F454592

General Info

Members Datasets Scaffolds Average Seq Length
494 312 990 267

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10029834|Ga0307516_100298344
Length 315
Sequence VNARQFTGFADGLLEAIGVGVEVPGKTLLRDASACFMAGQVTAILGPNGAGKSTLLSLLTGQRAPANGMVRLAGQPLAAHTPGDLARVRACVAQETQVAFDFTVQEVVELGRYPHRRHPSPQESGIVLQAMQATAVDHLAQRALNTLSGGEKARVHLARALAQVWEPVWRKAFFPPGRPKEKTDPSGGREPHEVGERGGSISRWLLLDEPTAALDLQHQHRMLQLVRDWAVGQGVGVVAVLHDLNLALRYSDRCVVLRDGQVVASGASDQVLTPACIEEVWGVRAHAAPAGEGTQRRPQYVFEPGEGDSRGFAGD

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
99 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
100 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
101 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
102 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
103 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
209 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
210 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
211 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
212 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
213 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
226 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2508501039 Frankia saprophytica CN3 Isolate Nodule
234 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
235 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
236 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
237 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
238 2547132374 Acidovorax radicis N35 Isolate Unclassified
239 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
240 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
241 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
242 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
243 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
244 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
245 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
246 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
247 2643221591 Devosia sp. Root685 Isolate Unclassified
248 2643221604 Nocardioides sp. Root190 Isolate Unclassified
249 2643221609 Acidovorax sp. Root217 Isolate Unclassified
250 2643221611 Acidovorax sp. Root219 Isolate Unclassified
251 2643221613 Oerskovia sp. Root22 Isolate Unclassified
252 2643221629 Devosia sp. Root105 Isolate Unclassified
253 2643221662 Devosia sp. Root413D1 Isolate Unclassified
254 2643221717 Acidovorax sp. Root267 Isolate Unclassified
255 2643221721 Oerskovia sp. Root918 Isolate Unclassified
256 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
257 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
258 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
259 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
260 2738541277 Variovorax sp. GV051 Isolate Unclassified
261 2738541305 Nocardioides sp. CF167 Isolate Unclassified
262 2738541307 Variovorax sp. GV008 Isolate Unclassified
263 2738543009 Luteibacter sp. OK325 Isolate Unclassified
264 2738543012 Acidovorax sp. CF301 Isolate Unclassified
265 2738543013 Variovorax sp. BT01 Isolate Unclassified
266 2738543019 Variovorax sp. GV040 Isolate Unclassified
267 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
268 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
269 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
270 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
271 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
272 2816332133 Acidovorax radicis 2721A Isolate Unclassified
273 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
274 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
275 2842677519 Variovorax sp. R-72495 Isolate Unclassified
276 2842733646 Variovorax sp. R-72446 Isolate Unclassified
277 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
278 2854911287 Brucella lupini LUP21 Isolate Unclassified
279 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
280 2857472729 Cohnella sp. R-74144 Isolate Unclassified
281 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
282 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
283 2884411467 Dyella sp. AD56 Isolate Rhizosphere
284 2885198086 Variovorax sp. 679 Isolate Unclassified
285 2885211737 Variovorax sp. 553 Isolate Unclassified
286 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
287 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
288 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
289 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
290 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
291 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
292 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
293 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
294 2928070936 Variovorax gossypii 1167 Isolate Unclassified
295 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
296 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
297 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
298 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
299 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
300 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
301 2941471342 Luteibacter sp. 621 Isolate Unclassified
