F454580

General Info

Members Datasets Scaffolds Average Seq Length
494 263 988 281

Family's Representative Sequence

Representative Sequence 3300024227|Ga0228598_1010867|Ga0228598_10108672
Length 338
Sequence MKTTLYGGLLIFTILVLPPKASLTLGKAPFAIGTCRGSPQGAALPGIARDNCRAARYDVHMIVHLIDGTYELFRHYYGLRRSPGGERLRFGAVVGVLNTVLQMLGEGATHLGVATDHVIESFRNSLWSGYKTGQGVDPALLAQFEPLEDSLRAMGIPVWAMTELEADDALASAAAIASKDPRVKKICIWTPDKDLAQCVHEDRIVQVDRRTKIVRDANGVRAKFGVDPELIPDYLALVGDASDGYPGIKGIGAKGATALLTRYGKIESFPPEVLGEGRALALLFKELATLQSDAVLFADVGELEWRGPTAAFPAVCEPLGAPYLLTRARAAVRPVAAE

Samples

Sample ID Description Type Environment
1 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
158 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
199 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 2.63
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 3.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0228598_1010867 3300024227 Unclassified 1813
2 Ga0065712_10176262 3300005290 Bacteria 1206
3 Ga0070658_10005164 3300005327 Bacteria 10626
4 Ga0070658_10039511 3300005327 Bacteria 3807
5 Ga0070676_10000549 3300005328 Bacteria 18166
6 Ga0070683_100141070 3300005329 Bacteria 2283
7 Ga0070690_100024689 3300005330 Bacteria 3697
8 Ga0070690_100135015 3300005330 Bacteria 1670
9 Ga0070677_10001116 3300005333 Bacteria 8629
10 Ga0070677_10004877 3300005333 Bacteria 4405
11 Ga0070666_10001560 3300005335 Bacteria 13903
12 Ga0070666_10041456 3300005335 Bacteria 3077
13 Ga0070666_10235059 3300005335 Bacteria 1295
14 Ga0070680_100104967 3300005336 Bacteria 2349
15 Ga0070680_100157719 3300005336 Bacteria 1907
16 Ga0070682_100215523 3300005337 Bacteria 1363
17 Ga0068868_100009314 3300005338 Bacteria 7060
18 Ga0068868_100072924 3300005338 Bacteria 2740
19 Ga0068868_100157514 3300005338 Bacteria 1873
20 Ga0068868_100167748 3300005338 Bacteria 1817
21 Ga0070689_100017686 3300005340 Bacteria 5242
22 Ga0070689_100059870 3300005340 Bacteria 2960
23 Ga0070689_100074603 3300005340 Bacteria 2654
24 Ga0070689_100218861 3300005340 Unclassified 1561
25 Ga0070661_100001194 3300005344 Bacteria 18335
26 Ga0070661_100005076 3300005344 Bacteria 9079
27 Ga0070661_100040752 3300005344 Bacteria 3389
28 Ga0070692_10015252 3300005345 Bacteria 3631
29 Ga0070668_100003785 3300005347 Bacteria 11172
30 Ga0070668_100272877 3300005347 Bacteria 1410
31 Ga0070669_100000346 3300005353 Bacteria 36175
32 Ga0070669_100154932 3300005353 Bacteria 1776
33 Ga0070675_100016549 3300005354 Bacteria 5854
34 Ga0070675_100102536 3300005354 Bacteria 2411
35 Ga0070675_100311683 3300005354 Bacteria 1388
36 Ga0070675_100408614 3300005354 Bacteria 1212
37 Ga0070671_100083128 3300005355 Bacteria 2677
38 Ga0070674_100027220 3300005356 Bacteria 3745
39 Ga0070674_100050322 3300005356 Bacteria 2868
40 Ga0070674_100313806 3300005356 Bacteria 1254
41 Ga0070673_100071070 3300005364 Bacteria 2795
42 Ga0070673_100204968 3300005364 Bacteria 1700
43 Ga0070688_100018303 3300005365 Bacteria 4040
44 Ga0070688_100042690 3300005365 Bacteria 2791
45 Ga0070659_100607560 3300005366 Unclassified 940
46 Ga0070667_100020097 3300005367 Bacteria 5545
47 Ga0070667_100037787 3300005367 Bacteria 4048
48 Ga0070667_100041601 3300005367 Bacteria 3855
49 Ga0070667_100240335 3300005367 Bacteria 1617
50 Ga0070667_100356142 3300005367 Bacteria 1326
51 Ga0070703_10020530 3300005406 Bacteria 1922
52 Ga0070709_10003111 3300005434 Bacteria 8901
53 Ga0070709_10013266 3300005434 Bacteria 4626
54 Ga0070714_100001190 3300005435 Bacteria 18737
55 Ga0070714_100003242 3300005435 Bacteria 12104
56 Ga0070714_100005783 3300005435 Bacteria 9484
57 Ga0070714_100014232 3300005435 Bacteria 6388
58 Ga0070714_100047552 3300005435 Bacteria 3645
59 Ga0070714_100318025 3300005435 Bacteria 1455
60 Ga0070713_100000065 3300005436 Bacteria 66969
61 Ga0070713_100125902 3300005436 Bacteria 2253
62 Ga0070713_100163817 3300005436 Bacteria 1987
63 Ga0070713_100502024 3300005436 Bacteria 1145
64 Ga0070711_100000098 3300005439 Bacteria 46357
65 Ga0070705_100483842 3300005440 Bacteria 936
66 Ga0070694_100016927 3300005444 Bacteria 4598
67 Ga0070708_100000135 3300005445 Bacteria 50646
68 Ga0070708_100209894 3300005445 Bacteria 1825
69 Ga0070663_100012910 3300005455 Bacteria 5303
70 Ga0070663_100311002 3300005455 Bacteria 1264
71 Ga0070678_100004386 3300005456 Bacteria 7991
72 Ga0070678_100004935 3300005456 Bacteria 7634
73 Ga0070678_100048240 3300005456 Bacteria 3065
74 Ga0070662_100164603 3300005457 Bacteria 1737
75 Ga0070681_10007807 3300005458 Bacteria 10465
76 Ga0070681_10083836 3300005458 Bacteria 3140
77 Ga0068867_100012404 3300005459 Bacteria 6027
78 Ga0068867_100026695 3300005459 Bacteria 4148
79 Ga0068867_100319464 3300005459 Bacteria 1286
80 Ga0070685_10001914 3300005466 Bacteria 10796
