F454589

General Info

Members Datasets Scaffolds Average Seq Length
494 219 479 348

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10002222|Ga0265323_100022222
Length 401
Sequence MSADRVEMPHNAVSAVIDRRYREGRIGRFRSAVTLVTGTGAVNVGAMSDASPNPAAFSCPVPLARQEEIQMAHGGGGRLTQQLIDRVFAPAFHNPALDARHDGALLSAPPSGLRLAFTTDSHVVSPLFFPGGDIGALAVHGTVNDLAMCGARPKWLSAGFILEEGLPIATLERAVASMGAAARAAGVEIVTGDTKVVERGKGDGLYVNTAGVGWIEHGLTIAPTSVRAGDIVLLSGDVGRHGMAILAQREGLAFESPIESDSAPLWPAVEALLAAGIAVHCLRDLTRGGLATAVIEIAEAAXXXMALDETAVPVSEPVRGACEILGLDPLYVANEGRFVAFVPAAQADAALAIIGKTAPGGPPARIGEVRPAPAGQVTLRSVVGVERVLDRLSGEQLPRIC

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
5 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
6 2738541277 Variovorax sp. GV051 Isolate Unclassified
7 2738543019 Variovorax sp. GV040 Isolate Unclassified
8 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
9 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
10 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
11 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
12 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
13 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
14 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
15 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0
Isolates 3.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.4
Rhizoplane 1.62
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1547630 2162886007 Bacteria 19385
2 rootH2_10215629 3300003320 Bacteria 1558
3 Ga0065704_10000385 3300005289 Bacteria 41151
4 Ga0065712_10097452 3300005290 Bacteria 2150
5 Ga0065707_10000437 3300005295 Bacteria 81012
6 Ga0065707_10004989 3300005295 Unclassified 4884
7 Ga0065707_10083484 3300005295 Bacteria 8998
8 Ga0065707_10090500 3300005295 Bacteria 4129
9 Ga0070658_10004953 3300005327 Bacteria 10855
10 Ga0070670_100001321 3300005331 Bacteria 19806
11 Ga0070670_100010021 3300005331 Bacteria 8088
12 Ga0070689_100050650 3300005340 Bacteria 3209
13 Ga0070668_100164509 3300005347 Bacteria 1802
14 Ga0070673_100029534 3300005364 Bacteria 4089
15 Ga0070709_10001725 3300005434 Bacteria 11883
16 Ga0070713_100001174 3300005436 Bacteria 16741
17 Ga0070713_100024925 3300005436 Bacteria 4668
18 Ga0070710_10009163 3300005437 Bacteria 4839
19 Ga0070700_100159368 3300005441 Unclassified 1552
20 Ga0070681_10186417 3300005458 Bacteria 1995
21 Ga0070706_100024694 3300005467 Bacteria 5534
22 Ga0070698_100150398 3300005471 Bacteria 2275
23 Ga0070699_100059949 3300005518 Bacteria 3297
24 Ga0070679_100100274 3300005530 Bacteria 2882
25 Ga0070684_100225563 3300005535 Bacteria 1710
26 Ga0068853_100212455 3300005539 Bacteria 1764
27 Ga0070672_100079913 3300005543 Bacteria 2619
28 Ga0070686_100007024 3300005544 Bacteria 6274
29 Ga0068855_100005707 3300005563 Bacteria 15202
30 Ga0068855_100023113 3300005563 Bacteria 7449
31 Ga0068855_100176509 3300005563 Bacteria 2417
32 Ga0068855_100277266 3300005563 Bacteria 1863
33 Ga0070664_100268682 3300005564 Bacteria 1536
34 Ga0068857_100186761 3300005577 Bacteria 1887
35 Ga0068856_100001056 3300005614 Bacteria 29195
36 Ga0068856_100144960 3300005614 Bacteria 2382
37 Ga0068859_100353486 3300005617 Unclassified 1564
38 Ga0068864_100072453 3300005618 Bacteria 3003
39 Ga0068870_10138326 3300005840 Bacteria 1422
40 Ga0068863_100135500 3300005841 Bacteria 2353
41 Ga0068858_100380179 3300005842 Bacteria 1355
42 Ga0081455_10100348 3300005937 Bacteria 2326
43 Ga0081538_10003792 3300005981 Bacteria 14138
44 Ga0070717_10005366 3300006028 Bacteria 9348
45 Ga0070715_10017055 3300006163 Bacteria 2742
46 Ga0070716_100106098 3300006173 Bacteria 1732
47 Ga0070712_100000154 3300006175 Bacteria 36911
48 Ga0075430_100164910 3300006846 Bacteria 1844
49 Ga0075431_100196381 3300006847 Bacteria 2066
50 Ga0075429_100000292 3300006880 Bacteria 35394
51 Ga0097620_100353492 3300006931 Unclassified 1564
52 Ga0105240_10127093 3300009093 Bacteria 3062
53 Ga0105240_10190809 3300009093 Bacteria 2410
54 Ga0105240_10310143 3300009093 Bacteria 1802
55 Ga0105247_10093022 3300009101 Bacteria 1916
56 Ga0114129_10029829 3300009147 Bacteria 7724
57 Ga0105241_10117881 3300009174 Bacteria 2134
58 Ga0105248_10129609 3300009177 Bacteria 2845
59 Ga0105237_10002929 3300009545 Bacteria 20666
60 Ga0105237_10092659 3300009545 Bacteria 3011
61 Ga0105238_10028370 3300009551 Bacteria 5703
62 Ga0105238_10338741 3300009551 Unclassified 1492
63 Ga0105249_10007200 3300009553 Bacteria 9710
64 Ga0105239_10023352 3300010375 Bacteria 6811
65 Ga0105246_10031642 3300011119 Bacteria 3502
66 Ga0157374_10016825 3300013296 Bacteria 6435
67 Ga0163163_10000001 3300014325 Bacteria 622185
68 Ga0163163_10257871 3300014325 Bacteria 1794
69 Ga0213873_10042292 3300021358 Bacteria 1178
70 Ga0213872_10017971 3300021361 Bacteria 3262
71 Ga0213872_10114003 3300021361 Bacteria 1199
72 Ga0213874_10001273 3300021377 Bacteria 5213
73 Ga0213876_10000966 3300021384 Bacteria 18914
74 Ga0207692_10046995 3300025898 Bacteria 2166
75 Ga0207643_10143253 3300025908 Bacteria 1429
76 Ga0207705_10104902 3300025909 Bacteria 2083
77 Ga0207695_10043049 3300025913 Bacteria 4816
78 Ga0207695_10275762 3300025913 Bacteria 1576
79 Ga0207671_10026978 3300025914 Bacteria 4297
80 Ga0207693_10001961 3300025915 Bacteria 18051
81 Ga0207663_10160535 3300025916 Bacteria 1586
82 Ga0207652_10174221 3300025921 Bacteria 1931
83 Ga0207659_10020828 3300025926 Bacteria 4341
84 Ga0207700_10001040 3300025928 Bacteria 16020
85 Ga0207664_10040816 3300025929 Bacteria 3612
86 Ga0207664_10136282 3300025929 Bacteria 2072
87 Ga0207691_10030263 3300025940 Bacteria 5060
88 Ga0207679_10030250 3300025945 Bacteria 3779
89 Ga0207679_10338436 3300025945 Bacteria 1308
90 Ga0207667_10000543 3300025949 Bacteria 49789
91 Ga0207712_10024215 3300025961 Bacteria 4018
92 Ga0207668_10172256 3300025972 Bacteria 1699
93 Ga0207639_10187601 3300026041 Bacteria 1764
94 Ga0207708_10073515 3300026075 Bacteria 2620
95 Ga0207702_10005674 3300026078 Bacteria 10883
96 Ga0207676_10062244 3300026095 Bacteria 2959
97 Ga0207674_10249142 3300026116 Bacteria 1723
98 Ga0209971_1020416 3300027682 Bacteria 1576
99 Ga0265337_1000095 3300028556 Bacteria 43526
100 Ga0265337_1000376 3300028556 Bacteria 23950
101 Ga0265337_1002863 3300028556 Bacteria 7701
102 Ga0265337_1014576 3300028556 Bacteria 2603
103 Ga0265326_10006923 3300028558 Bacteria 3496
104 Ga0265326_10009443 3300028558 Bacteria 2918
105 Ga0265326_10017726 3300028558 Bacteria 2052
106 Ga0265319_1000007 3300028563 Bacteria 217194
107 Ga0265319_1000043 3300028563 Bacteria 109696
108 Ga0265334_10003156 3300028573 Bacteria 7522
109 Ga0265334_10023995 3300028573 Bacteria 2477
110 Ga0265334_10040357 3300028573 Bacteria 1829
111 Ga0265318_10000034 3300028577 Bacteria 143153
112 Ga0265318_10000448 3300028577 Bacteria 31088
113 Ga0265318_10005065 3300028577 Bacteria 6244
114 Ga0265318_10010270 3300028577 Bacteria 4086
115 Ga0265318_10011819 3300028577 Bacteria 3740
116 Ga0265318_10026292 3300028577 Bacteria 2292
117 Ga0265318_10053162 3300028577 Bacteria 1519