302 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
303 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
304 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
305 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
306 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
307 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
308 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
309 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
310 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
311 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
312 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83
Metatranscriptomes 0.61
Isolates 16.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.27
Nodule 1.01
Rhizoplane 2.43
Rhizosphere 51.21
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10029834 3300031730 Bacteria 5510
2 JGI24736J21556_1004701 3300001904 Bacteria 2320
3 JGI24740J21852_10001962 3300001979 Bacteria 9394
4 JGI24739J22299_10000009 3300001989 Bacteria 55784
5 JGI24737J22298_10019820 3300001990 Bacteria 2151
6 JGI25159J45721_1000268 3300002987 Bacteria 24366
7 JGI25151J46595_10002521 3300003187 Bacteria 10882
8 JGI25151J46595_10005672 3300003187 Bacteria 6417
9 JGI25153J46596_10011864 3300003215 Bacteria 3817
10 rootH1_10074450 3300003316 Bacteria 8065
11 rootH1_10074450 3300003323 Bacteria 1933
12 rootL2_10157831 3300003322 Bacteria 4705
13 rootH1_10021282 3300003316 Bacteria 3546
14 rootH1_10021282 3300003323 Bacteria 17411
15 rootH1_10306502 3300003323 Bacteria 2034
16 JGI25160J50197_1000071 3300003354 Bacteria 108301
17 JGI25161J50226_1000030 3300003374 Bacteria 142870
18 Ga0006562J51391_1033731 3300003578 Bacteria 1325
19 Ga0006562J51391_1099714 3300003578 Bacteria 2304
20 Ga0006562J51391_1099715 3300003578 Bacteria 3750
21 Ga0055526_1002275 3300003771 Bacteria 13119
22 Ga0055526_1019322 3300003771 Bacteria 2488
23 Ga0055537_1000282 3300003773 Bacteria 36290
24 Ga0055537_1013935 3300003773 Bacteria 1483
25 Ga0055524_1000006 3300003775 Bacteria 324702
26 Ga0055536_1002768 3300003781 Bacteria 9705
27 Ga0055536_1014545 3300003781 Bacteria 2753
28 Ga0055534_1000624 3300003784 Bacteria 18150
29 Ga0055528_1020068 3300003790 Bacteria 2184
30 Ga0055530_10000295 3300003791 Bacteria 45206
31 Ga0055540_1000005 3300003792 Bacteria 378126
32 Ga0055540_1000733 3300003792 Bacteria 22290
33 Ga0055531_10019263 3300003794 Bacteria 2771
34 Ga0055543_1000269 3300004625 Bacteria 38782
35 Ga0065165_1003436 3300005262 Bacteria 11132
36 Ga0065165_1003639 3300005262 Bacteria 10534
37 Ga0065165_1004300 3300005262 Bacteria 8963
38 Ga0065165_1014112 3300005262 Bacteria 3119
39 Ga0068868_100141202 3300005338 Bacteria 1977
40 Ga0070691_10278038 3300005341 Bacteria 907
41 Ga0070668_100301454 3300005347 Bacteria 1344
42 Ga0070688_100082771 3300005365 Bacteria 2081
43 Ga0070714_100214141 3300005435 Bacteria 1767
44 Ga0070686_100051927 3300005544 Bacteria 2612
45 Ga0068855_100001529 3300005563 Bacteria 29012
46 Ga0068855_100001606 3300005563 Bacteria 28376
47 Ga0070664_100299365 3300005564 Bacteria 1453
48 Ga0068857_100000492 3300005577 Bacteria 28313
49 Ga0068857_100261533 3300005577 Bacteria 1588
50 Ga0068854_100000378 3300005578 Bacteria 28376
51 Ga0068854_100001428 3300005578 Bacteria 14444
52 Ga0068852_100083866 3300005616 Bacteria 2835
53 Ga0068859_100048597 3300005617 Bacteria 4261
54 Ga0068851_10028559 3300005834 Bacteria 2757
55 Ga0068858_100032806 3300005842 Bacteria 4823
56 Ga0068862_100405427 3300005844 Bacteria 1276
57 Ga0081539_10000317 3300005985 Bacteria 107746
58 Ga0075428_100205674 3300006844 Bacteria 2127
59 Ga0075430_100083564 3300006846 Bacteria 2675
60 Ga0075433_10137744 3300006852 Bacteria 2169
61 Ga0075429_100188547 3300006880 Bacteria 1807
62 Ga0075429_100357397 3300006880 Bacteria 1279
63 Ga0097620_100048596 3300006931 Bacteria 4261
64 Ga0079104_1011640 3300006946 Bacteria 2816
65 Ga0075435_100039608 3300007076 Bacteria 3761
66 Ga0105244_10007173 3300009036 Bacteria 7111
67 Ga0105240_10000343 3300009093 Bacteria 87196
68 Ga0105240_10000525 3300009093 Bacteria 70614
69 Ga0105240_10005430 3300009093 Bacteria 19001
70 Ga0105240_10009205 3300009093 Bacteria 14006
71 Ga0105240_10152191 3300009093 Bacteria 2754
72 Ga0111539_10108574 3300009094 Bacteria 3256
73 Ga0111539_10248956 3300009094 Bacteria 2069
74 Ga0114129_10585101 3300009147 Bacteria 1448
75 Ga0105243_10004803 3300009148 Bacteria 10618
76 Ga0105237_10000016 3300009545 Bacteria 256506
77 Ga0105239_10000020 3300010375 Bacteria 264435
78 Ga0105239_10045866 3300010375 Bacteria 4790
79 Ga0105239_10767753 3300010375 Bacteria 1104
80 Ga0105246_10129932 3300011119 Bacteria 1880
81 Ga0157370_10159977 3300013104 Bacteria 2095
82 Ga0157369_10006172 3300013105 Bacteria 13909
83 Ga0163162_10088884 3300013306 Bacteria 3169
84 Ga0157375_10139154 3300013308 Bacteria 2553
85 Ga0182008_10000845 3300014497 Bacteria 21349
86 Ga0163161_10004982 3300017792 Bacteria 9241
87 Ga0163161_10005102 3300017792 Bacteria 9138
88 Ga0213872_10003772 3300021361 Bacteria 8266
89 Ga0209147_104730 3300025229 Bacteria 2184
90 Ga0207425_1001788 3300025245 Bacteria 8333