81 Ga0070685_10017482 3300005466 Bacteria 3839
82 Ga0070706_100026300 3300005467 Bacteria 5355
83 Ga0070706_100043111 3300005467 Bacteria 4168
84 Ga0070707_100389912 3300005468 Bacteria 1353
85 Ga0070698_100053606 3300005471 Bacteria 4098
86 Ga0070699_100054525 3300005518 Bacteria 3460
87 Ga0070679_100001227 3300005530 Bacteria 22510
88 Ga0070679_100171140 3300005530 Bacteria 2145
89 Ga0070679_100243103 3300005530 Bacteria 1757
90 Ga0070684_100014555 3300005535 Bacteria 6376
91 Ga0070684_100070635 3300005535 Bacteria 3073
92 Ga0070684_100488054 3300005535 Bacteria 1140
93 Ga0070697_100184508 3300005536 Bacteria 1769
94 Ga0070697_100198099 3300005536 Bacteria 1707
95 Ga0068853_100311539 3300005539 Bacteria 1457
96 Ga0070672_100022831 3300005543 Bacteria 4602
97 Ga0070672_100023937 3300005543 Bacteria 4505
98 Ga0070672_100097707 3300005543 Bacteria 2377
99 Ga0070672_100180452 3300005543 Bacteria 1759
100 Ga0070672_100274496 3300005543 Bacteria 1424
101 Ga0070686_100127898 3300005544 Bacteria 1753
102 Ga0070695_100165807 3300005545 Bacteria 1555
103 Ga0070693_100034853 3300005547 Bacteria 2787
104 Ga0070693_100130579 3300005547 Bacteria 1570
105 Ga0070665_100000090 3300005548 Bacteria 175078
106 Ga0070665_100003399 3300005548 Bacteria 17013
107 Ga0070665_100019381 3300005548 Bacteria 6826
108 Ga0070665_100087305 3300005548 Bacteria 3124
109 Ga0070704_100381939 3300005549 Bacteria 1197
110 Ga0070704_100490822 3300005549 Bacteria 1064
111 Ga0068855_100000116 3300005563 Bacteria 99786
112 Ga0068855_100015916 3300005563 Bacteria 9048
113 Ga0068855_100030523 3300005563 Bacteria 6446
114 Ga0068855_100086529 3300005563 Bacteria 3624
115 Ga0068855_100158774 3300005563 Bacteria 2568
116 Ga0070664_100000643 3300005564 Bacteria 26805
117 Ga0070664_100005768 3300005564 Bacteria 9984
118 Ga0070664_100035465 3300005564 Bacteria 4188
119 Ga0068857_100008839 3300005577 Bacteria 8725
120 Ga0068857_100442673 3300005577 Bacteria 1214
121 Ga0068856_100077393 3300005614 Bacteria 3296
122 Ga0068856_100163489 3300005614 Bacteria 2237
123 Ga0068856_100176295 3300005614 Bacteria 2150
124 Ga0068852_100009887 3300005616 Bacteria 7099
125 Ga0068852_100013997 3300005616 Bacteria 6155
126 Ga0068852_100249458 3300005616 Bacteria 1700
127 Ga0068852_100283634 3300005616 Bacteria 1598
128 Ga0068859_100002213 3300005617 Bacteria 19733
129 Ga0068859_100091967 3300005617 Bacteria 3085
130 Ga0068859_100163035 3300005617 Bacteria 2308
131 Ga0068859_100264394 3300005617 Bacteria 1812
132 Ga0068859_100274523 3300005617 Bacteria 1778
133 Ga0068859_100286900 3300005617 Unclassified 1739
134 Ga0068864_100000554 3300005618 Bacteria 31949
135 Ga0068864_100028395 3300005618 Bacteria 4728
136 Ga0068864_100032863 3300005618 Bacteria 4409
137 Ga0068864_100059967 3300005618 Bacteria 3294
138 Ga0068864_100315118 3300005618 Bacteria 1468
139 Ga0068861_100018334 3300005719 Bacteria 4986
140 Ga0068851_10009044 3300005834 Bacteria 4622
141 Ga0068870_10022638 3300005840 Bacteria 3089
142 Ga0068863_100013515 3300005841 Bacteria 7875
143 Ga0068863_100019378 3300005841 Bacteria 6507
144 Ga0068863_100121919 3300005841 Bacteria 2487
145 Ga0068858_100013960 3300005842 Bacteria 7577
146 Ga0068858_100087244 3300005842 Bacteria 2902
147 Ga0068858_100361129 3300005842 Bacteria 1392
148 Ga0068860_100065023 3300005843 Bacteria 3464
149 Ga0068860_100098820 3300005843 Bacteria 2783
150 Ga0068862_100000903 3300005844 Bacteria 28796
151 Ga0068862_100053022 3300005844 Bacteria 3472
152 Ga0070717_10030500 3300006028 Bacteria 4332
153 Ga0070716_100095006 3300006173 Bacteria 1814
154 Ga0070716_100233917 3300006173 Bacteria 1242
155 Ga0097621_100040354 3300006237 Unclassified 3753
156 Ga0097621_100179433 3300006237 Bacteria 1829
157 Ga0068871_100141212 3300006358 Bacteria 2048
158 Ga0068871_100429388 3300006358 Bacteria 1181
159 Ga0068871_100471818 3300006358 Bacteria 1127
160 Ga0075428_100004208 3300006844 Bacteria 15850
161 Ga0075428_100158692 3300006844 Bacteria 2455
162 Ga0075431_100253368 3300006847 Bacteria 1788
163 Ga0075434_100162063 3300006871 Bacteria 2256
164 Ga0075429_100157135 3300006880 Bacteria 1991
165 Ga0068865_100045208 3300006881 Bacteria 3018
166 Ga0068865_100164468 3300006881 Unclassified 1695
167 Ga0097620_100002213 3300006931 Bacteria 19733
168 Ga0097620_100091971 3300006931 Bacteria 3085
169 Ga0097620_100163033 3300006931 Bacteria 2308
170 Ga0097620_100264413 3300006931 Bacteria 1812
171 Ga0097620_100274542 3300006931 Bacteria 1778
172 Ga0097620_100286913 3300006931 Unclassified 1739
173 Ga0075435_100118285 3300007076 Bacteria 2209
174 Ga0099794_10003083 3300007265 Bacteria 6297
175 Ga0105240_10003359 3300009093 Bacteria 24897
176 Ga0105240_10007259 3300009093 Bacteria 16130
177 Ga0105240_10104704 3300009093 Bacteria 3436