118 Ga0265323_10002222 3300028653 Bacteria 9036
119 Ga0265323_10002321 3300028653 Bacteria 8803
120 Ga0265323_10003310 3300028653 Bacteria 7155
121 Ga0265323_10004717 3300028653 Bacteria 5847
122 Ga0265323_10007275 3300028653 Bacteria 4612
123 Ga0265323_10008549 3300028653 Bacteria 4218
124 Ga0265323_10013777 3300028653 Bacteria 3216
125 Ga0265323_10017050 3300028653 Bacteria 2827
126 Ga0265323_10028376 3300028653 Bacteria 2098
127 Ga0265323_10030060 3300028653 Bacteria 2027
128 Ga0265323_10056068 3300028653 Bacteria 1383
129 Ga0265322_10000330 3300028654 Bacteria 19904
130 Ga0265322_10000795 3300028654 Bacteria 11326
131 Ga0265322_10004903 3300028654 Bacteria 3965
132 Ga0265322_10015379 3300028654 Bacteria 2212
133 Ga0265336_10002454 3300028666 Bacteria 7632
134 Ga0265336_10006533 3300028666 Bacteria 4196
135 Ga0265336_10013822 3300028666 Bacteria 2686
136 Ga0265338_10000016 3300028800 Bacteria 347424
137 Ga0265338_10000104 3300028800 Bacteria 156596
138 Ga0265338_10000109 3300028800 Bacteria 152826
139 Ga0265338_10000150 3300028800 Bacteria 126424
140 Ga0265338_10000198 3300028800 Bacteria 113584
141 Ga0265338_10000243 3300028800 Bacteria 100885
142 Ga0265338_10000726 3300028800 Bacteria 56154
143 Ga0265338_10001051 3300028800 Bacteria 46110
144 Ga0265338_10003600 3300028800 Bacteria 21630
145 Ga0265338_10003659 3300028800 Bacteria 21411
146 Ga0265338_10003869 3300028800 Bacteria 20743
147 Ga0265338_10004648 3300028800 Bacteria 18444
148 Ga0265338_10005266 3300028800 Bacteria 16949
149 Ga0265338_10007597 3300028800 Bacteria 13393
150 Ga0265338_10022696 3300028800 Bacteria 6481
151 Ga0265338_10067597 3300028800 Bacteria 3085
152 Ga0265338_10079081 3300028800 Bacteria 2769
153 Ga0265338_10079768 3300028800 Bacteria 2753
154 Ga0265338_10149899 3300028800 Bacteria 1813
155 Ga0265338_10170902 3300028800 Bacteria 1667
156 Ga0265338_10196154 3300028800 Bacteria 1526
157 Ga0265338_10197052 3300028800 Bacteria 1522
158 Ga0265338_10230479 3300028800 Bacteria 1378
159 Ga0265324_10000348 3300029957 Bacteria 33500
160 Ga0265324_10000488 3300029957 Bacteria 27664
161 Ga0265324_10003658 3300029957 Bacteria 7214
162 Ga0265324_10007101 3300029957 Bacteria 4584
163 Ga0265324_10018993 3300029957 Bacteria 2478
164 Ga0265324_10074893 3300029957 Bacteria 1152
165 Ga0265330_10008920 3300031235 Bacteria 4789
166 Ga0265330_10019049 3300031235 Bacteria 3149
167 Ga0265330_10112446 3300031235 Bacteria 1162
168 Ga0265332_10000077 3300031238 Bacteria 84198
169 Ga0265332_10011122 3300031238 Bacteria 4000
170 Ga0265332_10012668 3300031238 Bacteria 3740
171 Ga0265332_10018281 3300031238 Bacteria 3093
172 Ga0265332_10043823 3300031238 Bacteria 1931
173 Ga0265328_10008899 3300031239 Bacteria 4114
174 Ga0265320_10001362 3300031240 Bacteria 17820
175 Ga0265320_10001754 3300031240 Bacteria 15368
176 Ga0265320_10001983 3300031240 Bacteria 14441
177 Ga0265320_10006068 3300031240 Bacteria 7665
178 Ga0265320_10006603 3300031240 Bacteria 7292
179 Ga0265320_10008597 3300031240 Bacteria 6232
180 Ga0265320_10009005 3300031240 Bacteria 6053
181 Ga0265320_10013111 3300031240 Bacteria 4781
182 Ga0265320_10041825 3300031240 Bacteria 2277
183 Ga0265320_10055242 3300031240 Bacteria 1912
184 Ga0265320_10058671 3300031240 Bacteria 1842
185 Ga0265325_10000392 3300031241 Bacteria 30937
186 Ga0265325_10000578 3300031241 Bacteria 26630
187 Ga0265325_10006160 3300031241 Bacteria 7319
188 Ga0265325_10041382 3300031241 Bacteria 2415
189 Ga0265325_10058881 3300031241 Bacteria 1955
190 Ga0265325_10063201 3300031241 Bacteria 1873
191 Ga0265325_10079401 3300031241 Bacteria 1633
192 Ga0265325_10116727 3300031241 Bacteria 1291
193 Ga0265329_10000031 3300031242 Bacteria 57648
194 Ga0265340_10000067 3300031247 Bacteria 49055
195 Ga0265340_10001105 3300031247 Bacteria 15371
196 Ga0265340_10001467 3300031247 Bacteria 13525
197 Ga0265340_10001603 3300031247 Bacteria 12993
198 Ga0265340_10001984 3300031247 Bacteria 11706
199 Ga0265340_10006103 3300031247 Bacteria 6643
200 Ga0265340_10007019 3300031247 Bacteria 6144
201 Ga0265340_10023928 3300031247 Bacteria 3108
202 Ga0265340_10039580 3300031247 Unclassified 2325
203 Ga0265340_10050063 3300031247 Bacteria 2028
204 Ga0265339_10000045 3300031249 Bacteria 115884
205 Ga0265339_10005034 3300031249 Bacteria 8889
206 Ga0265339_10007442 3300031249 Bacteria 7075
207 Ga0265339_10021752 3300031249 Bacteria 3725
208 Ga0265339_10026506 3300031249 Bacteria 3319
209 Ga0265339_10032290 3300031249 Bacteria 2953
210 Ga0265339_10046603 3300031249 Bacteria 2382
211 Ga0265339_10058065 3300031249 Bacteria 2091
212 Ga0265339_10064130 3300031249 Bacteria 1972
213 Ga0265339_10087282 3300031249 Bacteria 1640
214 Ga0265339_10099348 3300031249 Bacteria 1517
215 Ga0265331_10024805 3300031250 Bacteria 3030
216 Ga0265327_10000205 3300031251 Bacteria 123596
217 Ga0265327_10000750 3300031251 Bacteria 50498
218 Ga0265327_10000958 3300031251 Bacteria 41429
219 Ga0265327_10000966 3300031251 Bacteria 41122
220 Ga0265327_10001084 3300031251 Bacteria 37901
221 Ga0265327_10004510 3300031251 Bacteria 12287
222 Ga0265327_10007116 3300031251 Bacteria 8735
223 Ga0265327_10036417 3300031251 Bacteria 2705
224 Ga0265327_10050730 3300031251 Bacteria 2169
225 Ga0265327_10082779 3300031251 Bacteria 1580
226 Ga0265316_10000282 3300031344 Bacteria 57053
227 Ga0265316_10000426 3300031344 Bacteria 48045
228 Ga0265316_10000616 3300031344 Bacteria 39606
229 Ga0265316_10005598 3300031344 Bacteria 12168
230 Ga0265316_10010389 3300031344 Bacteria 8487
231 Ga0265316_10010473 3300031344 Bacteria 8444
232 Ga0265316_10010744 3300031344 Bacteria 8317
233 Ga0265316_10014843 3300031344 Bacteria 6835
234 Ga0265316_10032811 3300031344 Bacteria 4236
235 Ga0265316_10042113 3300031344 Bacteria 3651
236 Ga0265316_10042725 3300031344 Bacteria 3620
237 Ga0265316_10069200 3300031344 Bacteria 2724
238 Ga0265316_10080745 3300031344 Bacteria 2494
239 Ga0265316_10082175 3300031344 Bacteria 2468
240 Ga0265316_10085104 3300031344 Bacteria 2420
241 Ga0265316_10095008 3300031344 Bacteria 2271
242 Ga0265316_10099070 3300031344 Bacteria 2217
243 Ga0265316_10109260 3300031344 Bacteria 2096
244 Ga0265316_10133140 3300031344 Bacteria 1871
245 Ga0265316_10153869 3300031344 Bacteria 1722
246 Ga0265316_10179054 3300031344 Bacteria 1579
247 Ga0265316_10248274 3300031344 Bacteria 1307
248 Ga0307408_100016037 3300031548 Bacteria 4997
249 Ga0265313_10000365 3300031595 Bacteria 49111
250 Ga0265313_10000861 3300031595 Bacteria 30620
251 Ga0265313_10001853 3300031595 Bacteria 19251
252 Ga0265313_10002980 3300031595 Bacteria 14117
253 Ga0265313_10003475 3300031595 Bacteria 12720
254 Ga0265313_10004583 3300031595 Bacteria 10516
255 Ga0265313_10005783 3300031595 Bacteria 8985
256 Ga0265313_10012546 3300031595 Bacteria 5161
257 Ga0265313_10015869 3300031595 Bacteria 4358
258 Ga0265313_10017428 3300031595 Bacteria 4082
259 Ga0265313_10032756 3300031595 Bacteria 2649
260 Ga0265313_10051373 3300031595 Bacteria 1973
261 Ga0307508_10020623 3300031616 Bacteria 5985