91 Ga0207425_1002577 3300025245 Bacteria 6297
92 Ga0209129_1005056 3300025258 Bacteria 4843
93 Ga0209565_1000004 3300025263 Bacteria 983150
94 Ga0209565_1000745 3300025263 Bacteria 19237
95 Ga0209673_1000450 3300025273 Bacteria 69939
96 Ga0209130_1000060 3300025284 Bacteria 201501
97 Ga0209130_1000818 3300025284 Bacteria 26223
98 Ga0209130_1006660 3300025284 Bacteria 3704
99 Ga0209675_1000096 3300025291 Bacteria 133284
100 Ga0209675_1000458 3300025291 Bacteria 31329
101 Ga0209675_1003175 3300025291 Bacteria 7983
102 Ga0209675_1013485 3300025291 Bacteria 2550
103 Ga0209676_1000007 3300025292 Bacteria 1029371
104 Ga0209676_1000260 3300025292 Bacteria 111683
105 Ga0209676_1002189 3300025292 Bacteria 14632
106 Ga0209676_1013777 3300025292 Bacteria 3085
107 Ga0209025_1000732 3300025294 Bacteria 55664
108 Ga0209025_1001572 3300025294 Bacteria 28902
109 Ga0209025_1002753 3300025294 Bacteria 17782
110 Ga0209025_1005609 3300025294 Bacteria 10137
111 Ga0209025_1033819 3300025294 Bacteria 2352
112 Ga0209564_1000495 3300025295 Bacteria 65018
113 Ga0209564_1000677 3300025295 Bacteria 50407
114 Ga0209564_1028114 3300025295 Bacteria 1807
115 Ga0209758_1000290 3300025297 Bacteria 98878
116 Ga0209758_1005515 3300025297 Bacteria 9667
117 Ga0209758_1077869 3300025297 Bacteria 1014
118 Ga0209050_1000003 3300025298 Bacteria 1609245
119 Ga0209050_1007902 3300025298 Bacteria 5831
120 Ga0209050_1011008 3300025298 Bacteria 4361
121 Ga0209050_1048899 3300025298 Bacteria 1088
122 Ga0209256_1000001 3300025299 Bacteria 2166974
123 Ga0207426_1000025 3300025302 Bacteria 532921
124 Ga0207426_1001808 3300025302 Bacteria 15871
125 Ga0209051_1000003 3300025303 Bacteria 1609245
126 Ga0209051_1000319 3300025303 Bacteria 72894
127 Ga0209257_1000020 3300025304 Bacteria 773356
128 Ga0209257_1015783 3300025304 Bacteria 3109
129 Ga0209257_1016028 3300025304 Bacteria 3062
130 Ga0209257_1024486 3300025304 Bacteria 2089
131 Ga0207656_10017749 3300025321 Bacteria 2792
132 Ga0207647_10000014 3300025904 Bacteria 143525
133 Ga0207695_10000307 3300025913 Bacteria 118870
134 Ga0207695_10000318 3300025913 Bacteria 116126
135 Ga0207695_10000382 3300025913 Bacteria 100524
136 Ga0207695_10015812 3300025913 Bacteria 8863
137 Ga0207695_10105429 3300025913 Bacteria 2806
138 Ga0207671_10000013 3300025914 Bacteria 478458
139 Ga0207690_10058275 3300025932 Bacteria 2612
140 Ga0207709_10000240 3300025935 Bacteria 68308
141 Ga0207669_10189996 3300025937 Bacteria 1481
142 Ga0207679_10209466 3300025945 Bacteria 1634
143 Ga0207667_10000040 3300025949 Bacteria 275827
144 Ga0207667_10000047 3300025949 Bacteria 240471
145 Ga0207668_10040355 3300025972 Bacteria 3149
146 Ga0207640_10000009 3300025981 Bacteria 283101
147 Ga0207640_10003961 3300025981 Bacteria 7992
148 Ga0207703_10077829 3300026035 Bacteria 2754
149 Ga0207678_10097974 3300026067 Bacteria 2505
150 Ga0207674_10000012 3300026116 Bacteria 193220
151 Ga0207698_10028307 3300026142 Bacteria 3994
152 Ga0207698_10277697 3300026142 Bacteria 1548
153 Ga0207428_10121453 3300027907 Bacteria 2003
154 Ga0268265_10415692 3300028380 Bacteria 1247
155 Ga0307515_10000213 3300028794 Bacteria 142742
156 Ga0307515_10000444 3300028794 Bacteria 99282
157 Ga0307515_10001286 3300028794 Bacteria 56985
158 Ga0307515_10208045 3300028794 Bacteria 1810
159 Ga0307515_10215248 3300028794 Bacteria 1754
160 Ga0307512_10249741 3300030522 Bacteria 885
161 Ga0316177_1109894 3300030731 Bacteria 3472
162 Ga0314311_1045676 3300030733 Bacteria 3821
163 Ga0316178_1066381 3300030735 Bacteria 4541
164 Ga0316180_1006347 3300030736 Bacteria 2125
165 Ga0316181_1054005 3300030744 Bacteria 8038
166 Ga0307513_10000006 3300031456 Bacteria 470848
167 Ga0307513_10000094 3300031456 Bacteria 127685
168 Ga0307513_10070770 3300031456 Bacteria 3644
169 Ga0307513_10109754 3300031456 Bacteria 2756
170 Ga0307513_10113574 3300031456 Bacteria 2696
171 Ga0307408_100016308 3300031548 Bacteria 4956
172 Ga0307408_100037454 3300031548 Bacteria 3416
173 Ga0307514_10000819 3300031649 Bacteria 50536
174 Ga0307514_10152822 3300031649 Bacteria 1545
175 Ga0307405_10006953 3300031731 Bacteria 5617
176 Ga0307405_10267846 3300031731 Bacteria 1279
177 Ga0307405_10446530 3300031731 Bacteria 1024
178 Ga0307405_10616663 3300031731 Bacteria 887
179 Ga0307406_10112403 3300031901 Bacteria 1878
180 Ga0307412_10015584 3300031911 Bacteria 4511
181 Ga0307412_10096986 3300031911 Bacteria 2076
182 Ga0307416_100102756 3300032002 Bacteria 2493
183 Ga0307414_10281882 3300032004 Bacteria 1397
184 Ga0307411_10030151 3300032005 Bacteria 3322
185 Ga0316584_0206960 3300036712 Bacteria 1446
186 Ga0395905_0000707 3300037471 Bacteria 44289
187 Ga0395905_0003258 3300037471 Bacteria 17455
188 Ga0436361_0009230 3300039447 Bacteria 32991
189 Ga0451853_3291156 3300041512 Bacteria 1438
190 Ga0451577_0136615 3300042876 Bacteria 2201
191 Ga0451577_0138094 3300042876 Bacteria 2189
192 Ga0451577_0187875 3300042876 Bacteria 1863
193 Ga0451577_0258505 3300042876 Bacteria 1577
194 Ga0451577_0577506 3300042876 Bacteria 1020
195 Ga0466969_0022255 3300044656 Bacteria 3273
196 Ga0466982_0000002 3300044672 Bacteria 454900
197 Ga0453683_0028649 3300044673 Bacteria 3525
198 Ga0466966_0006312 3300044684 Bacteria 7839