178 Ga0105240_10329473 3300009093 Bacteria 1738
179 Ga0111539_10166910 3300009094 Bacteria 2573
180 Ga0105247_10179418 3300009101 Bacteria 1412
181 Ga0105241_10212422 3300009174 Bacteria 1622
182 Ga0105242_10469700 3300009176 Bacteria 1190
183 Ga0105248_10025525 3300009177 Bacteria 6569
184 Ga0105248_10128613 3300009177 Bacteria 2858
185 Ga0105237_10087435 3300009545 Bacteria 3106
186 Ga0105238_10323697 3300009551 Bacteria 1528
187 Ga0157373_10072405 3300013100 Bacteria 2433
188 Ga0157371_10059034 3300013102 Bacteria 2721
189 Ga0157370_10003769 3300013104 Bacteria 17697
190 Ga0157370_10019781 3300013104 Bacteria 6739
191 Ga0157370_10033211 3300013104 Bacteria 5030
192 Ga0157370_10061930 3300013104 Bacteria 3550
193 Ga0157369_10006722 3300013105 Bacteria 13270
194 Ga0157369_10013850 3300013105 Bacteria 9112
195 Ga0157369_10027094 3300013105 Bacteria 6355
196 Ga0157374_10005834 3300013296 Bacteria 10405
197 Ga0157374_10293408 3300013296 Bacteria 1608
198 Ga0157374_10323178 3300013296 Bacteria 1529
199 Ga0163162_10089078 3300013306 Bacteria 3166
200 Ga0163162_10145824 3300013306 Bacteria 2483
201 Ga0163162_10272956 3300013306 Bacteria 1823
202 Ga0157372_10110293 3300013307 Bacteria 3151
203 Ga0157372_10110793 3300013307 Bacteria 3144
204 Ga0157372_10403670 3300013307 Bacteria 1592
205 Ga0157375_10001516 3300013308 Bacteria 19971
206 Ga0157375_10001901 3300013308 Bacteria 17965
207 Ga0163163_10040105 3300014325 Bacteria 4571
208 Ga0163163_10853889 3300014325 Unclassified 974
209 Ga0157380_10613077 3300014326 Unclassified 1079
210 Ga0182008_10030041 3300014497 Bacteria 2741
211 Ga0157377_10094477 3300014745 Bacteria 1771
212 Ga0157379_10003130 3300014968 Bacteria 14009
213 Ga0157376_10022911 3300014969 Bacteria 4877
214 Ga0157376_10173404 3300014969 Bacteria 1966
215 Ga0157376_10175454 3300014969 Bacteria 1955
216 Ga0157376_10444753 3300014969 Bacteria 1263
217 Ga0206353_11636042 3300020082 Bacteria 1249
218 Ga0213873_10000798 3300021358 Bacteria 5096
219 Ga0213872_10009539 3300021361 Bacteria 4653
220 Ga0213872_10014617 3300021361 Bacteria 3659
221 Ga0213872_10022994 3300021361 Bacteria 2869
222 Ga0213876_10001827 3300021384 Bacteria 12847
223 Ga0213876_10162097 3300021384 Unclassified 1190
224 Ga0213875_10000001 3300021388 Bacteria 2793540
225 Ga0207656_10004044 3300025321 Bacteria 5088
226 Ga0207653_10005606 3300025885 Bacteria 3920
227 Ga0207682_10000201 3300025893 Bacteria 27219
228 Ga0207682_10001636 3300025893 Bacteria 10265
229 Ga0207680_10021261 3300025903 Bacteria 3508
230 Ga0207680_10021870 3300025903 Bacteria 3469
231 Ga0207680_10039299 3300025903 Bacteria 2745
232 Ga0207699_10046837 3300025906 Bacteria 2532
233 Ga0207645_10002145 3300025907 Bacteria 15771
234 Ga0207645_10028723 3300025907 Bacteria 3589
235 Ga0207643_10003730 3300025908 Bacteria 8186
236 Ga0207705_10046224 3300025909 Bacteria 3128
237 Ga0207684_10173378 3300025910 Bacteria 1859
238 Ga0207707_10024055 3300025912 Bacteria 5326
239 Ga0207695_10070787 3300025913 Bacteria 3563
240 Ga0207695_10201238 3300025913 Bacteria 1906
241 Ga0207663_10000080 3300025916 Bacteria 46340
242 Ga0207660_10039256 3300025917 Bacteria 3309
243 Ga0207660_10121468 3300025917 Bacteria 1979
244 Ga0207657_10099072 3300025919 Bacteria 2421
245 Ga0207657_10262038 3300025919 Bacteria 1375
246 Ga0207649_10027685 3300025920 Bacteria 3329
247 Ga0207652_10124064 3300025921 Bacteria 2300
248 Ga0207652_10251732 3300025921 Bacteria 1593
249 Ga0207646_10224163 3300025922 Bacteria 1698
250 Ga0207681_10000039 3300025923 Bacteria 153082
251 Ga0207694_10006556 3300025924 Bacteria 8847
252 Ga0207694_10193519 3300025924 Bacteria 1653
253 Ga0207650_10009730 3300025925 Bacteria 6573
254 Ga0207650_10502121 3300025925 Bacteria 1014
255 Ga0207659_10014625 3300025926 Bacteria 5066
256 Ga0207659_10052848 3300025926 Bacteria 2896
257 Ga0207659_10286351 3300025926 Bacteria 1349
258 Ga0207700_10000046 3300025928 Bacteria 87971
259 Ga0207700_10334285 3300025928 Bacteria 1316
260 Ga0207664_10035228 3300025929 Bacteria 3860
261 Ga0207664_10149888 3300025929 Bacteria 1980
262 Ga0207664_10179612 3300025929 Bacteria 1816
263 Ga0207664_10248020 3300025929 Bacteria 1553
264 Ga0207664_10295884 3300025929 Bacteria 1423
265 Ga0207644_10029181 3300025931 Bacteria 3824
266 Ga0207644_10127052 3300025931 Bacteria 1947
267 Ga0207644_10250832 3300025931 Bacteria 1412
268 Ga0207706_10029477 3300025933 Bacteria 4898
269 Ga0207706_10046670 3300025933 Bacteria 3836
270 Ga0207686_10265739 3300025934 Bacteria 1260
271 Ga0207670_10063189 3300025936 Bacteria 2532
272 Ga0207669_10006619 3300025937 Bacteria 5311
273 Ga0207669_10057659 3300025937 Bacteria 2365
274 Ga0207704_10018530 3300025938 Bacteria 3636
275 Ga0207665_10048597 3300025939 Bacteria 2849