262 Ga0316575_10033487 3300031665 Bacteria 2015
263 Ga0316579_10005466 3300031691 Bacteria 5131
264 Ga0316579_10102636 3300031691 Bacteria 1370
265 Ga0265314_10000163 3300031711 Bacteria 101795
266 Ga0265314_10000197 3300031711 Bacteria 90193
267 Ga0265314_10001707 3300031711 Bacteria 23848
268 Ga0265314_10001931 3300031711 Bacteria 22152
269 Ga0265314_10004279 3300031711 Bacteria 13352
270 Ga0265314_10005516 3300031711 Bacteria 11386
271 Ga0265314_10028972 3300031711 Bacteria 4121
272 Ga0265314_10038395 3300031711 Bacteria 3459
273 Ga0265314_10060180 3300031711 Bacteria 2593
274 Ga0265314_10073545 3300031711 Bacteria 2279
275 Ga0265314_10138905 3300031711 Unclassified 1505
276 Ga0265342_10000297 3300031712 Bacteria 56545
277 Ga0265342_10001235 3300031712 Bacteria 24169
278 Ga0265342_10002121 3300031712 Bacteria 17491
279 Ga0265342_10002478 3300031712 Bacteria 15923
280 Ga0265342_10036686 3300031712 Bacteria 2994
281 Ga0265342_10038858 3300031712 Bacteria 2895
282 Ga0265342_10070065 3300031712 Bacteria 2046
283 Ga0316576_10000328 3300031727 Bacteria 21299
284 Ga0316576_10043801 3300031727 Bacteria 3231
285 Ga0316576_10091032 3300031727 Bacteria 2273
286 Ga0316578_10012318 3300031728 Bacteria 4507
287 Ga0316578_10012872 3300031728 Bacteria 4420
288 Ga0316578_10102562 3300031728 Bacteria 1716
289 Ga0307413_10001749 3300031824 Bacteria 8492
290 Ga0307406_10032286 3300031901 Bacteria 3196
291 Ga0307406_10035844 3300031901 Bacteria 3054
292 Ga0307407_10019071 3300031903 Bacteria 3485
293 Ga0307412_10087138 3300031911 Bacteria 2175
294 Ga0307409_100315701 3300031995 Bacteria 1460
295 Ga0307416_100001151 3300032002 Bacteria 14217
296 Ga0307416_100222615 3300032002 Bacteria 1811
297 Ga0307411_10003828 3300032005 Bacteria 7080
298 Ga0307411_10030023 3300032005 Bacteria 3328
299 Ga0307415_100004179 3300032126 Bacteria 7454
300 Ga0307415_100179083 3300032126 Bacteria 1661
301 Ga0373929_0000242 3300035085 Bacteria 9992
302 Ga0373949_0003145 3300035090 Bacteria 4023
303 Ga0373932_0000005 3300035112 Bacteria 259528
304 Ga0373954_0015679 3300035118 Bacteria 3389
305 Ga0373954_0078003 3300035118 Unclassified 1580
306 Ga0373956_0056214 3300035119 Bacteria 1776
307 Ga0373943_0124166 3300035170 Unclassified 1375
308 Ga0373943_0127858 3300035170 Bacteria 1357
309 Ga0373946_0063619 3300035171 Unclassified 1576
310 Ga0373946_0069428 3300035171 Bacteria 1518
311 Ga0373955_0111164 3300035172 Bacteria 1584
312 Ga0373931_0000016 3300035691 Bacteria 217932
313 Ga0373927_0001395 3300035695 Bacteria 18205
314 Ga0373927_0016966 3300035695 Bacteria 4799
315 Ga0373927_0025957 3300035695 Bacteria 3829
316 Ga0373947_0024726 3300035725 Bacteria 3501
317 Ga0373937_0020324 3300036401 Bacteria 5953
318 Ga0373937_0139609 3300036401 Bacteria 2266
319 Ga0373937_0245779 3300036401 Bacteria 1686
320 Ga0316582_0056624 3300036647 Bacteria 2502
321 Ga0316584_0022018 3300036712 Bacteria 4643
322 Ga0373925_0002916 3300037068 Bacteria 13488
323 Ga0373925_0077459 3300037068 Bacteria 2523
324 Ga0395905_0006580 3300037471 Bacteria 11671
325 Ga0436365_1378611 3300039437 Bacteria 178407
326 Ga0436361_0815776 3300039447 Bacteria 3048
327 Ga0436361_1142424 3300039447 Bacteria 1318
328 Ga0451577_0000606 3300042876 Bacteria 57749
329 Ga0451577_0002005 3300042876 Bacteria 25323
330 Ga0451577_0002934 3300042876 Bacteria 19547
331 Ga0451577_0006369 3300042876 Bacteria 11787
332 Ga0451577_0011209 3300042876 Bacteria 8499
333 Ga0451577_0015557 3300042876 Bacteria 7073
334 Ga0451577_0018452 3300042876 Bacteria 6427
335 Ga0451577_0019564 3300042876 Bacteria 6224
336 Ga0451577_0056158 3300042876 Bacteria 3511
337 Ga0451577_0080146 3300042876 Bacteria 2911
338 Ga0451577_0196272 3300042876 Bacteria 1822
339 Ga0451577_0218647 3300042876 Bacteria 1722
340 Ga0451577_0262381 3300042876 Bacteria 1564
341 Ga0451577_0319764 3300042876 Bacteria 1407
342 Ga0451577_0426020 3300042876 Bacteria 1205
343 Ga0451577_0442222 3300042876 Bacteria 1180
344 Ga0453683_0019968 3300044673 Bacteria 4285
345 Ga0453683_0115465 3300044673 Bacteria 1689
346 Ga0466963_0032707 3300044694 Bacteria 3370
347 Ga0453684_0000149 3300044712 Bacteria 307732
348 Ga0453684_0000163 3300044712 Bacteria 296196
349 Ga0453684_0003467 3300044712 Bacteria 35441
350 Ga0453684_0007992 3300044712 Bacteria 19162
351 Ga0453684_0011188 3300044712 Bacteria 15105
352 Ga0453684_0011981 3300044712 Bacteria 14423
353 Ga0453684_0015163 3300044712 Bacteria 12226
354 Ga0453684_0026051 3300044712 Bacteria 8465
355 Ga0453684_0040748 3300044712 Bacteria 6301
356 Ga0453684_0045799 3300044712 Bacteria 5829
357 Ga0453684_0083774 3300044712 Bacteria 3968
358 Ga0453684_0090049 3300044712 Bacteria 3792
359 Ga0453684_0119748 3300044712 Bacteria 3181
360 Ga0453684_0264562 3300044712 Bacteria 1968
361 Ga0453684_0373206 3300044712 Bacteria 1603
362 Ga0453684_0407996 3300044712 Bacteria 1520
363 Ga0453684_0420194 3300044712 Bacteria 1493
364 Ga0453684_0436402 3300044712 Bacteria 1460
365 Ga0453684_0520524 3300044712 Bacteria 1314
366 Ga0453684_0655172 3300044712 Bacteria 1145
367 Ga0466960_0002164 3300044901 Bacteria 7334
368 Ga0466959_0121232 3300045049 Bacteria 1859
369 Ga0451576_0000894 3300045051 Bacteria 56660
370 Ga0451576_0002982 3300045051 Bacteria 23983
371 Ga0451576_0010278 3300045051 Bacteria 10749
372 Ga0451576_0014354 3300045051 Bacteria 8823
373 Ga0451576_0019077 3300045051 Bacteria 7495
374 Ga0451576_0026575 3300045051 Bacteria 6225
375 Ga0451576_0031780 3300045051 Bacteria 5626
376 Ga0451576_0060783 3300045051 Bacteria 3941
377 Ga0451576_0078990 3300045051 Bacteria 3423
378 Ga0451576_0084917 3300045051 Bacteria 3293
379 Ga0451576_0146448 3300045051 Bacteria 2462
380 Ga0451576_0160217 3300045051 Bacteria 2348
381 Ga0451576_0222675 3300045051 Bacteria 1970
382 Ga0451576_0271126 3300045051 Bacteria 1774
383 Ga0451576_0389472 3300045051 Bacteria 1461
384 Ga0451576_0425977 3300045051 Bacteria 1392
385 Ga0466967_0039073 3300045976 Bacteria 4076
386 Ga0495592_0089067 3300046454 Bacteria 2217
387 Ga0495592_0162874 3300046454 Bacteria 1533
388 Ga0495629_0049110 3300046459 Bacteria 2958
389 Ga0495641_0073138 3300046461 Bacteria 1538
390 Ga0495651_0047230 3300046462 Bacteria 3330
391 Ga0495651_0076663 3300046462 Bacteria 2532
392 Ga0495580_0033244 3300046472 Bacteria 3717
393 Ga0495639_0065889 3300046475 Bacteria 1666
394 Ga0495664_0124601 3300046477 Bacteria 1558
395 Ga0495628_0021871 3300046516 Bacteria 5257
396 Ga0495628_0028267 3300046516 Bacteria 4557
397 Ga0495628_0038602 3300046516 Bacteria 3822
398 Ga0495630_0000010 3300046517 Bacteria 265324
399 Ga0495630_0010714 3300046517 Bacteria 6622
400 Ga0495630_0068111 3300046517 Unclassified 2676
401 Ga0495652_0012556 3300046529 Bacteria 7639
402 Ga0495640_0085847 3300046533 Bacteria 2085
403 Ga0495640_0099341 3300046533 Bacteria 1912
404 Ga0495586_0000032 3300046535 Bacteria 93203
405 Ga0495586_0013225 3300046535 Bacteria 4376
406 Ga0495586_0046407 3300046535 Bacteria 2342
407 Ga0495586_0186398 3300046535 Bacteria 1175
