F454604

General Info

Members Datasets Scaffolds Average Seq Length
494 290 988 211

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1089434|Ga0436364_1089434_327_1022
Length 231
Sequence MARWLEAAHAQSGEDDMKVGILGSGDVAKALAAGFVKHGHQVTLGTRDTGKLKDFLAQHQGAQAASFAEAAKFGEVVVLAVKGNVAHDALKATGAANLSGKPVIDATNPIADAPPTNGVLKFFTYLDQSLMEQLQSAFPDAHFVKAYNSVGNARMINPEFPGGAKPTMFICGNDDKAKAVVRGINDQFGWETADMGKAEAARAIEPLCMLWCILGFTKNEWTHAFKLLHQA

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
159 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
160 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 1.82
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 13.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1089434 3300037853 Bacteria 1081
2 JGI25156J39149_1001163 3300002705 Bacteria 11713
3 rootH1_10012424 3300003316 Bacteria 16855
4 Ga0058863_11092087 3300004799 Unclassified 1015
5 Ga0065712_10348092 3300005290 Unclassified 791
6 Ga0065707_10103056 3300005295 Bacteria 2770
7 Ga0070658_10094802 3300005327 Bacteria 2463
8 Ga0070683_100032985 3300005329 Bacteria 4719
9 Ga0070683_100240705 3300005329 Bacteria 1721
10 Ga0070690_100000575 3300005330 Bacteria 18554
11 Ga0070690_100163015 3300005330 Bacteria 1529
12 Ga0070690_100233176 3300005330 Bacteria 1295
13 Ga0070670_101054593 3300005331 Unclassified 740
14 Ga0068869_100001102 3300005334 Bacteria 15741
15 Ga0068869_100208441 3300005334 Bacteria 1544
16 Ga0070666_10198773 3300005335 Bacteria 1410
17 Ga0070666_10465528 3300005335 Bacteria 914
18 Ga0070680_100024246 3300005336 Bacteria 4843
19 Ga0070680_100492952 3300005336 Unclassified 1048
20 Ga0070682_100005071 3300005337 Bacteria 7320
21 Ga0068868_100021926 3300005338 Bacteria 4815
22 Ga0068868_100531993 3300005338 Bacteria 1033
23 Ga0068868_100551003 3300005338 Bacteria 1016
24 Ga0070689_100000814 3300005340 Bacteria 19254
25 Ga0070689_100779427 3300005340 Bacteria 840
26 Ga0070687_100000171 3300005343 Bacteria 22395
27 Ga0070692_10002591 3300005345 Bacteria 7050
28 Ga0070692_10138073 3300005345 Bacteria 1377
29 Ga0070669_100072368 3300005353 Bacteria 2552
30 Ga0070675_101142694 3300005354 Bacteria 716
31 Ga0070671_100431679 3300005355 Bacteria 1129
32 Ga0070673_100141774 3300005364 Bacteria 2028
33 Ga0070673_100727504 3300005364 Bacteria 913
34 Ga0070688_100666436 3300005365 Bacteria 803
35 Ga0070659_100426577 3300005366 Bacteria 1122
36 Ga0070703_10015642 3300005406 Bacteria 2173
37 Ga0070703_10020760 3300005406 Bacteria 1914
38 Ga0070703_10133650 3300005406 Bacteria 914
39 Ga0070713_100076875 3300005436 Bacteria 2837
40 Ga0070713_100532687 3300005436 Bacteria 1111
41 Ga0070713_101150198 3300005436 Unclassified 751
42 Ga0070701_10000376 3300005438 Bacteria 14969
43 Ga0070701_10455238 3300005438 Bacteria 822
44 Ga0070711_100107323 3300005439 Unclassified 2043
45 Ga0070705_100000270 3300005440 Bacteria 31405
46 Ga0070700_100002521 3300005441 Bacteria 9338
47 Ga0070694_100000941 3300005444 Bacteria 16440
48 Ga0070694_100849625 3300005444 Bacteria 751
49 Ga0070708_100204035 3300005445 Bacteria 1852
50 Ga0070662_100033739 3300005457 Unclassified 3606
51 Ga0070681_10046516 3300005458 Bacteria 4338
52 Ga0070681_10049411 3300005458 Bacteria 4200
53 Ga0070681_10721441 3300005458 Bacteria 913
54 Ga0068867_100000947 3300005459 Bacteria 19763
55 Ga0070707_100039874 3300005468 Bacteria 4491
56 Ga0070698_100156887 3300005471 Bacteria 2222
57 Ga0070699_100006690 3300005518 Bacteria 10026
58 Ga0070699_100192247 3300005518 Unclassified 1813
59 Ga0070679_100004354 3300005530 Bacteria 13078
60 Ga0070679_100263424 3300005530 Bacteria 1679
61 Ga0070684_100267973 3300005535 Bacteria 1563
62 Ga0070697_100117970 3300005536 Bacteria 2217
63 Ga0070697_100126144 3300005536 Unclassified 2144
64 Ga0068853_100081521 3300005539 Bacteria 2833
65 Ga0068853_101070345 3300005539 Unclassified 777
66 Ga0070686_100000516 3300005544 Bacteria 23132
67 Ga0070686_100136201 3300005544 Bacteria 1704
68 Ga0070695_100000162 3300005545 Bacteria 31870
69 Ga0070696_100001207 3300005546 Bacteria 16779
70 Ga0070696_100001426 3300005546 Bacteria 15634
71 Ga0070696_100002453 3300005546 Bacteria 12299