276 Ga0207691_10000024 3300025940 Bacteria 132111
277 Ga0207691_10001120 3300025940 Bacteria 26623
278 Ga0207691_10011247 3300025940 Bacteria 8586
279 Ga0207691_10090183 3300025940 Bacteria 2748
280 Ga0207691_10122296 3300025940 Bacteria 2305
281 Ga0207691_10416237 3300025940 Bacteria 1145
282 Ga0207711_10241392 3300025941 Bacteria 1657
283 Ga0207661_10108756 3300025944 Bacteria 2341
284 Ga0207679_10002773 3300025945 Bacteria 10852
285 Ga0207679_10002784 3300025945 Bacteria 10826
286 Ga0207679_10562739 3300025945 Bacteria 1024
287 Ga0207667_10000018 3300025949 Bacteria 388308
288 Ga0207667_10000551 3300025949 Bacteria 49309
289 Ga0207667_10019337 3300025949 Bacteria 7607
290 Ga0207667_10028585 3300025949 Bacteria 6054
291 Ga0207651_10002417 3300025960 Bacteria 8926
292 Ga0207651_10338118 3300025960 Unclassified 1264
293 Ga0207668_10050723 3300025972 Bacteria 2861
294 Ga0207658_10029744 3300025986 Bacteria 3861
295 Ga0207658_10064388 3300025986 Bacteria 2750
296 Ga0207658_10274668 3300025986 Bacteria 1442
297 Ga0207658_10641901 3300025986 Bacteria 956
298 Ga0207677_10014751 3300026023 Bacteria 4574
299 Ga0207677_10083725 3300026023 Bacteria 2297
300 Ga0207677_10329001 3300026023 Bacteria 1273
301 Ga0207703_10000603 3300026035 Bacteria 36484
302 Ga0207703_10126799 3300026035 Bacteria 2198
303 Ga0207703_10191216 3300026035 Bacteria 1813
304 Ga0207639_10023415 3300026041 Bacteria 4460
305 Ga0207639_10049737 3300026041 Bacteria 3180
306 Ga0207678_10018865 3300026067 Bacteria 6059
307 Ga0207678_10418730 3300026067 Bacteria 1161
308 Ga0207708_10082542 3300026075 Bacteria 2471
309 Ga0207702_10103419 3300026078 Bacteria 2519
310 Ga0207641_10033033 3300026088 Bacteria 4298
311 Ga0207641_10049460 3300026088 Bacteria 3552
312 Ga0207641_10240091 3300026088 Bacteria 1688
313 Ga0207641_10455531 3300026088 Bacteria 1237
314 Ga0207648_10013028 3300026089 Bacteria 7756
315 Ga0207648_10043767 3300026089 Bacteria 3930
316 Ga0207648_10046012 3300026089 Bacteria 3826
317 Ga0207648_10359923 3300026089 Bacteria 1313
318 Ga0207676_10021925 3300026095 Bacteria 4692
319 Ga0207676_10045349 3300026095 Bacteria 3396
320 Ga0207676_10147879 3300026095 Bacteria 2019
321 Ga0207676_10266927 3300026095 Bacteria 1548
322 Ga0207674_10000083 3300026116 Bacteria 101460
323 Ga0207674_10442115 3300026116 Bacteria 1257
324 Ga0207675_100090572 3300026118 Bacteria 2876
325 Ga0207675_100115582 3300026118 Bacteria 2535
326 Ga0207683_10000012 3300026121 Bacteria 134768
327 Ga0207683_10000261 3300026121 Bacteria 47116
328 Ga0207683_10097047 3300026121 Bacteria 2628
329 Ga0207698_10007333 3300026142 Bacteria 6912
330 Ga0207698_10129187 3300026142 Bacteria 2156
331 Ga0207698_10149706 3300026142 Bacteria 2023
332 Ga0207428_10005553 3300027907 Bacteria 11744
333 Ga0207428_10033471 3300027907 Bacteria 4221
334 Ga0265356_1000112 3300028017 Bacteria 13967
335 Ga0265357_1000747 3300028023 Bacteria 2097
336 Ga0268266_10006676 3300028379 Bacteria 10526
337 Ga0268266_10013186 3300028379 Bacteria 7127
338 Ga0268266_10167916 3300028379 Bacteria 1990
339 Ga0268266_10322878 3300028379 Bacteria 1445
340 Ga0268265_10004113 3300028380 Bacteria 10226
341 Ga0268264_10045434 3300028381 Bacteria 3646
342 Ga0268264_10090090 3300028381 Bacteria 2643
343 Ga0265338_10000794 3300028800 Bacteria 53515
344 Ga0265338_10101478 3300028800 Bacteria 2343
345 Ga0265760_10000202 3300031090 Bacteria 15896
346 Ga0265332_10074518 3300031238 Bacteria 1443
347 Ga0265332_10077197 3300031238 Bacteria 1415
348 Ga0265320_10020093 3300031240 Bacteria 3630
349 Ga0265325_10004349 3300031241 Bacteria 8972
350 Ga0265325_10028693 3300031241 Bacteria 2996
351 Ga0265340_10083840 3300031247 Bacteria 1497
352 Ga0265339_10004111 3300031249 Bacteria 10033
353 Ga0265313_10001211 3300031595 Bacteria 24638
354 Ga0265342_10002725 3300031712 Bacteria 15029
355 Ga0265342_10009361 3300031712 Bacteria 6914
356 Ga0316576_10127039 3300031727 Bacteria 1917
357 Ga0307516_10000033 3300031730 Bacteria 155697
358 Ga0307413_10001675 3300031824 Bacteria 8620
359 Ga0307410_10007004 3300031852 Bacteria 6136
360 Ga0307406_10004914 3300031901 Bacteria 7281
361 Ga0307412_10026242 3300031911 Bacteria 3619
362 Ga0307416_100002523 3300032002 Bacteria 10532
363 Ga0307416_100143024 3300032002 Bacteria 2178
364 Ga0307411_10007152 3300032005 Bacteria 5655
365 Ga0307415_100014472 3300032126 Bacteria 4640
366 Ga0307510_10199505 3300033180 Unclassified 1538
367 Ga0373930_0001493 3300034816 Bacteria 3496
368 Ga0373940_0000700 3300035088 Bacteria 5417
369 Ga0373932_0002760 3300035112 Bacteria 4363
370 Ga0373939_0001695 3300035114 Bacteria 5329
371 Ga0373962_0006314 3300035242 Bacteria 2870
372 Ga0373931_0001448 3300035691 Bacteria 10187
373 Ga0373931_0116899 3300035691 Bacteria 1520