199 Ga0466961_0076535 3300044693 Bacteria 2121
200 Ga0466963_0061236 3300044694 Unclassified 2516
201 Ga0466964_0148067 3300044706 Bacteria 1085
202 Ga0453684_0001048 3300044712 Bacteria 88382
203 Ga0453684_0001308 3300044712 Bacteria 73691
204 Ga0453684_0002592 3300044712 Bacteria 43253
205 Ga0453684_0030969 3300044712 Bacteria 7538
206 Ga0453684_0061490 3300044712 Bacteria 4820
207 Ga0453684_0085259 3300044712 Bacteria 3925
208 Ga0453684_0132041 3300044712 Bacteria 2995
209 Ga0453684_0460811 3300044712 Bacteria 1413
210 Ga0466971_0005493 3300044719 Bacteria 5504
211 Ga0466970_0052111 3300044765 Bacteria 2184
212 Ga0466957_0053102 3300044842 Bacteria 2470
213 Ga0466957_0216499 3300044842 Bacteria 1263
214 Ga0466959_0324609 3300045049 Bacteria 1052
215 Ga0451576_0007484 3300045051 Bacteria 13031
216 Ga0451576_0008790 3300045051 Bacteria 11814
217 Ga0451576_0129292 3300045051 Bacteria 2632
218 Ga0495617_000081 3300046452 Bacteria 74014
219 Ga0495617_000279 3300046452 Bacteria 29542
220 Ga0495638_0000139 3300046460 Bacteria 114810
221 Ga0495638_0024599 3300046460 Bacteria 3925
222 Ga0495638_0088171 3300046460 Bacteria 1873
223 Ga0495638_0104872 3300046460 Bacteria 1686
224 Ga0495638_0154698 3300046460 Bacteria 1327
225 Ga0495650_0001790 3300046471 Bacteria 19409
226 Ga0495584_0000221 3300046491 Bacteria 41153
227 Ga0495585_0001150 3300046492 Bacteria 21583
228 Ga0495607_0000067 3300046501 Bacteria 102663
229 Ga0495606_0002675 3300046507 Bacteria 20216
230 Ga0495606_0003127 3300046507 Bacteria 17968
231 Ga0495610_0004309 3300046512 Bacteria 10568
232 Ga0495616_0000051 3300046513 Bacteria 106797
233 Ga0495616_0001145 3300046513 Bacteria 18718
234 Ga0495616_0017453 3300046513 Bacteria 3958
235 Ga0495620_0000066 3300046515 Bacteria 89405
236 Ga0495620_0000379 3300046515 Bacteria 30302
237 Ga0495631_0000174 3300046518 Bacteria 43807
238 Ga0495631_0000792 3300046518 Bacteria 20201
239 Ga0495632_0000059 3300046519 Bacteria 121437
240 Ga0495632_0003696 3300046519 Bacteria 10726
241 Ga0495632_0008606 3300046519 Bacteria 6236
242 Ga0495637_0017844 3300046520 Bacteria 3298
243 Ga0495643_0172874 3300046522 Bacteria 1055
244 Ga0495648_0022258 3300046524 Bacteria 4367
245 Ga0495654_0008411 3300046530 Bacteria 5702
246 Ga0495609_0004802 3300046538 Bacteria 7289
247 Ga0495621_0038580 3300046539 Bacteria 1667
248 Ga0495668_0000858 3300046616 Bacteria 34275
249 Ga0495668_0141228 3300046616 Bacteria 1318
250 Ga0495668_0212052 3300046616 Bacteria 1060
251 Ga0495611_0000002 3300046648 Bacteria 705677
252 Ga0495611_0000032 3300046648 Bacteria 110000
253 Ga0495625_0000002 3300046660 Bacteria 813323
254 Ga0495625_0003466 3300046660 Bacteria 15709
255 Ga0495625_0094507 3300046660 Bacteria 2063
256 Ga0495625_0185846 3300046660 Bacteria 1379
257 Ga0495625_0378790 3300046660 Bacteria 888
258 Ga0495658_0398428 3300046683 Bacteria 877
259 Ga0495670_0000688 3300046691 Bacteria 16104
260 Ga0495670_0002951 3300046691 Bacteria 8392
261 Ga0495671_0000183 3300046692 Bacteria 55588
262 Ga0495589_0000067 3300046794 Bacteria 99395
263 Ga0495660_0000384 3300046810 Bacteria 38494
264 Ga0495676_0147526 3300047321 Bacteria 1678
265 Ga0495683_0002957 3300047323 Bacteria 10044
266 Ga0495679_000003 3300047446 Bacteria 787868
267 Ga0495673_0000310 3300047469 Bacteria 64112
268 Ga0495673_0001190 3300047469 Bacteria 21831
269 Ga0495673_0167845 3300047469 Bacteria 838
270 Ga0495686_0000024 3300047472 Bacteria 400343
271 Ga0495686_0043040 3300047472 Bacteria 2866
272 Ga0495686_0217161 3300047472 Bacteria 1089
273 Ga0495593_0051047 3300047673 Bacteria 2189
274 Ga0496101_0148853 3300048904 Bacteria 1789
275 Ga0496104_0467935 3300048907 Bacteria 1172
276 Ga0496105_0012639 3300048908 Bacteria 6686
277 Ga0496106_0001098 3300048909 Bacteria 20009
278 Ga0496106_0151571 3300048909 Bacteria 1829
279 Ga0496108_0379885 3300048911 Bacteria 1234
280 Ga0496110_0324582 3300048913 Bacteria 1402
281 Ga0496115_0253542 3300048918 Bacteria 1448
282 Ga0496116_0065094 3300048919 Bacteria 2340
283 Ga0496116_0180451 3300048919 Bacteria 1131
284 Ga0496117_0002398 3300048920 Bacteria 23826
285 Ga0496117_0007987 3300048920 Bacteria 10153
286 Ga0496118_0000224 3300048921 Bacteria 98813
287 Ga0496118_0000268 3300048921 Bacteria 91201
288 Ga0496118_0000423 3300048921 Bacteria 70256
289 Ga0496118_0003065 3300048921 Bacteria 21458
290 Ga0496119_0000139 3300048922 Bacteria 101548
291 Ga0496119_0006518 3300048922 Bacteria 10774
292 Ga0496119_0037767 3300048922 Bacteria 3131
293 Ga0496120_0000185 3300048923 Bacteria 106472
294 Ga0496120_0000862 3300048923 Bacteria 42878
295 Ga0496120_0166289 3300048923 Bacteria 1095
296 Ga0496121_0000096 3300048924 Bacteria 207449
297 Ga0496121_0004043 3300048924 Bacteria 20148
298 Ga0496121_0006635 3300048924 Bacteria 14253
299 Ga0496121_0035835 3300048924 Bacteria 4435
300 Ga0496121_0054084 3300048924 Bacteria 3358
301 Ga0496121_0078676 3300048924 Bacteria 2620
302 Ga0496121_0080936 3300048924 Bacteria 2572
303 Ga0496121_0102701 3300048924 Bacteria 2201
304 Ga0496121_0267272 3300048924 Bacteria 1177
305 Ga0496122_0013167 3300048925 Bacteria 8128
306 Ga0496122_0013938 3300048925 Bacteria 7816