408 Ga0495587_0011730 3300046536 Bacteria 5546
409 Ga0495598_0019194 3300046537 Bacteria 1789
410 Ga0495645_0007695 3300046543 Bacteria 7496
411 Ga0495667_0020256 3300046559 Bacteria 4488
412 Ga0495667_0043845 3300046559 Bacteria 2963
413 Ga0495634_0001149 3300046642 Bacteria 24443
414 Ga0495635_0089992 3300046663 Unclassified 2100
415 Ga0495635_0156764 3300046663 Unclassified 1549
416 Ga0495657_0014610 3300046675 Bacteria 5762
417 Ga0495599_0042742 3300046678 Bacteria 2844
418 Ga0495599_0070589 3300046678 Bacteria 2180
419 Ga0495647_0029547 3300046681 Bacteria 2027
420 Ga0495658_0029991 3300046683 Bacteria 2949
421 Ga0495613_0021752 3300046689 Bacteria 4778
422 Ga0495613_0041178 3300046689 Bacteria 3421
423 Ga0495613_0218951 3300046689 Bacteria 1337
424 Ga0495600_0178269 3300046809 Unclassified 1370
425 Ga0495604_0254332 3300047317 Bacteria 1196
426 Ga0495674_0000045 3300047319 Bacteria 83352
427 Ga0495674_0087745 3300047319 Bacteria 2662
428 Ga0495674_0092650 3300047319 Bacteria 2579
429 Ga0495674_0213743 3300047319 Bacteria 1596
430 Ga0495674_0318670 3300047319 Bacteria 1267
431 Ga0495680_0047285 3300047322 Bacteria 3385
432 Ga0495675_0001607 3300047444 Bacteria 13585
433 Ga0495684_0004233 3300047471 Bacteria 11205
434 Ga0495684_0005062 3300047471 Bacteria 10287
435 Ga0495684_0034006 3300047471 Bacteria 3911
436 Ga0495602_0032878 3300048088 Bacteria 4876
437 Ga0495602_0120285 3300048088 Bacteria 2114
438 Ga0496100_0313408 3300048903 Bacteria 1177
439 Ga0496101_0213119 3300048904 Bacteria 1497
440 Ga0496109_0147748 3300048912 Bacteria 2199
441 Ga0496110_0065536 3300048913 Bacteria 3212
442 Ga0496112_0134811 3300048915 Bacteria 2440
443 Ga0496112_0224173 3300048915 Bacteria 1835
444 Ga0496113_0010230 3300048916 Bacteria 6194
445 Ga0496115_0007872 3300048918 Bacteria 7860
446 Ga0496119_0010297 3300048922 Bacteria 7882
447 Ga0495682_0026958 3300049460 Bacteria 2133
448 Ga0501031_0003280 3300049568 Bacteria 10392
449 Ga0501032_0116415 3300049569 Bacteria 1767
450 Ga0501033_0029667 3300049570 Bacteria 4110
451 Ga0501033_0031750 3300049570 Bacteria 3966
452 Ga0501033_0060361 3300049570 Bacteria 2798
453 Ga0501034_0005209 3300049571 Bacteria 14266
454 Ga0501034_0188340 3300049571 Bacteria 2026
455 Ga0501037_0072584 3300049573 Bacteria 2503
456 Ga0501038_0048605 3300049574 Bacteria 3670
457 Ga0501039_0178702 3300049575 Bacteria 1669
458 Ga0501039_0253104 3300049575 Bacteria 1385
459 Ga0501046_0000114 3300049580 Bacteria 84468
460 Ga0501047_0040498 3300049581 Bacteria 4506
461 Ga0501047_0091354 3300049581 Bacteria 2922
462 Ga0501047_0140167 3300049581 Bacteria 2297
463 Ga0501047_0211370 3300049581 Bacteria 1798
464 Ga0501048_0205605 3300049582 Bacteria 1396
465 Ga0501067_0001223 3300049583 Bacteria 13954
466 Ga0501073_0031068 3300049589 Bacteria 3812
467 Ga0501080_0312280 3300049742 Bacteria 1424
468 Ga0501083_0076938 3300049744 Bacteria 2214
469 Ga0501083_0162550 3300049744 Bacteria 1460
470 Ga0501035_0012842 3300049822 Bacteria 7735
471 Ga0501035_0119548 3300049822 Bacteria 2304
472 Ga0501035_0126938 3300049822 Bacteria 2227
473 Ga0501044_0000133 3300049823 Bacteria 91116
474 Ga0501044_0001769 3300049823 Bacteria 25264
475 nmdc:mga05p37_32187_c1 3300050507 Bacteria 6412
476 nmdc:mga09592_626_c1 3300050508 Bacteria 27009
477 nmdc:mga06r32_233143_c1 3300050510 Bacteria 1829
478 Ga0501084_0007795 3300054114 Bacteria 8813
479 Ga0501082_0106908 3300060353 Bacteria 2420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048088 Ga0495602_0120285 Ga0495602_0120285_1246_2103 274
2 3300044694 Ga0466963_0032707 Ga0466963_0032707_1537_2649 301
3 3300044901 Ga0466960_0002164 Ga0466960_0002164_545_1657 301
4 3300035118 Ga0373954_0078003 Ga0373954_0078003_99_1052 305
5 3300045976 Ga0466967_0039073 Ga0466967_0039073_1741_2856 305
6 3300049570 Ga0501033_0031750 Ga0501033_0031750_2936_3946 309
7 3300028577 Ga0265318_10053162 Ga0265318_100531621 315
8 3300028653 Ga0265323_10030060 Ga0265323_100300602 315
9 3300031240 Ga0265320_10006068 Ga0265320_100060686 315
10 3300031711 Ga0265314_10060180 Ga0265314_100601802 315
11 3300003320 rootH2_10215629 rootH2_102156291 318
12 3300042876 Ga0451577_0426020 Ga0451577_0426020_233_1195 318
13 3300044712 Ga0453684_0655172 Ga0453684_0655172_46_1011 318
14 3300027682 Ga0209971_1020416 Ga0209971_10204162 319
15 3300031911 Ga0307412_10087138 Ga0307412_100871382 319
16 3300032005 Ga0307411_10030023 Ga0307411_100300234 319
17 3300044673 Ga0453683_0115465 Ga0453683_0115465_702_1667 319
18 3300028573 Ga0265334_10040357 Ga0265334_100403572 320
19 3300031239 Ga0265328_10008899 Ga0265328_100088992 320
20 3300031251 Ga0265327_10000205 Ga0265327_1000020569 320
21 3300009545 Ga0105237_10002929 Ga0105237_100029298 322
22 3300031344 Ga0265316_10153869 Ga0265316_101538692 322
23 3300009551 Ga0105238_10028370 Ga0105238_100283704 323
24 3300048903 Ga0496100_0313408 Ga0496100_0313408_57_1145 323
25 3300048904 Ga0496101_0213119 Ga0496101_0213119_347_1435 323
26 3300048912 Ga0496109_0147748 Ga0496109_0147748_947_2035 323
27 3300048915 Ga0496112_0224173 Ga0496112_0224173_268_1356 323
28 3300048916 Ga0496113_0010230 Ga0496113_0010230_309_1397 323
29 3300049581 Ga0501047_0140167 Ga0501047_0140167_270_1244 323
30 3300031727 Ga0316576_10000328 Ga0316576_100003287 324
31 3300031728 Ga0316578_10012872 Ga0316578_100128722 324
32 3300046517 Ga0495630_0068111 Ga0495630_0068111_537_1580 324
33 3300046559 Ga0495667_0043845 Ga0495667_0043845_1096_2139 324
34 3300046663 Ga0495635_0156764 Ga0495635_0156764_21_1064 324
35 3300046675 Ga0495657_0014610 Ga0495657_0014610_3644_4687 324
36 3300046809 Ga0495600_0178269 Ga0495600_0178269_44_1087 324
37 3300047471 Ga0495684_0005062 Ga0495684_0005062_4610_5653 324
38 3300049573 Ga0501037_0072584 Ga0501037_0072584_874_1920 324
39 3300049589 Ga0501073_0031068 Ga0501073_0031068_1709_2755 324
40 3300049570 Ga0501033_0060361 Ga0501033_0060361_686_1672 326
41 3300031238 Ga0265332_10018281 Ga0265332_100182813 327
42 3300031711 Ga0265314_10000197 Ga0265314_1000019725 327
43 3300031728 Ga0316578_10102562 Ga0316578_101025622 327
44 3300044712 Ga0453684_0264562 Ga0453684_0264562_874_1944 327
45 3300046516 Ga0495628_0021871 Ga0495628_0021871_1228_2277 327
46 3300049571 Ga0501034_0188340 Ga0501034_0188340_985_1974 327
47 3300049575 Ga0501039_0178702 Ga0501039_0178702_616_1605 327
48 3300005563 Ga0068855_100277266 Ga0068855_1002772662 328
49 3300005937 Ga0081455_10100348 Ga0081455_101003481 328
50 3300009093 Ga0105240_10310143 Ga0105240_103101432 328
51 3300009174 Ga0105241_10117881 Ga0105241_101178812 328
52 3300009545 Ga0105237_10092659 Ga0105237_100926592 328
53 3300031249 Ga0265339_10064130 Ga0265339_100641302 328
54 3300046462 Ga0495651_0047230 Ga0495651_0047230_188_1189 328
55 3300046477 Ga0495664_0124601 Ga0495664_0124601_41_1042 328
56 3300046516 Ga0495628_0028267 Ga0495628_0028267_805_1806 328
57 3300046529 Ga0495652_0012556 Ga0495652_0012556_5257_6258 328
58 3300046543 Ga0495645_0007695 Ga0495645_0007695_515_1516 328