374 Ga0373935_0454424 3300035692 Bacteria 926
375 Ga0373947_0236597 3300035725 Bacteria 1204
376 Ga0373925_0407963 3300037068 Bacteria 1109
377 Ga0373925_0515706 3300037068 Bacteria 982
378 Ga0395898_0010233 3300037466 Bacteria 9820
379 Ga0436364_0273345 3300037853 Bacteria 2794207
380 Ga0436364_0411276 3300037853 Bacteria 1455
381 Ga0436364_1186523 3300037853 Bacteria 1467
382 Ga0395901_0343036 3300038443 Bacteria 1543
383 Ga0436365_0169938 3300039437 Bacteria 43567
384 Ga0436365_1507518 3300039437 Unclassified 2338
385 Ga0436360_0309224 3300039438 Unclassified 1924
386 Ga0436360_0428812 3300039438 Bacteria 2877
387 Ga0436360_1156138 3300039438 Bacteria 2618
388 Ga0436361_0056336 3300039447 Bacteria 32352
389 Ga0436361_0336681 3300039447 Bacteria 10905
390 Ga0436361_0497684 3300039447 Unclassified 1566
391 Ga0436361_0679055 3300039447 Bacteria 6037
392 Ga0436361_0821518 3300039447 Bacteria 1081
393 Ga0436363_1027966 3300039450 Unclassified 1754
394 Ga0436363_1699659 3300039450 Bacteria 18865
395 Ga0436362_0780155 3300039453 Bacteria 28429
396 Ga0439437_006970 3300042000 Bacteria 1258
397 Ga0439445_0041389 3300042004 Bacteria 1225
398 Ga0451577_0505868 3300042876 Bacteria 1097
399 Ga0466963_0127011 3300044694 Bacteria 1758
400 Ga0466964_0228727 3300044706 Unclassified 907
401 Ga0466957_0237477 3300044842 Unclassified 1208
402 Ga0451576_0117757 3300045051 Bacteria 2765
403 Ga0451576_0474241 3300045051 Bacteria 1314
404 Ga0451576_0644545 3300045051 Bacteria 1113
405 Ga0466958_0042877 3300045836 Bacteria 2724
406 Ga0466958_0078474 3300045836 Bacteria 2029
407 Ga0466967_0002629 3300045976 Bacteria 11309
408 Ga0495580_0000002 3300046472 Bacteria 121311
409 Ga0495610_0050593 3300046512 Bacteria 2028
410 Ga0495628_0429718 3300046516 Bacteria 961
411 Ga0495598_0001402 3300046537 Bacteria 4762
412 Ga0495598_0041879 3300046537 Bacteria 1342
413 Ga0495669_0008196 3300046684 Bacteria 4386
414 Ga0495671_0047531 3300046692 Bacteria 2144
415 Ga0496100_0204775 3300048903 Bacteria 1440
416 Ga0496102_0079275 3300048905 Bacteria 3024
417 Ga0496103_0036547 3300048906 Bacteria 3008
418 Ga0496104_0202668 3300048907 Bacteria 1896
419 Ga0496105_0066946 3300048908 Bacteria 2965
420 Ga0496109_0007832 3300048912 Bacteria 9049
421 Ga0496110_0081247 3300048913 Bacteria 2889
422 Ga0496110_0102700 3300048913 Unclassified 2564
423 Ga0496111_0039811 3300048914 Bacteria 3372
424 Ga0496113_0190381 3300048916 Bacteria 1628
425 Ga0496114_0000022 3300048917 Bacteria 219236
426 Ga0496114_0006397 3300048917 Bacteria 9277
427 Ga0496115_0075426 3300048918 Bacteria 2739
428 Ga0501033_0082448 3300049570 Bacteria 2358
429 Ga0501034_0059229 3300049571 Bacteria 3847
430 Ga0501036_0017079 3300049572 Bacteria 6066
431 Ga0501036_0019777 3300049572 Bacteria 5653
432 Ga0501037_0094584 3300049573 Bacteria 2161
433 Ga0501038_0065127 3300049574 Bacteria 3106
434 Ga0501039_0003539 3300049575 Bacteria 11701
435 Ga0501040_0014166 3300049576 Bacteria 5249
436 Ga0501040_0021237 3300049576 Bacteria 4333
437 Ga0501041_0002814 3300049577 Bacteria 9938
438 Ga0501041_0087721 3300049577 Bacteria 1920
439 Ga0501042_0048109 3300049578 Bacteria 3041
440 Ga0501042_0057913 3300049578 Bacteria 2765
441 Ga0501046_0022544 3300049580 Bacteria 5188
442 Ga0501046_0053849 3300049580 Bacteria 3167
443 Ga0501047_0332335 3300049581 Bacteria 1358
444 Ga0501048_0045167 3300049582 Bacteria 3148
445 Ga0501067_0005112 3300049583 Bacteria 7290
446 Ga0501068_0058959 3300049584 Bacteria 2330
447 Ga0501070_0010824 3300049586 Bacteria 7706
448 Ga0501071_0017111 3300049587 Bacteria 4994
449 Ga0501071_0026136 3300049587 Bacteria 4095
450 Ga0501071_0084470 3300049587 Bacteria 2327
451 Ga0501072_0012659 3300049588 Bacteria 6449
452 Ga0501072_0137011 3300049588 Bacteria 1951
453 Ga0501074_0075186 3300049590 Bacteria 2425
454 Ga0501075_0015482 3300049591 Bacteria 5474
455 Ga0501075_0082135 3300049591 Bacteria 2440
456 Ga0501077_0000071 3300049593 Bacteria 50853
457 Ga0501077_0007540 3300049593 Bacteria 6712
458 Ga0501077_0052583 3300049593 Bacteria 2586
459 Ga0501079_0005122 3300049741 Bacteria 9740
460 Ga0501079_0011125 3300049741 Bacteria 6862
461 Ga0501080_0002841 3300049742 Bacteria 15216
462 Ga0501080_0011673 3300049742 Bacteria 8047
463 Ga0501080_0020201 3300049742 Bacteria 6166
464 Ga0501080_0049703 3300049742 Bacteria 3903
465 Ga0501081_0044251 3300049743 Bacteria 3055
466 Ga0501083_0013542 3300049744 Bacteria 5702
467 Ga0501035_0050534 3300049822 Bacteria 3726
468 Ga0501035_0093601 3300049822 Bacteria 2644
469 Ga0501044_0489524 3300049823 Bacteria 1132
470 Ga0501045_0006094 3300049824 Bacteria 8348
471 Ga0501045_0031258 3300049824 Bacteria 3856
472 nmdc:mga09592_160665_c1 3300050508 Bacteria 1941
473 nmdc:mga0qj67_143383_c1 3300050509 Bacteria 1937