307 Ga0496122_0074821 3300048925 Bacteria 2393
308 Ga0496122_0239561 3300048925 Bacteria 1024
309 Ga0496122_0245947 3300048925 Bacteria 1004
310 Ga0496122_0259227 3300048925 Bacteria 966
311 Ga0496123_0015023 3300048926 Bacteria 6378
312 Ga0496123_0033564 3300048926 Bacteria 3691
313 Ga0496123_0074988 3300048926 Bacteria 2090
314 Ga0496123_0104861 3300048926 Bacteria 1633
315 Ga0496123_0171011 3300048926 Bacteria 1146
316 Ga0496124_0041275 3300048927 Bacteria 3983
317 Ga0496124_0185005 3300048927 Bacteria 1599
318 Ga0496125_0000044 3300048928 Bacteria 296762
319 Ga0496125_0000693 3300048928 Bacteria 55603
320 Ga0496125_0009965 3300048928 Bacteria 9658
321 Ga0496125_0070806 3300048928 Bacteria 2728
322 Ga0496125_0139815 3300048928 Bacteria 1685
323 Ga0496126_0000491 3300048929 Bacteria 77939
324 Ga0496126_0008022 3300048929 Bacteria 11457
325 Ga0496126_0012931 3300048929 Bacteria 8522
326 Ga0496126_0024347 3300048929 Bacteria 5846
327 Ga0496126_0068813 3300048929 Bacteria 3159
328 Ga0496126_0076303 3300048929 Bacteria 2973
329 Ga0495678_000026 3300049459 Bacteria 226978
330 Ga0501031_0090719 3300049568 Bacteria 1993
331 Ga0501032_0005254 3300049569 Bacteria 9634
332 Ga0501032_0101115 3300049569 Bacteria 1910
333 Ga0501033_0021293 3300049570 Bacteria 4891
334 Ga0501033_0036530 3300049570 Bacteria 3681
335 Ga0501033_0049915 3300049570 Bacteria 3105
336 Ga0501033_0347604 3300049570 Bacteria 1039
337 Ga0501033_0427965 3300049570 Bacteria 921
338 Ga0501034_0297566 3300049571 Bacteria 1551
339 Ga0501036_0089499 3300049572 Bacteria 2601
340 Ga0501042_0049041 3300049578 Bacteria 3012
341 Ga0501043_0083012 3300049579 Bacteria 2519
342 Ga0501043_0103345 3300049579 Bacteria 2239
343 Ga0501046_0058630 3300049580 Bacteria 3018
344 Ga0501046_0092124 3300049580 Bacteria 2331
345 Ga0501046_0173282 3300049580 Bacteria 1618
346 Ga0501046_0504835 3300049580 Bacteria 866
347 Ga0501047_0160553 3300049581 Bacteria 2119
348 Ga0501047_0206212 3300049581 Bacteria 1825
349 Ga0501070_0205560 3300049586 Bacteria 1617
350 Ga0501070_0227935 3300049586 Bacteria 1527
351 Ga0501075_0148376 3300049591 Bacteria 1788
352 Ga0501249_072539 3300049679 Bacteria 805
353 Ga0501079_0102382 3300049741 Bacteria 2221
354 Ga0501035_0010956 3300049822 Bacteria 8397
355 Ga0501035_0028901 3300049822 Bacteria 5059
356 Ga0501035_0050100 3300049822 Bacteria 3743
357 Ga0501035_0070440 3300049822 Bacteria 3097
358 Ga0501035_0122805 3300049822 Bacteria 2269
359 Ga0501035_0379328 3300049822 Bacteria 1179
360 Ga0501044_0008051 3300049823 Bacteria 11575
361 Ga0501044_0049869 3300049823 Bacteria 4321
362 Ga0501044_0124637 3300049823 Bacteria 2574
363 Ga0501044_0604123 3300049823 Bacteria 990
364 nmdc:mga00v17_146031_c1 3300050491 Bacteria 1518
365 nmdc:mga0yw44_227711_c1 3300050492 Bacteria 1237
366 nmdc:mga0k408_199246_c1 3300050493 Bacteria 1195
367 nmdc:mga05p37_333732_c1 3300050507 Bacteria 1790
368 nmdc:mga09592_164154_c1 3300050508 Bacteria 1919
369 nmdc:mga08y16_113557_c1 3300050511 Bacteria 2820
370 nmdc:mga08y16_123471_c1 3300050511 Bacteria 2694
371 nmdc:mga0a205_35523_c2 3300050515 Bacteria 4455
372 Ga0500643_000031 3300053087 Bacteria 204488
373 Ga0500643_005386 3300053087 Bacteria 5527
374 Ga0500644_0001269 3300053088 Bacteria 6894
375 Ga0500651_0000024 3300053093 Bacteria 129450
376 Ga0500651_0001597 3300053093 Bacteria 11511
377 Ga0500651_0281581 3300053093 Bacteria 959
378 Ga0500641_0065924 3300053096 Unclassified 1516
379 Ga0500555_005962 3300053103 Bacteria 3455
380 Ga0500571_003124 3300053110 Bacteria 8428
381 Ga0500593_000394 3300053117 Bacteria 17385
382 Ga0500594_0001386 3300053118 Bacteria 5259
383 Ga0500594_0011066 3300053118 Bacteria 2104
384 Ga0500607_017269 3300053121 Bacteria 4119
385 Ga0500608_001315 3300053122 Bacteria 8869
386 Ga0500608_007698 3300053122 Bacteria 4475
387 Ga0500618_002261 3300053125 Bacteria 7488
388 Ga0500642_0001859 3300053130 Bacteria 6097
389 Ga0500652_005292 3300053131 Bacteria 4052
390 Ga0500655_007497 3300053133 Bacteria 1962
391 Ga0500658_0000226 3300053134 Bacteria 26958
392 Ga0500658_0000310 3300053134 Bacteria 21887
393 Ga0500559_0003642 3300053136 Bacteria 7532
394 Ga0500559_0016361 3300053136 Bacteria 3130
395 Ga0500559_0029050 3300053136 Bacteria 2365
396 Ga0500564_006460 3300053138 Bacteria 4889
397 Ga0500568_0000892 3300053139 Bacteria 20766
398 Ga0500573_0128999 3300053140 Bacteria 1402
399 Ga0500616_0000001 3300053153 Bacteria 1986011
400 Ga0500616_0057291 3300053153 Bacteria 2030
401 Ga0500616_0099432 3300053153 Bacteria 1425
402 Ga0500622_0000543 3300053156 Bacteria 34737
403 Ga0500624_011148 3300053157 Bacteria 1306
404 Ga0500633_0011923 3300053160 Bacteria 2383
405 Ga0500634_0002280 3300053161 Bacteria 8009
406 Ga0500636_0099488 3300053177 Bacteria 1655
407 Ga0500625_125116 3300053729 Bacteria 1024
408 Ga0500645_000015 3300053730 Bacteria 150140
409 Ga0500645_000651 3300053730 Bacteria 21912
410 Ga0500645_001759 3300053730 Bacteria 10497
411 Ga0500645_032841 3300053730 Bacteria 1555
412 Ga0466962_0006166 3300061719 Bacteria 5760
413 Ga0530510_0014587 3300061734 Bacteria 5544
414 Ga0530510_0038103 3300061734 Bacteria 3470
415 Ga0530510_0179998 3300061734 Bacteria 1567