59 3300046678 Ga0495599_0042742 Ga0495599_0042742_944_1945 328
60 3300046689 Ga0495613_0218951 Ga0495613_0218951_12_1013 328
61 3300047317 Ga0495604_0254332 Ga0495604_0254332_41_1042 328
62 3300047319 Ga0495674_0213743 Ga0495674_0213743_423_1424 328
63 3300047319 Ga0495674_0318670 Ga0495674_0318670_140_1141 328
64 3300031901 Ga0307406_10032286 Ga0307406_100322864 329
65 3300031995 Ga0307409_100315701 Ga0307409_1003157012 329
66 3300032002 Ga0307416_100222615 Ga0307416_1002226152 329
67 3300032126 Ga0307415_100179083 Ga0307415_1001790832 329
68 iso_pu_bacteria 2929297113 2929299528 329
69 3300045051 Ga0451576_0014354 Ga0451576_0014354_1196_2227 330
70 3300045051 Ga0451576_0271126 Ga0451576_0271126_750_1742 330
71 3300031727 Ga0316576_10043801 Ga0316576_100438013 331
72 3300046517 Ga0495630_0010714 Ga0495630_0010714_513_1565 331
73 3300031728 Ga0316578_10012318 Ga0316578_100123184 332
74 3300005981 Ga0081538_10003792 Ga0081538_100037927 333
75 3300028563 Ga0265319_1000043 Ga0265319_100004376 333
76 3300028577 Ga0265318_10000448 Ga0265318_1000044813 333
77 3300031711 Ga0265314_10005516 Ga0265314_100055163 333
78 3300005340 Ga0070689_100050650 Ga0070689_1000506502 334
79 3300005347 Ga0070668_100164509 Ga0070668_1001645092 334
80 3300005436 Ga0070713_100024925 Ga0070713_1000249254 334
81 3300009177 Ga0105248_10129609 Ga0105248_101296093 334
82 3300025972 Ga0207668_10172256 Ga0207668_101722562 334
83 3300046516 Ga0495628_0038602 Ga0495628_0038602_2440_3483 334
84 3300046678 Ga0495599_0070589 Ga0495599_0070589_47_1090 334
85 3300047319 Ga0495674_0092650 Ga0495674_0092650_271_1314 334
86 3300021384 Ga0213876_10000966 Ga0213876_1000096614 335
87 3300028653 Ga0265323_10007275 Ga0265323_100072755 335
88 3300039437 Ga0436365_1378611 Ga0436365_1378611_68938_70050 335
89 iso_pu_bacteria 2846033681 2846036577 335
90 iso_pu_bacteria 2846037992 2846041580 335
91 3300035170 Ga0373943_0127858 Ga0373943_0127858_188_1246 336
92 3300028556 Ga0265337_1014576 Ga0265337_10145763 337
93 3300028577 Ga0265318_10010270 Ga0265318_100102704 337
94 3300028800 Ga0265338_10007597 Ga0265338_100075976 337
95 3300029957 Ga0265324_10007101 Ga0265324_100071014 337
96 3300031240 Ga0265320_10001754 Ga0265320_100017547 337
97 3300031251 Ga0265327_10001084 Ga0265327_100010847 337
98 3300031251 Ga0265327_10004510 Ga0265327_100045107 337
99 3300031344 Ga0265316_10010744 Ga0265316_100107442 337
100 3300031711 Ga0265314_10001707 Ga0265314_100017076 337
101 3300046462 Ga0495651_0076663 Ga0495651_0076663_809_1840 337
102 3300046536 Ga0495587_0011730 Ga0495587_0011730_3119_4150 337
103 3300047444 Ga0495675_0001607 Ga0495675_0001607_11913_12944 337
104 3300047471 Ga0495684_0004233 Ga0495684_0004233_2630_3661 337
105 3300048088 Ga0495602_0032878 Ga0495602_0032878_2683_3714 337
106 3300021377 Ga0213874_10001273 Ga0213874_100012735 338
107 3300036647 Ga0316582_0056624 Ga0316582_0056624_717_1772 338
108 iso_pu_bacteria 2791355137 2792841439 338
109 iso_pu_bacteria 2904615490 2904624862 338
110 iso_pu_bacteria 642555112 642598889 338
111 3300006846 Ga0075430_100164910 Ga0075430_1001649102 339
112 3300031238 Ga0265332_10000077 Ga0265332_1000007739 339
113 3300046533 Ga0495640_0085847 Ga0495640_0085847_866_1918 339
114 iso_pu_bacteria 2547132512 2548848601 339
115 3300005617 Ga0068859_100353486 Ga0068859_1003534862 340
116 3300006931 Ga0097620_100353492 Ga0097620_1003534922 340
117 3300009093 Ga0105240_10127093 Ga0105240_101270934 340
118 3300025913 Ga0207695_10275762 Ga0207695_102757621 340
119 3300025914 Ga0207671_10026978 Ga0207671_100269784 340
120 3300025929 Ga0207664_10040816 Ga0207664_100408164 340
121 3300028653 Ga0265323_10004717 Ga0265323_100047173 340
122 3300031235 Ga0265330_10112446 Ga0265330_101124461 340
123 3300031344 Ga0265316_10082175 Ga0265316_100821753 340
124 3300031711 Ga0265314_10073545 Ga0265314_100735453 340
125 iso_pu_bacteria 2721755763 2723877196 340
126 3300005331 Ga0070670_100001321 Ga0070670_10000132116 341
127 3300005841 Ga0068863_100135500 Ga0068863_1001355002 341
128 3300021358 Ga0213873_10042292 Ga0213873_100422921 341
129 3300021361 Ga0213872_10114003 Ga0213872_101140031 341
130 3300025945 Ga0207679_10338436 Ga0207679_103384361 341
131 3300028800 Ga0265338_10000104 Ga0265338_10000104109 341
132 3300031238 Ga0265332_10012668 Ga0265332_100126682 341
133 3300031665 Ga0316575_10033487 Ga0316575_100334872 341
134 3300031824 Ga0307413_10001749 Ga0307413_100017497 341
135 3300031903 Ga0307407_10019071 Ga0307407_100190712 341
136 3300032002 Ga0307416_100001151 Ga0307416_1000011514 341
137 3300032005 Ga0307411_10003828 Ga0307411_100038284 341
138 3300032126 Ga0307415_100004179 Ga0307415_1000041794 341
139 iso_pu_bacteria 2513237082 2513557655 341
140 iso_pu_bacteria 2600255067 2600811877 341
141 iso_pu_bacteria 2738541277 2738721208 341
142 iso_pu_bacteria 2738543019 2739280407 341
143 iso_pu_bacteria 2856287931 2856289672 341
144 iso_pu_bacteria 2857357740 2857364404 341
145 3300005290 Ga0065712_10097452 Ga0065712_100974522 342
146 3300005331 Ga0070670_100010021 Ga0070670_1000100213 342
147 3300005364 Ga0070673_100029534 Ga0070673_1000295343 342
148 3300005543 Ga0070672_100079913 Ga0070672_1000799132 342
149 3300005544 Ga0070686_100007024 Ga0070686_1000070242 342
150 3300005564 Ga0070664_100268682 Ga0070664_1002686822 342
151 3300005618 Ga0068864_100072453 Ga0068864_1000724532 342
152 3300005840 Ga0068870_10138326 Ga0068870_101383262 342
153 3300005842 Ga0068858_100380179 Ga0068858_1003801791 342
154 3300014325 Ga0163163_10257871 Ga0163163_102578712 342
155 3300021361 Ga0213872_10017971 Ga0213872_100179713 342
156 3300025908 Ga0207643_10143253 Ga0207643_101432532 342
157 3300025926 Ga0207659_10020828 Ga0207659_100208283 342
158 3300025940 Ga0207691_10030263 Ga0207691_100302633 342
159 3300025945 Ga0207679_10030250 Ga0207679_100302502 342
160 3300026095 Ga0207676_10062244 Ga0207676_100622442 342
161 3300031240 Ga0265320_10058671 Ga0265320_100586712 342
162 3300031344 Ga0265316_10032811 Ga0265316_100328114 342
163 3300031344 Ga0265316_10069200 Ga0265316_100692002 342
164 3300031344 Ga0265316_10095008 Ga0265316_100950083 342
165 3300031344 Ga0265316_10133140 Ga0265316_101331401 342
166 3300031616 Ga0307508_10020623 Ga0307508_100206236 342
167 3300031901 Ga0307406_10035844 Ga0307406_100358444 342
168 3300035171 Ga0373946_0069428 Ga0373946_0069428_386_1438 342
169 3300039447 Ga0436361_0815776 Ga0436361_0815776_1507_2547 342
170 3300042876 Ga0451577_0002934 Ga0451577_0002934_7576_8628 342
171 3300042876 Ga0451577_0006369 Ga0451577_0006369_4375_5427 342
172 3300042876 Ga0451577_0018452 Ga0451577_0018452_316_1380 342
173 3300042876 Ga0451577_0019564 Ga0451577_0019564_4368_5432 342
174 3300042876 Ga0451577_0056158 Ga0451577_0056158_1443_2516 342
175 3300042876 Ga0451577_0319764 Ga0451577_0319764_314_1366 342
176 3300042876 Ga0451577_0442222 Ga0451577_0442222_17_1069 342
177 3300044712 Ga0453684_0000149 Ga0453684_0000149_180039_181091 342
178 3300044712 Ga0453684_0000163 Ga0453684_0000163_220464_221516 342