474 nmdc:mga06r32_171677_c1 3300050510 Bacteria 2152
475 nmdc:mga08y16_112971_c1 3300050511 Bacteria 2828
476 nmdc:mga08y16_11991_c1 3300050511 Bacteria 9102
477 nmdc:mga08y16_134446_c1 3300050511 Bacteria 2570
478 nmdc:mga08y16_50301_c1 3300050511 Bacteria 4362
479 nmdc:mga0n895_13350_c1 3300050512 Bacteria 7406
480 nmdc:mga0n895_45347_c1 3300050512 Bacteria 4290
481 nmdc:mga0rr50_213282_c1 3300050513 Bacteria 1591
482 nmdc:mga08x19_112659_c1 3300050514 Bacteria 1816
483 nmdc:mga08x19_346_c1 3300050514 Bacteria 33568
484 nmdc:mga0a205_338992_c1 3300050515 Bacteria 1372
485 nmdc:mga0a205_54670_c1 3300050515 Bacteria 3854
486 Ga0495601_0208834 3300053077 Bacteria 1276
487 Ga0500622_0020112 3300053156 Bacteria 3545
488 Ga0501084_0028810 3300054114 Bacteria 4643
489 Ga0501084_0102816 3300054114 Bacteria 2399
490 Ga0501082_0000703 3300060353 Bacteria 29422
491 Ga0501082_0082629 3300060353 Bacteria 2771
492 Ga0530510_0018140 3300061734 Bacteria 4990
493 Ga0530510_0071020 3300061734 Bacteria 2527
494 Ga0530510_0377796 3300061734 Bacteria 1066
495 Ga0228598_1010867
496 Ga0065712_10176262
497 Ga0070658_10005164
498 Ga0070658_10039511
499 Ga0070676_10000549
500 Ga0070683_100141070
501 Ga0070690_100024689
502 Ga0070690_100135015
503 Ga0070677_10001116
504 Ga0070677_10004877
505 Ga0070666_10001560
506 Ga0070666_10041456
507 Ga0070666_10235059
508 Ga0070680_100104967
509 Ga0070680_100157719
510 Ga0070682_100215523
511 Ga0068868_100009314
512 Ga0068868_100072924
513 Ga0068868_100157514
514 Ga0068868_100167748
515 Ga0070689_100017686
516 Ga0070689_100059870
517 Ga0070689_100074603
518 Ga0070689_100218861
519 Ga0070661_100001194
520 Ga0070661_100005076
521 Ga0070661_100040752
522 Ga0070692_10015252
523 Ga0070668_100003785
524 Ga0070668_100272877
525 Ga0070669_100000346
526 Ga0070669_100154932
527 Ga0070675_100016549
528 Ga0070675_100102536
529 Ga0070675_100311683
530 Ga0070675_100408614
531 Ga0070671_100083128
532 Ga0070674_100027220
533 Ga0070674_100050322
534 Ga0070674_100313806
535 Ga0070673_100071070
536 Ga0070673_100204968
537 Ga0070688_100018303
538 Ga0070688_100042690
539 Ga0070659_100607560
540 Ga0070667_100020097
541 Ga0070667_100037787
542 Ga0070667_100041601
543 Ga0070667_100240335
544 Ga0070667_100356142
545 Ga0070703_10020530
546 Ga0070709_10003111
547 Ga0070709_10013266
548 Ga0070714_100001190
549 Ga0070714_100003242
550 Ga0070714_100005783
551 Ga0070714_100014232
552 Ga0070714_100047552
553 Ga0070714_100318025
554 Ga0070713_100000065
555 Ga0070713_100125902
556 Ga0070713_100163817
557 Ga0070713_100502024
558 Ga0070711_100000098
559 Ga0070705_100483842
560 Ga0070694_100016927
561 Ga0070708_100000135
562 Ga0070708_100209894
563 Ga0070663_100012910
564 Ga0070663_100311002
565 Ga0070678_100004386
566 Ga0070678_100004935
567 Ga0070678_100048240
568 Ga0070662_100164603
569 Ga0070681_10007807
570 Ga0070681_10083836
571 Ga0068867_100012404
572 Ga0068867_100026695
573 Ga0068867_100319464
574 Ga0070685_10001914
575 Ga0070685_10017482
576 Ga0070706_100026300
577 Ga0070706_100043111
578 Ga0070707_100389912
579 Ga0070698_100053606
580 Ga0070699_100054525
581 Ga0070679_100001227
582 Ga0070679_100171140
583 Ga0070679_100243103
584 Ga0070684_100014555
585 Ga0070684_100070635
586 Ga0070684_100488054
587 Ga0070697_100184508
588 Ga0070697_100198099
589 Ga0068853_100311539
590 Ga0070672_100022831
591 Ga0070672_100023937
592 Ga0070672_100097707
593 Ga0070672_100180452
594 Ga0070672_100274496
595 Ga0070686_100127898
596 Ga0070695_100165807
597 Ga0070693_100034853
598 Ga0070693_100130579
599 Ga0070665_100000090
600 Ga0070665_100003399
601 Ga0070665_100019381
602 Ga0070665_100087305
603 Ga0070704_100381939
604 Ga0070704_100490822
605 Ga0068855_100000116
606 Ga0068855_100015916
607 Ga0068855_100030523
608 Ga0068855_100086529
609 Ga0068855_100158774
610 Ga0070664_100000643
611 Ga0070664_100005768
612 Ga0070664_100035465
613 Ga0068857_100008839
614 Ga0068857_100442673
615 Ga0068856_100077393
616 Ga0068856_100163489
617 Ga0068856_100176295
618 Ga0068852_100009887
619 Ga0068852_100013997
620 Ga0068852_100249458
621 Ga0068852_100283634
622 Ga0068859_100002213
623 Ga0068859_100091967
624 Ga0068859_100163035
625 Ga0068859_100264394
626 Ga0068859_100274523
627 Ga0068859_100286900
628 Ga0068864_100000554
629 Ga0068864_100028395
630 Ga0068864_100032863
631 Ga0068864_100059967
632 Ga0068864_100315118
633 Ga0068861_100018334
634 Ga0068851_10009044
635 Ga0068870_10022638
636 Ga0068863_100013515
637 Ga0068863_100019378
638 Ga0068863_100121919
639 Ga0068858_100013960
640 Ga0068858_100087244
641 Ga0068858_100361129
642 Ga0068860_100065023
643 Ga0068860_100098820
644 Ga0068862_100000903
645 Ga0068862_100053022
646 Ga0070717_10030500
647 Ga0070716_100095006
648 Ga0070716_100233917
