ga0495675_0115471
903 Ga0495677_0041977
904 Ga0495673_0000008
905 Ga0495673_0006697
906 Ga0495681_0252752
907 Ga0495686_0000337
908 Ga0495686_0000479
909 Ga0495686_0003533
910 Ga0495615_0000493
911 Ga0495626_0046517
912 Ga0496102_0007285
913 Ga0496114_0004013
914 Ga0496116_0180479
915 Ga0496116_0305649
916 Ga0496117_0064092
917 Ga0496117_0097773
918 Ga0496118_0105378
919 Ga0496121_0000072
920 Ga0496121_0002477
921 Ga0496121_0010557
922 Ga0496122_0161493
923 Ga0496124_0010449
924 Ga0496124_0075763
925 Ga0496124_0250150
926 Ga0496125_0003735
927 Ga0496125_0015215
928 Ga0496125_0057128
929 Ga0496126_0003963
930 Ga0496126_0007972
931 Ga0496126_0773111
932 Ga0495678_009040
933 Ga0495678_010050
934 Ga0495682_0000874
935 Ga0495682_0002198
936 Ga0501034_0000447
937 Ga0501034_0327768
938 Ga0501269_000543
939 nmdc:mga00v17_11474_c1
940 nmdc:mga00v17_352163_c1
941 nmdc:mga0yw44_23085_c1
942 nmdc:mga0k408_36503_c1
943 nmdc:mga0k408_46363_c2
944 nmdc:mga06z11_460229_c1
945 nmdc:mga09592_1310_c1
946 nmdc:mga0qj67_234237_c1
947 Ga0500643_001268
948 Ga0500594_0012334
949 Ga0500618_000044
950 Ga0500658_0009651
951 Ga0500622_0000070
952 Ga0500622_0005338
953 Ga0500622_0008407
954 Ga0500622_0110425
955 Ga0500634_0024337
956 Ga0500645_008492
957 Ga0466962_0003687
958 Ga0466962_0008488
959 Ga0466962_0036490
960 2511248399
961 2599445499
962 2599904316
963 2599941294
964 2599953186
965 2738746902
966 2738819988
967 2738832468
968 2738873995
969 2739057205
970 2739185625
971 2739220593
972 2739356132
973 2794597991
974 2819592261
975 2819617852
976 2821448378
977 2831865099
978 2834643548
979 2886849118
980 2887377398
981 2900581114
982 2901307943
983 2909044372
984 2928062832
985 2945935544
986 642422061
987 643600761
988 8003405286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

15

136

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.9476 1 174
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9453 5 174
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9184 5 174
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.9169 1 174
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9135 5 161
ID Description Score Start End Superfamily
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9603 5 177 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9556 5 174 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9519 6 174 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9453 5 174 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9186 5 177 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A4U3APZ6-F1-model_v4 deleted 0.9839 42 122
AF-A0A840RQA2-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9825 7 110 GO:0003861
GO:0009098
GO:0009316
AF-A0A5R8QTF1-F1-model_v4 deleted 0.9778 9 129
AF-A0A7K2L3S6-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9746 9 131 GO:0003861
GO:0009098
GO:0009316
AF-A0A3D5PKX6-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9733 7 111 GO:0003861
GO:0009098
GO:0009316

Map