179 3300044712 Ga0453684_0003467 Ga0453684_0003467_32379_33431 342
180 3300044712 Ga0453684_0007992 Ga0453684_0007992_487_1539 342
181 3300044712 Ga0453684_0420194 Ga0453684_0420194_29_1063 342
182 3300045049 Ga0466959_0121232 Ga0466959_0121232_574_1680 342
183 3300045051 Ga0451576_0002982 Ga0451576_0002982_15090_16154 342
184 3300045051 Ga0451576_0019077 Ga0451576_0019077_3711_4775 342
185 3300045051 Ga0451576_0031780 Ga0451576_0031780_2031_3083 342
186 3300045051 Ga0451576_0078990 Ga0451576_0078990_2327_3379 342
187 3300045051 Ga0451576_0146448 Ga0451576_0146448_138_1190 342
188 3300045051 Ga0451576_0160217 Ga0451576_0160217_687_1742 342
189 3300045051 Ga0451576_0389472 Ga0451576_0389472_226_1278 342
190 3300045051 Ga0451576_0425977 Ga0451576_0425977_158_1210 342
191 3300046537 Ga0495598_0019194 Ga0495598_0019194_26_1066 342
192 3300005535 Ga0070684_100225563 Ga0070684_1002255632 343
193 3300005614 Ga0068856_100144960 Ga0068856_1001449603 343
194 3300009551 Ga0105238_10338741 Ga0105238_103387412 343
195 3300028556 Ga0265337_1000095 Ga0265337_100009537 343
196 3300028666 Ga0265336_10006533 Ga0265336_100065333 343
197 3300028800 Ga0265338_10000726 Ga0265338_1000072629 343
198 3300028800 Ga0265338_10001051 Ga0265338_1000105137 343
199 3300028800 Ga0265338_10149899 Ga0265338_101498991 343
200 3300028800 Ga0265338_10197052 Ga0265338_101970522 343
201 3300031251 Ga0265327_10000966 Ga0265327_100009666 343
202 3300031251 Ga0265327_10007116 Ga0265327_100071165 343
203 3300031344 Ga0265316_10000616 Ga0265316_1000061627 343
204 3300031691 Ga0316579_10005466 Ga0316579_100054662 343
205 3300049571 Ga0501034_0005209 Ga0501034_0005209_10156_11268 343
206 3300049580 Ga0501046_0000114 Ga0501046_0000114_25517_26575 343
207 3300049581 Ga0501047_0040498 Ga0501047_0040498_919_2031 343
208 3300049581 Ga0501047_0211370 Ga0501047_0211370_460_1518 343
209 3300049582 Ga0501048_0205605 Ga0501048_0205605_158_1270 343
210 3300049822 Ga0501035_0012842 Ga0501035_0012842_3812_4924 343
211 3300049823 Ga0501044_0001769 Ga0501044_0001769_17990_19102 343
212 3300005458 Ga0070681_10186417 Ga0070681_101864172 344
213 3300005467 Ga0070706_100024694 Ga0070706_1000246945 344
214 3300005518 Ga0070699_100059949 Ga0070699_1000599494 344
215 3300005530 Ga0070679_100100274 Ga0070679_1001002742 344
216 3300005577 Ga0068857_100186761 Ga0068857_1001867612 344
217 3300025921 Ga0207652_10174221 Ga0207652_101742212 344
218 3300026116 Ga0207674_10249142 Ga0207674_102491422 344
219 3300028558 Ga0265326_10009443 Ga0265326_100094432 344
220 3300028654 Ga0265322_10000330 Ga0265322_1000033013 344
221 3300028800 Ga0265338_10000109 Ga0265338_1000010969 344
222 3300031241 Ga0265325_10041382 Ga0265325_100413822 344
223 3300031247 Ga0265340_10039580 Ga0265340_100395802 344
224 3300031548 Ga0307408_100016037 Ga0307408_1000160372 344
225 3300031595 Ga0265313_10032756 Ga0265313_100327562 344
226 3300044712 Ga0453684_0436402 Ga0453684_0436402_156_1211 344
227 3300045051 Ga0451576_0000894 Ga0451576_0000894_45662_46720 344
228 3300046454 Ga0495592_0162874 Ga0495592_0162874_184_1242 344
229 3300048915 Ga0496112_0134811 Ga0496112_0134811_1156_2202 344
230 iso_pu_bacteria 2836160341 2836166335 344
231 3300005295 Ga0065707_10090500 Ga0065707_100905004 345
232 3300005434 Ga0070709_10001725 Ga0070709_100017255 345
233 3300005436 Ga0070713_100001174 Ga0070713_1000011746 345
234 3300005437 Ga0070710_10009163 Ga0070710_100091632 345
235 3300005563 Ga0068855_100023113 Ga0068855_1000231135 345
236 3300005614 Ga0068856_100001056 Ga0068856_1000010562 345
237 3300006163 Ga0070715_10017055 Ga0070715_100170551 345
238 3300006173 Ga0070716_100106098 Ga0070716_1001060981 345
239 3300006175 Ga0070712_100000154 Ga0070712_10000015431 345
240 3300006847 Ga0075431_100196381 Ga0075431_1001963813 345
241 3300006880 Ga0075429_100000292 Ga0075429_10000029210 345
242 3300009093 Ga0105240_10190809 Ga0105240_101908093 345
243 3300009147 Ga0114129_10029829 Ga0114129_100298295 345
244 3300025898 Ga0207692_10046995 Ga0207692_100469951 345
245 3300025915 Ga0207693_10001961 Ga0207693_1000196113 345
246 3300025916 Ga0207663_10160535 Ga0207663_101605352 345
247 3300025928 Ga0207700_10001040 Ga0207700_100010404 345
248 3300026078 Ga0207702_10005674 Ga0207702_100056745 345
249 3300028556 Ga0265337_1000376 Ga0265337_10003767 345
250 3300028556 Ga0265337_1002863 Ga0265337_10028634 345
251 3300028558 Ga0265326_10017726 Ga0265326_100177262 345
252 3300028577 Ga0265318_10011819 Ga0265318_100118193 345
253 3300028577 Ga0265318_10026292 Ga0265318_100262922 345
254 3300028653 Ga0265323_10008549 Ga0265323_100085492 345
255 3300028800 Ga0265338_10000150 Ga0265338_1000015089 345
256 3300028800 Ga0265338_10000243 Ga0265338_1000024331 345
257 3300028800 Ga0265338_10003600 Ga0265338_100036006 345
258 3300028800 Ga0265338_10004648 Ga0265338_1000464813 345
259 3300028800 Ga0265338_10079768 Ga0265338_100797684 345
260 3300028800 Ga0265338_10196154 Ga0265338_101961541 345
261 3300029957 Ga0265324_10000488 Ga0265324_1000048836 345
262 3300029957 Ga0265324_10003658 Ga0265324_100036582 345
263 3300029957 Ga0265324_10074893 Ga0265324_100748931 345
264 3300031235 Ga0265330_10019049 Ga0265330_100190494 345
265 3300031240 Ga0265320_10013111 Ga0265320_100131111 345
266 3300031241 Ga0265325_10000392 Ga0265325_1000039217 345
267 3300031241 Ga0265325_10000578 Ga0265325_100005789 345
268 3300031241 Ga0265325_10006160 Ga0265325_100061602 345
269 3300031247 Ga0265340_10000067 Ga0265340_1000006713 345
270 3300031247 Ga0265340_10001105 Ga0265340_100011058 345
271 3300031247 Ga0265340_10001603 Ga0265340_100016033 345
272 3300031247 Ga0265340_10001984 Ga0265340_100019844 345
273 3300031247 Ga0265340_10006103 Ga0265340_100061032 345
274 3300031247 Ga0265340_10007019 Ga0265340_100070193 345
275 3300031249 Ga0265339_10021752 Ga0265339_100217522 345
276 3300031249 Ga0265339_10032290 Ga0265339_100322902 345
277 3300031249 Ga0265339_10046603 Ga0265339_100466032 345
278 3300031249 Ga0265339_10058065 Ga0265339_100580652 345
279 3300031249 Ga0265339_10087282 Ga0265339_100872822 345
280 3300031250 Ga0265331_10024805 Ga0265331_100248052 345
281 3300031251 Ga0265327_10036417 Ga0265327_100364172 345
282 3300031344 Ga0265316_10000426 Ga0265316_1000042620 345
283 3300031344 Ga0265316_10005598 Ga0265316_100055984 345
284 3300031344 Ga0265316_10042113 Ga0265316_100421133 345
285 3300031344 Ga0265316_10179054 Ga0265316_101790543 345
286 3300031595 Ga0265313_10000861 Ga0265313_1000086119 345
287 3300031595 Ga0265313_10001853 Ga0265313_100018534 345
288 3300031595 Ga0265313_10015869 Ga0265313_100158694 345
289 3300031711 Ga0265314_10000163 Ga0265314_1000016387 345
290 3300031711 Ga0265314_10028972 Ga0265314_100289722 345
291 3300031711 Ga0265314_10138905 Ga0265314_101389052 345
292 3300031712 Ga0265342_10002121 Ga0265342_100021219 345
293 3300031712 Ga0265342_10070065 Ga0265342_100700652 345
294 3300035085 Ga0373929_0000242 Ga0373929_0000242_1534_2586 345
295 3300035090 Ga0373949_0003145 Ga0373949_0003145_659_1711 345