649 Ga0097621_100040354
650 Ga0097621_100179433
651 Ga0068871_100141212
652 Ga0068871_100429388
653 Ga0068871_100471818
654 Ga0075428_100004208
655 Ga0075428_100158692
656 Ga0075431_100253368
657 Ga0075434_100162063
658 Ga0075429_100157135
659 Ga0068865_100045208
660 Ga0068865_100164468
661 Ga0097620_100002213
662 Ga0097620_100091971
663 Ga0097620_100163033
664 Ga0097620_100264413
665 Ga0097620_100274542
666 Ga0097620_100286913
667 Ga0075435_100118285
668 Ga0099794_10003083
669 Ga0105240_10003359
670 Ga0105240_10007259
671 Ga0105240_10104704
672 Ga0105240_10329473
673 Ga0111539_10166910
674 Ga0105247_10179418
675 Ga0105241_10212422
676 Ga0105242_10469700
677 Ga0105248_10025525
678 Ga0105248_10128613
679 Ga0105237_10087435
680 Ga0105238_10323697
681 Ga0157373_10072405
682 Ga0157371_10059034
683 Ga0157370_10003769
684 Ga0157370_10019781
685 Ga0157370_10033211
686 Ga0157370_10061930
687 Ga0157369_10006722
688 Ga0157369_10013850
689 Ga0157369_10027094
690 Ga0157374_10005834
691 Ga0157374_10293408
692 Ga0157374_10323178
693 Ga0163162_10089078
694 Ga0163162_10145824
695 Ga0163162_10272956
696 Ga0157372_10110293
697 Ga0157372_10110793
698 Ga0157372_10403670
699 Ga0157375_10001516
700 Ga0157375_10001901
701 Ga0163163_10040105
702 Ga0163163_10853889
703 Ga0157380_10613077
704 Ga0182008_10030041
705 Ga0157377_10094477
706 Ga0157379_10003130
707 Ga0157376_10022911
708 Ga0157376_10173404
709 Ga0157376_10175454
710 Ga0157376_10444753
711 Ga0206353_11636042
712 Ga0213873_10000798
713 Ga0213872_10009539
714 Ga0213872_10014617
715 Ga0213872_10022994
716 Ga0213876_10001827
717 Ga0213876_10162097
718 Ga0213875_10000001
719 Ga0207656_10004044
720 Ga0207653_10005606
721 Ga0207682_10000201
722 Ga0207682_10001636
723 Ga0207680_10021261
724 Ga0207680_10021870
725 Ga0207680_10039299
726 Ga0207699_10046837
727 Ga0207645_10002145
728 Ga0207645_10028723
729 Ga0207643_10003730
730 Ga0207705_10046224
731 Ga0207684_10173378
732 Ga0207707_10024055
733 Ga0207695_10070787
734 Ga0207695_10201238
735 Ga0207663_10000080
736 Ga0207660_10039256
737 Ga0207660_10121468
738 Ga0207657_10099072
739 Ga0207657_10262038
740 Ga0207649_10027685
741 Ga0207652_10124064
742 Ga0207652_10251732
743 Ga0207646_10224163
744 Ga0207681_10000039
745 Ga0207694_10006556
746 Ga0207694_10193519
747 Ga0207650_10009730
748 Ga0207650_10502121
749 Ga0207659_10014625
750 Ga0207659_10052848
751 Ga0207659_10286351
752 Ga0207700_10000046
753 Ga0207700_10334285
754 Ga0207664_10035228
755 Ga0207664_10149888
756 Ga0207664_10179612
757 Ga0207664_10248020
758 Ga0207664_10295884
759 Ga0207644_10029181
760 Ga0207644_10127052
761 Ga0207644_10250832
762 Ga0207706_10029477
763 Ga0207706_10046670
764 Ga0207686_10265739
765 Ga0207670_10063189
766 Ga0207669_10006619
767 Ga0207669_10057659
768 Ga0207704_10018530
769 Ga0207665_10048597
770 Ga0207691_10000024
771 Ga0207691_10001120
772 Ga0207691_10011247
773 Ga0207691_10090183
774 Ga0207691_10122296
775 Ga0207691_10416237
776 Ga0207711_10241392
777 Ga0207661_10108756
778 Ga0207679_10002773
779 Ga0207679_10002784
780 Ga0207679_10562739
781 Ga0207667_10000018
782 Ga0207667_10000551
783 Ga0207667_10019337
784 Ga0207667_10028585
785 Ga0207651_10002417
786 Ga0207651_10338118
787 Ga0207668_10050723
788 Ga0207658_10029744
789 Ga0207658_10064388
790 Ga0207658_10274668
791 Ga0207658_10641901
792 Ga0207677_10014751
793 Ga0207677_10083725
794 Ga0207677_10329001
795 Ga0207703_10000603
796 Ga0207703_10126799
797 Ga0207703_10191216
798 Ga0207639_10023415
799 Ga0207639_10049737
800 Ga0207678_10018865
801 Ga0207678_10418730
802 Ga0207708_10082542
803 Ga0207702_10103419
804 Ga0207641_10033033
805 Ga0207641_10049460
806 Ga0207641_10240091
807 Ga0207641_10455531
808 Ga0207648_10013028
809 Ga0207648_10043767
810 Ga0207648_10046012
811 Ga0207648_10359923
812 Ga0207676_10021925
813 Ga0207676_10045349
814 Ga0207676_10147879
815 Ga0207676_10266927
816 Ga0207674_10000083
817 Ga0207674_10442115
818 Ga0207675_100090572
819 Ga0207675_100115582
820 Ga0207683_10000012
821 Ga0207683_10000261
822 Ga0207683_10097047
823 Ga0207698_10007333
824 Ga0207698_10129187
825 Ga0207698_10149706
826 Ga0207428_10005553
827 Ga0207428_10033471
828 Ga0265356_1000112
829 Ga0265357_1000747
830 Ga0268266_10006676
831 Ga0268266_10013186
832 Ga0268266_10167916
833 Ga0268266_10322878
834 Ga0268265_10004113
835 Ga0268264_10045434
836 Ga0268264_10090090
837 Ga0265338_10000794
838 Ga0265338_10101478
839 Ga0265760_10000202
840 Ga0265332_10074518
841 Ga0265332_10077197
842 Ga0265320_10020093
843 Ga0265325_10004349
844 Ga0265325_10028693
845 Ga0265340_10083840
846 Ga0265339_10004111
847 Ga0265313_10001211
848 Ga0265342_10002725
849 Ga0265342_10009361
850 Ga0316576_10127039
851 Ga0307516_10000033
852 Ga0307413_10001675
853 Ga0307410_10007004