416 2508674681 2508501039 Bacteria 9978592
417 2511179448 2510917027 Bacteria 5287437
418 2511245708 2511231002 Bacteria 5042903
419 2512635824 2512564013 Bacteria 6286191
420 2526062402 2524614857 Bacteria 4146328
421 2548500190 2547132374 Bacteria 5530232
422 2595317518 2593339198 Bacteria 7267884
423 2595447577 2593339238 Bacteria 4182970
424 2599332091 2599185156 Bacteria 5403036
425 2599624081 2599185214 Bacteria 8209958
426 2599672092 2599185226 Bacteria 8233575
427 2599681825 2599185227 Bacteria 8246414
428 2599693839 2599185229 Bacteria 8216126
429 2643758631 2643221547 Bacteria 4740017
430 2643966072 2643221591 Bacteria 4397626
431 2644036222 2643221604 Bacteria 5014917
432 2644059950 2643221609 Bacteria 6756331
433 2644074432 2643221611 Bacteria 6820941
434 2644080817 2643221613 Bacteria 4622396
435 2644166400 2643221629 Bacteria 5850260
436 2644346559 2643221662 Bacteria 5851492
437 2644644493 2643221717 Bacteria 5676132
438 2644663866 2643221721 Bacteria 4486924
439 2692315182 2690316117 Bacteria 6800650
440 2721025604 2718218334 Bacteria 4765486
441 2723602884 2721755693 Bacteria 6126117
442 2730138870 2728369359 Bacteria 5621728
443 2738719895 2738541277 Bacteria 7458140
444 2738870195 2738541305 Bacteria 4910150
445 2738879693 2738541307 Bacteria 8606193
446 2739225878 2738543009 Bacteria 4944499
447 2739241480 2738543012 Bacteria 7115078
448 2739252611 2738543013 Bacteria 5618633
449 2739279094 2738543019 Bacteria 7459457
450 2740063750 2739367875 Bacteria 4157290
451 2753809591 2751185905 Bacteria 6142767
452 2792620484 2791355091 Bacteria 6135441
453 2792625842 2791355092 Bacteria 6248105
454 2802436573 2802428803 Bacteria 5806948
455 2816473644 2816332133 Bacteria 7249298
456 2837652816 2837651117 Bacteria 3772164
457 2837681807 2837678835 Bacteria 5252418
458 2842681882 2842677519 Bacteria 5615038
459 2842734682 2842733646 Bacteria 5716726
460 2842924446 2842922631 Bacteria 5824079
461 2854916586 2854911287 Bacteria 5582813
462 2857461600 2857460504 Bacteria 5194327
463 2857477033 2857472729 Bacteria 6568124
464 2865001334 2864997549 Bacteria 5139696
465 2884338940 2884338543 Bacteria 4610696
466 2884412932 2884411467 Bacteria 5246714
467 2885199241 2885198086 Bacteria 7212419
468 2885212892 2885211737 Bacteria 7212420
469 2889278847 2889276214 Bacteria 5979355
470 2889300454 2889295896 Bacteria 4704906
471 2898798554 2898795034 Bacteria 4294459
472 2904543958 2904541872 Bacteria 8915136
473 2904598562 2904595352 Bacteria 6124848
474 2915602561 2915597211 Bacteria 6475886
475 2915612020 2915606848 Bacteria 6032732
476 2915652518 2915650412 Bacteria 4288180
477 2928076764 2928070936 Bacteria 8062541
478 2928090487 2928084124 Bacteria 7159212
479 2929162483 2929160207 Bacteria 9075316
480 2929187724 2929183550 Bacteria 6377511
481 2935893859 2935890801 Bacteria 4593001
482 2939635753 2939631187 Bacteria 6118131
483 2939636076 2939631187 Bacteria 6118131
484 2939704565 2939702853 Bacteria 5139229
485 2941475659 2941471342 Bacteria 5018624
486 2945984585 2945984333 Bacteria 7358892
487 2980126216 2980125574 Bacteria 5567337
488 2981287632 2981284811 Bacteria 4641497
489 2981292826 2981289755 Bacteria 4641509
490 2981982960 2981980479 Bacteria 4641628
491 2981987870 2981985349 Bacteria 4641497
492 2996708104 2996706504 Bacteria 5757485
493 648169215 648028048 Bacteria 5394884
494 8005662209 8005658619 Bacteria 4500593
495 8045868035 8045864390 Bacteria 5043873
496 8055036357 8055034563 Bacteria 3562128
497 Ga0307516_10029834
498 JGI24736J21556_1004701
499 JGI24740J21852_10001962
500 JGI24739J22299_10000009
501 JGI24737J22298_10019820
502 JGI25159J45721_1000268
503 JGI25151J46595_10002521
504 JGI25151J46595_10005672
505 JGI25153J46596_10011864
506 rootH1_10074450
507 rootL2_10157831
508 rootH1_10021282
509 rootH1_10306502
510 JGI25160J50197_1000071
511 JGI25161J50226_1000030
512 Ga0006562J51391_1033731
513 Ga0006562J51391_1099714
514 Ga0006562J51391_1099715
515 Ga0055526_1002275
516 Ga0055526_1019322
517 Ga0055537_1000282
518 Ga0055537_1013935
519 Ga0055524_1000006
520 Ga0055536_1002768
521 Ga0055536_1014545
522 Ga0055534_1000624
523 Ga0055528_1020068
524 Ga0055530_10000295
525 Ga0055540_1000005
526 Ga0055540_1000733
527 Ga0055531_10019263
528 Ga0055543_1000269
529 Ga0065165_1003436
530 Ga0065165_1003639
531 Ga0065165_1004300
532 Ga0065165_1014112
533 Ga0068868_100141202
534 Ga0070691_10278038
535 Ga0070668_100301454
536 Ga0070688_100082771
537 Ga0070714_100214141
538 Ga0070686_100051927
539 Ga0068855_100001529
540 Ga0068855_100001606
541 Ga0070664_100299365
542 Ga0068857_100000492
543 Ga0068857_100261533
544 Ga0068854_100000378
545 Ga0068854_100001428
546 Ga0068852_100083866
547 Ga0068859_100048597
548 Ga0068851_10028559
549 Ga0068858_100032806
550 Ga0068862_100405427
551 Ga0081539_10000317
552 Ga0075428_100205674
553 Ga0075430_100083564
554 Ga0075433_10137744
555 Ga0075429_100188547
556 Ga0075429_100357397
557 Ga0097620_100048596
558 Ga0079104_1011640
559 Ga0075435_100039608
560 Ga0105244_10007173
561 Ga0105240_10000343
562 Ga0105240_10000525
563 Ga0105240_10005430
564 Ga0105240_10009205
565 Ga0105240_10152191
566 Ga0111539_10108574