296 3300035112 Ga0373932_0000005 Ga0373932_0000005_181888_182940 345
297 3300035170 Ga0373943_0124166 Ga0373943_0124166_45_1097 345
298 3300035171 Ga0373946_0063619 Ga0373946_0063619_128_1180 345
299 3300035691 Ga0373931_0000016 Ga0373931_0000016_76589_77641 345
300 3300035695 Ga0373927_0016966 Ga0373927_0016966_1959_3011 345
301 3300035695 Ga0373927_0025957 Ga0373927_0025957_2577_3629 345
302 3300035725 Ga0373947_0024726 Ga0373947_0024726_1837_2889 345
303 3300036401 Ga0373937_0139609 Ga0373937_0139609_435_1484 345
304 3300037068 Ga0373925_0002916 Ga0373925_0002916_6509_7561 345
305 3300037068 Ga0373925_0077459 Ga0373925_0077459_1290_2342 345
306 3300042876 Ga0451577_0002005 Ga0451577_0002005_13742_14788 345
307 3300042876 Ga0451577_0011209 Ga0451577_0011209_3663_4715 345
308 3300042876 Ga0451577_0218647 Ga0451577_0218647_63_1115 345
309 3300044712 Ga0453684_0011981 Ga0453684_0011981_10532_11578 345
310 3300044712 Ga0453684_0090049 Ga0453684_0090049_1572_2624 345
311 3300044712 Ga0453684_0520524 Ga0453684_0520524_122_1174 345
312 3300045051 Ga0451576_0026575 Ga0451576_0026575_4662_5795 345
313 3300045051 Ga0451576_0084917 Ga0451576_0084917_2197_3249 345
314 3300046454 Ga0495592_0089067 Ga0495592_0089067_193_1245 345
315 3300046472 Ga0495580_0033244 Ga0495580_0033244_1789_2838 345
316 3300046535 Ga0495586_0013225 Ga0495586_0013225_2849_3901 345
317 3300046535 Ga0495586_0186398 Ga0495586_0186398_46_1098 345
318 3300048922 Ga0496119_0010297 Ga0496119_0010297_1321_2376 345
319 3300050507 nmdc:mga05p37_32187_c1 nmdc:mga05p37_32187_c1_1288_2340 345
320 3300050508 nmdc:mga09592_626_c1 nmdc:mga09592_626_c1_8856_9908 345
321 3300005327 Ga0070658_10004953 Ga0070658_1000495311 346
322 3300005539 Ga0068853_100212455 Ga0068853_1002124551 346
323 3300005563 Ga0068855_100005707 Ga0068855_10000570713 346
324 3300005563 Ga0068855_100176509 Ga0068855_1001765092 346
325 3300006028 Ga0070717_10005366 Ga0070717_100053667 346
326 3300009553 Ga0105249_10007200 Ga0105249_100072009 346
327 3300010375 Ga0105239_10023352 Ga0105239_100233524 346
328 3300013296 Ga0157374_10016825 Ga0157374_100168254 346
329 3300014325 Ga0163163_10000001 Ga0163163_10000001275 346
330 3300025909 Ga0207705_10104902 Ga0207705_101049021 346
331 3300025913 Ga0207695_10043049 Ga0207695_100430492 346
332 3300025929 Ga0207664_10136282 Ga0207664_101362821 346
333 3300025949 Ga0207667_10000543 Ga0207667_100005436 346
334 3300025961 Ga0207712_10024215 Ga0207712_100242152 346
335 3300026041 Ga0207639_10187601 Ga0207639_101876011 346
336 3300028558 Ga0265326_10006923 Ga0265326_100069234 346
337 3300028563 Ga0265319_1000007 Ga0265319_1000007138 346
338 3300028573 Ga0265334_10023995 Ga0265334_100239952 346
339 3300028577 Ga0265318_10005065 Ga0265318_100050653 346
340 3300028653 Ga0265323_10002222 Ga0265323_100022222 346
341 3300028653 Ga0265323_10002321 Ga0265323_100023214 346
342 3300028653 Ga0265323_10003310 Ga0265323_100033106 346
343 3300028653 Ga0265323_10013777 Ga0265323_100137773 346
344 3300028653 Ga0265323_10017050 Ga0265323_100170503 346
345 3300028653 Ga0265323_10028376 Ga0265323_100283762 346
346 3300028653 Ga0265323_10056068 Ga0265323_100560681 346
347 3300028654 Ga0265322_10000795 Ga0265322_100007956 346
348 3300028654 Ga0265322_10004903 Ga0265322_100049033 346
349 3300028654 Ga0265322_10015379 Ga0265322_100153792 346
350 3300028666 Ga0265336_10002454 Ga0265336_100024544 346
351 3300028666 Ga0265336_10013822 Ga0265336_100138223 346
352 3300028800 Ga0265338_10000016 Ga0265338_10000016136 346
353 3300028800 Ga0265338_10000198 Ga0265338_1000019889 346
354 3300028800 Ga0265338_10003659 Ga0265338_1000365919 346
355 3300028800 Ga0265338_10003869 Ga0265338_1000386910 346
356 3300028800 Ga0265338_10005266 Ga0265338_100052668 346
357 3300028800 Ga0265338_10022696 Ga0265338_100226966 346
358 3300028800 Ga0265338_10067597 Ga0265338_100675972 346
359 3300028800 Ga0265338_10079081 Ga0265338_100790812 346
360 3300028800 Ga0265338_10170902 Ga0265338_101709022 346
361 3300028800 Ga0265338_10230479 Ga0265338_102304791 346
362 3300029957 Ga0265324_10000348 Ga0265324_1000034824 346
363 3300031235 Ga0265330_10008920 Ga0265330_100089202 346
364 3300031238 Ga0265332_10043823 Ga0265332_100438232 346
365 3300031240 Ga0265320_10001362 Ga0265320_100013624 346
366 3300031240 Ga0265320_10006603 Ga0265320_100066034 346
367 3300031240 Ga0265320_10008597 Ga0265320_100085974 346
368 3300031240 Ga0265320_10009005 Ga0265320_100090055 346
369 3300031240 Ga0265320_10041825 Ga0265320_100418253 346
370 3300031240 Ga0265320_10055242 Ga0265320_100552422 346
371 3300031241 Ga0265325_10058881 Ga0265325_100588812 346
372 3300031241 Ga0265325_10063201 Ga0265325_100632012 346
373 3300031241 Ga0265325_10116727 Ga0265325_101167272 346
374 3300031242 Ga0265329_10000031 Ga0265329_1000003113 346
375 3300031247 Ga0265340_10001467 Ga0265340_100014678 346
376 3300031247 Ga0265340_10023928 Ga0265340_100239283 346
377 3300031247 Ga0265340_10050063 Ga0265340_100500632 346
378 3300031249 Ga0265339_10000045 Ga0265339_1000004558 346
379 3300031249 Ga0265339_10005034 Ga0265339_100050344 346
380 3300031249 Ga0265339_10007442 Ga0265339_100074423 346
381 3300031249 Ga0265339_10026506 Ga0265339_100265063 346
382 3300031251 Ga0265327_10082779 Ga0265327_100827792 346
383 3300031344 Ga0265316_10000282 Ga0265316_1000028234 346
384 3300031344 Ga0265316_10010389 Ga0265316_100103897 346
385 3300031344 Ga0265316_10010473 Ga0265316_100104734 346
386 3300031344 Ga0265316_10014843 Ga0265316_100148435 346
387 3300031344 Ga0265316_10042725 Ga0265316_100427252 346
388 3300031344 Ga0265316_10080745 Ga0265316_100807452 346
389 3300031344 Ga0265316_10085104 Ga0265316_100851042 346
390 3300031344 Ga0265316_10099070 Ga0265316_100990702 346
391 3300031344 Ga0265316_10109260 Ga0265316_101092602 346
392 3300031344 Ga0265316_10248274 Ga0265316_102482741 346
393 3300031595 Ga0265313_10000365 Ga0265313_1000036527 346
394 3300031595 Ga0265313_10002980 Ga0265313_100029803 346
395 3300031595 Ga0265313_10003475 Ga0265313_100034757 346
396 3300031595 Ga0265313_10005783 Ga0265313_100057836 346
397 3300031595 Ga0265313_10012546 Ga0265313_100125462 346
398 3300031595 Ga0265313_10017428 Ga0265313_100174283 346
399 3300031595 Ga0265313_10051373 Ga0265313_100513732 346
400 3300031691 Ga0316579_10102636 Ga0316579_101026362 346
401 3300031711 Ga0265314_10004279 Ga0265314_100042794 346
402 3300031711 Ga0265314_10038395 Ga0265314_100383954 346
403 3300031712 Ga0265342_10000297 Ga0265342_1000029733 346
404 3300031712 Ga0265342_10001235 Ga0265342_1000123518 346
405 3300031712 Ga0265342_10002478 Ga0265342_1000247812 346
406 3300031712 Ga0265342_10036686 Ga0265342_100366862 346
407 3300031712 Ga0265342_10038858 Ga0265342_100388583 346
408 3300031727 Ga0316576_10091032 Ga0316576_100910322 346
409 3300035118 Ga0373954_0015679 Ga0373954_0015679_1169_2224 346
410 3300035119 Ga0373956_0056214 Ga0373956_0056214_277_1332 346
411 3300035172 Ga0373955_0111164 Ga0373955_0111164_85_1140 346