854 Ga0307406_10004914
855 Ga0307412_10026242
856 Ga0307416_100002523
857 Ga0307416_100143024
858 Ga0307411_10007152
859 Ga0307415_100014472
860 Ga0307510_10199505
861 Ga0373930_0001493
862 Ga0373940_0000700
863 Ga0373932_0002760
864 Ga0373939_0001695
865 Ga0373962_0006314
866 Ga0373931_0001448
867 Ga0373931_0116899
868 Ga0373935_0454424
869 Ga0373947_0236597
870 Ga0373925_0407963
871 Ga0373925_0515706
872 Ga0395898_0010233
873 Ga0436364_0273345
874 Ga0436364_0411276
875 Ga0436364_1186523
876 Ga0395901_0343036
877 Ga0436365_0169938
878 Ga0436365_1507518
879 Ga0436360_0309224
880 Ga0436360_0428812
881 Ga0436360_1156138
882 Ga0436361_0056336
883 Ga0436361_0336681
884 Ga0436361_0497684
885 Ga0436361_0679055
886 Ga0436361_0821518
887 Ga0436363_1027966
888 Ga0436363_1699659
889 Ga0436362_0780155
890 Ga0439437_006970
891 Ga0439445_0041389
892 Ga0451577_0505868
893 Ga0466963_0127011
894 Ga0466964_0228727
895 Ga0466957_0237477
896 Ga0451576_0117757
897 Ga0451576_0474241
898 Ga0451576_0644545
899 Ga0466958_0042877
900 Ga0466958_0078474
901 Ga0466967_0002629
902 Ga0495580_0000002
903 Ga0495610_0050593
904 Ga0495628_0429718
905 Ga0495598_0001402
906 Ga0495598_0041879
907 Ga0495669_0008196
908 Ga0495671_0047531
909 Ga0496100_0204775
910 Ga0496102_0079275
911 Ga0496103_0036547
912 Ga0496104_0202668
913 Ga0496105_0066946
914 Ga0496109_0007832
915 Ga0496110_0081247
916 Ga0496110_0102700
917 Ga0496111_0039811
918 Ga0496113_0190381
919 Ga0496114_0000022
920 Ga0496114_0006397
921 Ga0496115_0075426
922 Ga0501033_0082448
923 Ga0501034_0059229
924 Ga0501036_0017079
925 Ga0501036_0019777
926 Ga0501037_0094584
927 Ga0501038_0065127
928 Ga0501039_0003539
929 Ga0501040_0014166
930 Ga0501040_0021237
931 Ga0501041_0002814
932 Ga0501041_0087721
933 Ga0501042_0048109
934 Ga0501042_0057913
935 Ga0501046_0022544
936 Ga0501046_0053849
937 Ga0501047_0332335
938 Ga0501048_0045167
939 Ga0501067_0005112
940 Ga0501068_0058959
941 Ga0501070_0010824
942 Ga0501071_0017111
943 Ga0501071_0026136
944 Ga0501071_0084470
945 Ga0501072_0012659
946 Ga0501072_0137011
947 Ga0501074_0075186
948 Ga0501075_0015482
949 Ga0501075_0082135
950 Ga0501077_0000071
951 Ga0501077_0007540
952 Ga0501077_0052583
953 Ga0501079_0005122
954 Ga0501079_0011125
955 Ga0501080_0002841
956 Ga0501080_0011673
957 Ga0501080_0020201
958 Ga0501080_0049703
959 Ga0501081_0044251
960 Ga0501083_0013542
961 Ga0501035_0050534
962 Ga0501035_0093601
963 Ga0501044_0489524
964 Ga0501045_0006094
965 Ga0501045_0031258
966 nmdc:mga09592_160665_c1
967 nmdc:mga0qj67_143383_c1
968 nmdc:mga06r32_171677_c1
969 nmdc:mga08y16_112971_c1
970 nmdc:mga08y16_11991_c1
971 nmdc:mga08y16_134446_c1
972 nmdc:mga08y16_50301_c1
973 nmdc:mga0n895_13350_c1
974 nmdc:mga0n895_45347_c1
975 nmdc:mga0rr50_213282_c1
976 nmdc:mga08x19_112659_c1
977 nmdc:mga08x19_346_c1
978 nmdc:mga0a205_338992_c1
979 nmdc:mga0a205_54670_c1
980 Ga0495601_0208834
981 Ga0500622_0020112
982 Ga0501084_0028810
983 Ga0501084_0102816
984 Ga0501082_0000703
985 Ga0501082_0082629
986 Ga0530510_0018140
987 Ga0530510_0071020
988 Ga0530510_0377796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

226

311

0.93

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

62

225

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zdd-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov6 oligonucleotide and potassium 0.8244 1 240
3zde-assembly1.cif.gz_A potassium free structure of e. coli exoix 0.8215 2 240
3zd9-assembly1.cif.gz_A potassium bound structure of e. coli exoix in p21 0.8173 2 240
3zdc-assembly1.cif.gz_A structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, potassium and calcium 0.8148 1 239
3zd8-assembly2.cif.gz_B potassium bound structure of e. coli exoix in p1 0.8107 1 239
ID Description Score Start End Superfamily
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8585 3 166 3.40.50.1010
af_P9WNU5_7_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8355 2 166 3.40.50.1010
af_Q2FYJ1_1_174_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8237 2 166 3.40.50.1010
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8158 3 166 3.40.50.1010
af_Q8I7W9_262_459_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8071 2 166 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1G0LXP3-F1-model_v4 5'-3' exonuclease domain-containing protein 0.9883 1 162 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A534DP25-F1-model_v4 deleted 0.978 1 268
AF-A0A534HDU0-F1-model_v4 Flap endonuclease 0.9773 1 268 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7W1CVH7-F1-model_v4 Flap endonuclease 0.9759 1 272 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A534GZ59-F1-model_v4 Flap endonuclease 0.9746 1 266 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map