567 Ga0111539_10248956
568 Ga0114129_10585101
569 Ga0105243_10004803
570 Ga0105237_10000016
571 Ga0105239_10000020
572 Ga0105239_10045866
573 Ga0105239_10767753
574 Ga0105246_10129932
575 Ga0157370_10159977
576 Ga0157369_10006172
577 Ga0163162_10088884
578 Ga0157375_10139154
579 Ga0182008_10000845
580 Ga0163161_10004982
581 Ga0163161_10005102
582 Ga0213872_10003772
583 Ga0209147_104730
584 Ga0207425_1001788
585 Ga0207425_1002577
586 Ga0209129_1005056
587 Ga0209565_1000004
588 Ga0209565_1000745
589 Ga0209673_1000450
590 Ga0209130_1000060
591 Ga0209130_1000818
592 Ga0209130_1006660
593 Ga0209675_1000096
594 Ga0209675_1000458
595 Ga0209675_1003175
596 Ga0209675_1013485
597 Ga0209676_1000007
598 Ga0209676_1000260
599 Ga0209676_1002189
600 Ga0209676_1013777
601 Ga0209025_1000732
602 Ga0209025_1001572
603 Ga0209025_1002753
604 Ga0209025_1005609
605 Ga0209025_1033819
606 Ga0209564_1000495
607 Ga0209564_1000677
608 Ga0209564_1028114
609 Ga0209758_1000290
610 Ga0209758_1005515
611 Ga0209758_1077869
612 Ga0209050_1000003
613 Ga0209050_1007902
614 Ga0209050_1011008
615 Ga0209050_1048899
616 Ga0209256_1000001
617 Ga0207426_1000025
618 Ga0207426_1001808
619 Ga0209051_1000003
620 Ga0209051_1000319
621 Ga0209257_1000020
622 Ga0209257_1015783
623 Ga0209257_1016028
624 Ga0209257_1024486
625 Ga0207656_10017749
626 Ga0207647_10000014
627 Ga0207695_10000307
628 Ga0207695_10000318
629 Ga0207695_10000382
630 Ga0207695_10015812
631 Ga0207695_10105429
632 Ga0207671_10000013
633 Ga0207690_10058275
634 Ga0207709_10000240
635 Ga0207669_10189996
636 Ga0207679_10209466
637 Ga0207667_10000040
638 Ga0207667_10000047
639 Ga0207668_10040355
640 Ga0207640_10000009
641 Ga0207640_10003961
642 Ga0207703_10077829
643 Ga0207678_10097974
644 Ga0207674_10000012
645 Ga0207698_10028307
646 Ga0207698_10277697
647 Ga0207428_10121453
648 Ga0268265_10415692
649 Ga0307515_10000213
650 Ga0307515_10000444
651 Ga0307515_10001286
652 Ga0307515_10208045
653 Ga0307515_10215248
654 Ga0307512_10249741
655 Ga0316177_1109894
656 Ga0314311_1045676
657 Ga0316178_1066381
658 Ga0316180_1006347
659 Ga0316181_1054005
660 Ga0307513_10000006
661 Ga0307513_10000094
662 Ga0307513_10070770
663 Ga0307513_10109754
664 Ga0307513_10113574
665 Ga0307408_100016308
666 Ga0307408_100037454
667 Ga0307514_10000819
668 Ga0307514_10152822
669 Ga0307405_10006953
670 Ga0307405_10267846
671 Ga0307405_10446530
672 Ga0307405_10616663
673 Ga0307406_10112403
674 Ga0307412_10015584
675 Ga0307412_10096986
676 Ga0307416_100102756
677 Ga0307414_10281882
678 Ga0307411_10030151
679 Ga0316584_0206960
680 Ga0395905_0000707
681 Ga0395905_0003258
682 Ga0436361_0009230
683 Ga0451853_3291156
684 Ga0451577_0136615
685 Ga0451577_0138094
686 Ga0451577_0187875
687 Ga0451577_0258505
688 Ga0451577_0577506
689 Ga0466969_0022255
690 Ga0466982_0000002
691 Ga0453683_0028649
692 Ga0466966_0006312
693 Ga0466961_0076535
694 Ga0466963_0061236
695 Ga0466964_0148067
696 Ga0453684_0001048
697 Ga0453684_0001308
698 Ga0453684_0002592
699 Ga0453684_0030969
700 Ga0453684_0061490
701 Ga0453684_0085259
702 Ga0453684_0132041
703 Ga0453684_0460811
704 Ga0466971_0005493
705 Ga0466970_0052111
706 Ga0466957_0053102
707 Ga0466957_0216499
708 Ga0466959_0324609
709 Ga0451576_0007484
710 Ga0451576_0008790
711 Ga0451576_0129292
712 Ga0495617_000081
713 Ga0495617_000279
714 Ga0495638_0000139
715 Ga0495638_0024599
716 Ga0495638_0088171
717 Ga0495638_0104872
718 Ga0495638_0154698
719 Ga0495650_0001790
720 Ga0495584_0000221
721 Ga0495585_0001150
722 Ga0495607_0000067
723 Ga0495606_0002675
724 Ga0495606_0003127
725 Ga0495610_0004309
726 Ga0495616_0000051
727 Ga0495616_0001145
728 Ga0495616_0017453
729 Ga0495620_0000066
730 Ga0495620_0000379
731 Ga0495631_0000174
732 Ga0495631_0000792
733 Ga0495632_0000059
734 Ga0495632_0003696
735 Ga0495632_0008606
736 Ga0495637_0017844
737 Ga0495643_0172874
738 Ga0495648_0022258
739 Ga0495654_0008411
740 Ga0495609_0004802
741 Ga0495621_0038580
742 Ga0495668_0000858
743 Ga0495668_0141228
744 Ga0495668_0212052
745 Ga0495611_0000002
746 Ga0495611_0000032
747 Ga0495625_0000002
748 Ga0495625_0003466
749 Ga0495625_0094507
750 Ga0495625_0185846
751 Ga0495625_0378790
752 Ga0495658_0398428
753 Ga0495670_0000688
754 Ga0495670_0002951
755 Ga0495671_0000183
756 Ga0495589_0000067
757 Ga0495660_0000384
758 Ga0495676_0147526
759 Ga0495683_0002957
760 Ga0495679_000003
761 Ga0495673_0000310
762 Ga0495673_0001190
763 Ga0495673_0167845
764 Ga0495686_0000024
765 Ga0495686_0043040
766 Ga0495686_0217161
767 Ga0495593_0051047
768 Ga0496101_0148853
769 Ga0496104_0467935
770 Ga0496105_0012639
771 Ga0496106_0001098
772 Ga0496106_0151571
773 Ga0496108_0379885
774 Ga0496110_0324582
775 Ga0496115_0253542
776 Ga0496116_0065094
777 Ga0496116_0180451
778 Ga0496117_0002398
779 Ga0496117_0007987
780 Ga0496118_0000224
781 Ga0496118_0000268
782 Ga0496118_0000423
783 Ga0496118_0003065
784 Ga0496119_0000139
785 Ga0496119_0006518
786 Ga0496119_0037767
787 Ga0496120_0000185
788 Ga0496120_0000862
789 Ga0496120_0166289
790 Ga0496121_0000096
791 Ga0496121_0004043
792 Ga0496121_0006635
793 Ga0496121_0035835
794 Ga0496121_0054084
795 Ga0496121_0078676
796 Ga0496121_0080936
797 Ga0496121_0102701
798 Ga0496121_0267272