412 3300035695 Ga0373927_0001395 Ga0373927_0001395_7791_8876 346
413 3300036401 Ga0373937_0020324 Ga0373937_0020324_1528_2583 346
414 3300036401 Ga0373937_0245779 Ga0373937_0245779_537_1592 346
415 3300036712 Ga0316584_0022018 Ga0316584_0022018_2325_3377 346
416 3300037471 Ga0395905_0006580 Ga0395905_0006580_6928_7983 346
417 3300039447 Ga0436361_1142424 Ga0436361_1142424_173_1225 346
418 3300042876 Ga0451577_0000606 Ga0451577_0000606_9572_10648 346
419 3300044712 Ga0453684_0045799 Ga0453684_0045799_2855_3910 346
420 3300044712 Ga0453684_0119748 Ga0453684_0119748_1674_2726 346
421 3300045051 Ga0451576_0222675 Ga0451576_0222675_41_1099 346
422 3300046459 Ga0495629_0049110 Ga0495629_0049110_1169_2224 346
423 3300046461 Ga0495641_0073138 Ga0495641_0073138_10_1065 346
424 3300046475 Ga0495639_0065889 Ga0495639_0065889_117_1172 346
425 3300046517 Ga0495630_0000010 Ga0495630_0000010_36626_37681 346
426 3300046533 Ga0495640_0099341 Ga0495640_0099341_668_1723 346
427 3300046535 Ga0495586_0000032 Ga0495586_0000032_35269_36324 346
428 3300046535 Ga0495586_0046407 Ga0495586_0046407_1052_2107 346
429 3300046559 Ga0495667_0020256 Ga0495667_0020256_74_1129 346
430 3300046642 Ga0495634_0001149 Ga0495634_0001149_13075_14130 346
431 3300046663 Ga0495635_0089992 Ga0495635_0089992_705_1760 346
432 3300046681 Ga0495647_0029547 Ga0495647_0029547_507_1562 346
433 3300046683 Ga0495658_0029991 Ga0495658_0029991_1225_2280 346
434 3300046689 Ga0495613_0021752 Ga0495613_0021752_2257_3312 346
435 3300046689 Ga0495613_0041178 Ga0495613_0041178_541_1596 346
436 3300047319 Ga0495674_0000045 Ga0495674_0000045_18407_19462 346
437 3300047319 Ga0495674_0087745 Ga0495674_0087745_380_1465 346
438 3300047322 Ga0495680_0047285 Ga0495680_0047285_2110_3165 346
439 3300047471 Ga0495684_0034006 Ga0495684_0034006_204_1259 346
440 3300048913 Ga0496110_0065536 Ga0496110_0065536_1813_2868 346
441 3300048918 Ga0496115_0007872 Ga0496115_0007872_2880_3965 346
442 3300049460 Ga0495682_0026958 Ga0495682_0026958_582_1637 346
443 3300049568 Ga0501031_0003280 Ga0501031_0003280_959_2014 346
444 3300049569 Ga0501032_0116415 Ga0501032_0116415_597_1652 346
445 3300049570 Ga0501033_0029667 Ga0501033_0029667_81_1136 346
446 3300049574 Ga0501038_0048605 Ga0501038_0048605_864_1910 346
447 3300049575 Ga0501039_0253104 Ga0501039_0253104_44_1111 346
448 3300049581 Ga0501047_0091354 Ga0501047_0091354_867_1913 346
449 3300049583 Ga0501067_0001223 Ga0501067_0001223_3761_4810 346
450 3300049742 Ga0501080_0312280 Ga0501080_0312280_368_1414 346
451 3300049744 Ga0501083_0076938 Ga0501083_0076938_995_2062 346
452 3300049744 Ga0501083_0162550 Ga0501083_0162550_59_1108 346
453 3300049822 Ga0501035_0119548 Ga0501035_0119548_99_1154 346
454 3300049822 Ga0501035_0126938 Ga0501035_0126938_917_1963 346
455 3300049823 Ga0501044_0000133 Ga0501044_0000133_89944_90999 346
456 3300050510 nmdc:mga06r32_233143_c1 nmdc:mga06r32_233143_c1_468_1526 346
457 3300054114 Ga0501084_0007795 Ga0501084_0007795_6515_7564 346
458 3300060353 Ga0501082_0106908 Ga0501082_0106908_1099_2148 346
459 3300028573 Ga0265334_10003156 Ga0265334_100031566 347
460 3300028577 Ga0265318_10000034 Ga0265318_1000003484 347
461 3300029957 Ga0265324_10018993 Ga0265324_100189932 347
462 3300031238 Ga0265332_10011122 Ga0265332_100111222 347
463 3300031240 Ga0265320_10001983 Ga0265320_100019833 347
464 3300031241 Ga0265325_10079401 Ga0265325_100794011 347
465 3300031249 Ga0265339_10099348 Ga0265339_100993481 347
466 3300031251 Ga0265327_10000750 Ga0265327_100007504 347
467 3300031251 Ga0265327_10000958 Ga0265327_1000095833 347
468 3300031251 Ga0265327_10050730 Ga0265327_100507302 347
469 3300031595 Ga0265313_10004583 Ga0265313_100045836 347
470 3300031711 Ga0265314_10001931 Ga0265314_100019318 347
471 3300042876 Ga0451577_0196272 Ga0451577_0196272_259_1311 347
472 3300042876 Ga0451577_0262381 Ga0451577_0262381_43_1125 347
473 3300044712 Ga0453684_0015163 Ga0453684_0015163_5298_6365 347
474 3300044712 Ga0453684_0407996 Ga0453684_0407996_122_1276 347
475 2162886007 SwRhRL2b_contig_1547630 SwRhRL2b_0643.00004380 350
476 3300005289 Ga0065704_10000385 Ga0065704_1000038519 350
477 3300005295 Ga0065707_10000437 Ga0065707_1000043751 350
478 3300005295 Ga0065707_10004989 Ga0065707_100049891 350
479 3300005295 Ga0065707_10083484 Ga0065707_100834842 350
480 3300005441 Ga0070700_100159368 Ga0070700_1001593682 350
481 3300005471 Ga0070698_100150398 Ga0070698_1001503982 350
482 3300009101 Ga0105247_10093022 Ga0105247_100930222 350
483 3300011119 Ga0105246_10031642 Ga0105246_100316423 350
484 3300026075 Ga0207708_10073515 Ga0207708_100735153 350
485 3300042876 Ga0451577_0015557 Ga0451577_0015557_3345_4400 350
486 3300042876 Ga0451577_0080146 Ga0451577_0080146_1470_2531 350
487 3300044673 Ga0453683_0019968 Ga0453683_0019968_440_1492 350
488 3300044712 Ga0453684_0011188 Ga0453684_0011188_11577_12638 350
489 3300044712 Ga0453684_0026051 Ga0453684_0026051_3652_4707 350
490 3300044712 Ga0453684_0040748 Ga0453684_0040748_3972_5051 350
491 3300044712 Ga0453684_0083774 Ga0453684_0083774_564_1655 350
492 3300044712 Ga0453684_0373206 Ga0453684_0373206_533_1588 350
493 3300045051 Ga0451576_0010278 Ga0451576_0010278_1137_2225 350
494 3300045051 Ga0451576_0060783 Ga0451576_0060783_486_1538 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

100

215

0.93

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

227

380

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vti-assembly1.cif.gz_C crystal structure of hype-hypf complex 0.9664 35 341
3vyt-assembly1.cif.gz_C crystal structure of the hypc-hypd-hype complex (form i inward) 0.9631 19 350
3vti-assembly1.cif.gz_C crystal structure of hype-hypf complex 0.9571 35 341
2z1f-assembly1.cif.gz_A crystal structure of hype from thermococcus kodakaraensis (inward form) 0.953 43 350
3vyt-assembly1.cif.gz_C crystal structure of the hypc-hypd-hype complex (form i inward) 0.949 19 350
ID Description Score Start End Superfamily
2z1fA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9778 55 165 3.30.1330.10
3wjpA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9623 171 348 3.90.650.10
af_Q58089_159_335_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9612 174 350 3.90.650.10
2z1tA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9594 172 350 3.90.650.10
2i6rA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9507 173 350 3.90.650.10
ID Description Score Start End GO Terms
AF-X1IZ93-F1-model_v4 Hydrogenase expression/formation protein HypE 0.9955 100 250 GO:0051604
AF-A0A2N2SIU5-F1-model_v4 Hydrogenase expression/formation protein HypE 0.992 64 350 GO:0051604
AF-A0A2M7P649-F1-model_v4 Hydrogenase expression/formation protein HypE 0.9883 64 350 GO:0051604
AF-A0A355UMJ6-F1-model_v4 Hydrogenase expression/formation protein HypE 0.9882 19 350 GO:0051604
AF-A0A353BIS0-F1-model_v4 Hydrogenase expression/formation protein HypE 0.9863 117 350 GO:0051604

Feature Viewer

pLDDT pTM Quality
92.06 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map