799 Ga0496122_0013167
800 Ga0496122_0013938
801 Ga0496122_0074821
802 Ga0496122_0239561
803 Ga0496122_0245947
804 Ga0496122_0259227
805 Ga0496123_0015023
806 Ga0496123_0033564
807 Ga0496123_0074988
808 Ga0496123_0104861
809 Ga0496123_0171011
810 Ga0496124_0041275
811 Ga0496124_0185005
812 Ga0496125_0000044
813 Ga0496125_0000693
814 Ga0496125_0009965
815 Ga0496125_0070806
816 Ga0496125_0139815
817 Ga0496126_0000491
818 Ga0496126_0008022
819 Ga0496126_0012931
820 Ga0496126_0024347
821 Ga0496126_0068813
822 Ga0496126_0076303
823 Ga0495678_000026
824 Ga0501031_0090719
825 Ga0501032_0005254
826 Ga0501032_0101115
827 Ga0501033_0021293
828 Ga0501033_0036530
829 Ga0501033_0049915
830 Ga0501033_0347604
831 Ga0501033_0427965
832 Ga0501034_0297566
833 Ga0501036_0089499
834 Ga0501042_0049041
835 Ga0501043_0083012
836 Ga0501043_0103345
837 Ga0501046_0058630
838 Ga0501046_0092124
839 Ga0501046_0173282
840 Ga0501046_0504835
841 Ga0501047_0160553
842 Ga0501047_0206212
843 Ga0501070_0205560
844 Ga0501070_0227935
845 Ga0501075_0148376
846 Ga0501249_072539
847 Ga0501079_0102382
848 Ga0501035_0010956
849 Ga0501035_0028901
850 Ga0501035_0050100
851 Ga0501035_0070440
852 Ga0501035_0122805
853 Ga0501035_0379328
854 Ga0501044_0008051
855 Ga0501044_0049869
856 Ga0501044_0124637
857 Ga0501044_0604123
858 nmdc:mga00v17_146031_c1
859 nmdc:mga0yw44_227711_c1
860 nmdc:mga0k408_199246_c1
861 nmdc:mga05p37_333732_c1
862 nmdc:mga09592_164154_c1
863 nmdc:mga08y16_113557_c1
864 nmdc:mga08y16_123471_c1
865 nmdc:mga0a205_35523_c2
866 Ga0500643_000031
867 Ga0500643_005386
868 Ga0500644_0001269
869 Ga0500651_0000024
870 Ga0500651_0001597
871 Ga0500651_0281581
872 Ga0500641_0065924
873 Ga0500555_005962
874 Ga0500571_003124
875 Ga0500593_000394
876 Ga0500594_0001386
877 Ga0500594_0011066
878 Ga0500607_017269
879 Ga0500608_001315
880 Ga0500608_007698
881 Ga0500618_002261
882 Ga0500642_0001859
883 Ga0500652_005292
884 Ga0500655_007497
885 Ga0500658_0000226
886 Ga0500658_0000310
887 Ga0500559_0003642
888 Ga0500559_0016361
889 Ga0500559_0029050
890 Ga0500564_006460
891 Ga0500568_0000892
892 Ga0500573_0128999
893 Ga0500616_0000001
894 Ga0500616_0057291
895 Ga0500616_0099432
896 Ga0500622_0000543
897 Ga0500624_011148
898 Ga0500633_0011923
899 Ga0500634_0002280
900 Ga0500636_0099488
901 Ga0500625_125116
902 Ga0500645_000015
903 Ga0500645_000651
904 Ga0500645_001759
905 Ga0500645_032841
906 Ga0466962_0006166
907 Ga0530510_0014587
908 Ga0530510_0038103
909 Ga0530510_0179998
910 2508674681
911 2511179448
912 2511245708
913 2512635824
914 2526062402
915 2548500190
916 2595317518
917 2595447577
918 2599332091
919 2599624081
920 2599672092
921 2599681825
922 2599693839
923 2643758631
924 2643966072
925 2644036222
926 2644059950
927 2644074432
928 2644080817
929 2644166400
930 2644346559
931 2644644493
932 2644663866
933 2692315182
934 2721025604
935 2723602884
936 2730138870
937 2738719895
938 2738870195
939 2738879693
940 2739225878
941 2739241480
942 2739252611
943 2739279094
944 2740063750
945 2753809591
946 2792620484
947 2792625842
948 2802436573
949 2816473644
950 2837652816
951 2837681807
952 2842681882
953 2842734682
954 2842924446
955 2854916586
956 2857461600
957 2857477033
958 2865001334
959 2884338940
960 2884412932
961 2885199241
962 2885212892
963 2889278847
964 2889300454
965 2898798554
966 2904543958
967 2904598562
968 2915602561
969 2915612020
970 2915652518
971 2928076764
972 2928090487
973 2929162483
974 2929187724
975 2935893859
976 2939635753
977 2939636076
978 2939704565
979 2941475659
980 2945984585
981 2980126216
982 2981287632
983 2981292826
984 2981982960
985 2981987870
986 2996708104
987 648169215
988 8005662209
989 8045868035
990 8055036357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b58-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.9526 9 256
4g1u-assembly1.cif.gz_D x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.9396 8 256
5b57-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.927 9 256
5b58-assembly1.cif.gz_D inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.9265 9 256
5b57-assembly1.cif.gz_D inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.9262 9 256
ID Description Score Start End Superfamily
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9584 9 248 3.40.50.300
4g1uC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9393 7 256 3.40.50.300
af_Q58283_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9367 9 245 3.40.50.300
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9358 9 251 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.929 1 231 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W9ZE67-F1-model_v4 Iron complex transport system ATP-binding protein 0.9669 9 256 GO:0005524
GO:0016887
AF-A0A653LTZ0-F1-model_v4 Hemin import ATP-binding protein HmuV (Modular protein) (EC 3.6.3.-) 0.9622 9 248 GO:0005524
GO:0016020
GO:0016887
AF-A0A0Q8NL85-F1-model_v4 Iron ABC transporter 0.9609 9 247 GO:0005524
GO:0016887
AF-A0A7W0CJP9-F1-model_v4 Iron complex transport system ATP-binding protein 0.9568 9 256 GO:0005524
GO:0016887
AF-A0A2M9LCL9-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9546 5 248 GO:0005524
GO:0016887

Map