72 Ga0070696_100006184 3300005546 Bacteria 8003
73 Ga0070696_100155479 3300005546 Bacteria 1682
74 Ga0070693_100000071 3300005547 Bacteria 42071
75 Ga0070704_100001539 3300005549 Bacteria 12433
76 Ga0070704_100210879 3300005549 Bacteria 1574
77 Ga0068855_100004363 3300005563 Bacteria 17292
78 Ga0068855_100120314 3300005563 Unclassified 3005
79 Ga0068855_100260216 3300005563 Unclassified 1933
80 Ga0068854_100004587 3300005578 Bacteria 8712
81 Ga0068856_100006005 3300005614 Bacteria 11948
82 Ga0068856_100231269 3300005614 Bacteria 1864
83 Ga0070702_100000211 3300005615 Bacteria 19353
84 Ga0068852_100404194 3300005616 Bacteria 1344
85 Ga0068852_100636692 3300005616 Bacteria 1073
86 Ga0068859_100001726 3300005617 Bacteria 22275
87 Ga0068859_100131079 3300005617 Bacteria 2579
88 Ga0068859_100955216 3300005617 Unclassified 940
89 Ga0068861_100138348 3300005719 Bacteria 1984
90 Ga0068870_10002272 3300005840 Bacteria 7980
91 Ga0068863_100268894 3300005841 Unclassified 1650
92 Ga0068858_100001499 3300005842 Bacteria 24066
93 Ga0068858_100775325 3300005842 Bacteria 935
94 Ga0068860_100001892 3300005843 Bacteria 22244
95 Ga0068860_100340829 3300005843 Unclassified 1474
96 Ga0068862_100004151 3300005844 Bacteria 12275
97 Ga0068862_100620310 3300005844 Unclassified 1040
98 Ga0070717_10062554 3300006028 Bacteria 3087
99 Ga0075366_10158785 3300006195 Bacteria 1370
100 Ga0097621_100001372 3300006237 Bacteria 16751
101 Ga0068871_100001218 3300006358 Bacteria 17166
102 Ga0068871_100312456 3300006358 Bacteria 1382
103 Ga0075428_100002539 3300006844 Bacteria 19847
104 Ga0075428_100017442 3300006844 Bacteria 7936
105 Ga0075428_100108989 3300006844 Unclassified 3018
106 Ga0075430_100036869 3300006846 Bacteria 4144
107 Ga0075430_100059571 3300006846 Bacteria 3210
108 Ga0075430_100137138 3300006846 Bacteria 2038
109 Ga0075430_100150465 3300006846 Bacteria 1938
110 Ga0075431_100015650 3300006847 Bacteria 7689
111 Ga0075431_100667690 3300006847 Bacteria 1019
112 Ga0075433_10009944 3300006852 Bacteria 7621
113 Ga0075433_10045538 3300006852 Bacteria 3814
114 Ga0075433_10231962 3300006852 Unclassified 1639
115 Ga0075433_10280195 3300006852 Unclassified 1477
116 Ga0075433_10886946 3300006852 Unclassified 778
117 Ga0075433_10956674 3300006852 Unclassified 746
118 Ga0075434_100001831 3300006871 Bacteria 18346
119 Ga0075434_100025766 3300006871 Bacteria 5757
120 Ga0075434_100336546 3300006871 Bacteria 1530
121 Ga0075434_100495130 3300006871 Unclassified 1243
122 Ga0075429_100005800 3300006880 Bacteria 10655
123 Ga0068865_100000407 3300006881 Bacteria 23897
124 Ga0075436_100009289 3300006914 Bacteria 6728
125 Ga0075436_100173322 3300006914 Bacteria 1523
126 Ga0097620_100001726 3300006931 Bacteria 22275
127 Ga0097620_100131079 3300006931 Bacteria 2579
128 Ga0097620_100955446 3300006931 Unclassified 940
129 Ga0075435_100008379 3300007076 Bacteria 7414
130 Ga0075435_100153002 3300007076 Bacteria 1940
131 Ga0105240_10103152 3300009093 Bacteria 3466
132 Ga0105240_10508208 3300009093 Unclassified 1339
133 Ga0105240_10537942 3300009093 Unclassified 1294
134 Ga0105240_10937698 3300009093 Bacteria 929
135 Ga0111539_10013487 3300009094 Bacteria 10213
136 Ga0111539_10034696 3300009094 Bacteria 6113
137 Ga0111539_10386804 3300009094 Bacteria 1629
138 Ga0105245_10003506 3300009098 Bacteria 14041
139 Ga0105245_10010072 3300009098 Bacteria 8236
140 Ga0105245_10016870 3300009098 Bacteria 6375
141 Ga0114129_10002308 3300009147 Bacteria 26441
142 Ga0114129_10006698 3300009147 Bacteria 16362
143 Ga0114129_10037806 3300009147 Bacteria 6813
144 Ga0114129_10223362 3300009147 Unclassified 2540
145 Ga0114129_10530866 3300009147 Bacteria 1533
146 Ga0114129_11600472 3300009147 Bacteria 798
147 Ga0105243_10000583 3300009148 Bacteria 36624
148 Ga0105241_10059707 3300009174 Unclassified 2933
149 Ga0105242_10003882 3300009176 Bacteria 11615
150 Ga0105248_10012840 3300009177 Bacteria 9239
151 Ga0105248_10041798 3300009177 Bacteria 5141
152 Ga0105248_10539172 3300009177 Bacteria 1316
153 Ga0105237_10137006 3300009545 Bacteria 2442
154 Ga0105249_10195820 3300009553 Bacteria 1975
155 Ga0105249_10259769 3300009553 Bacteria 1725
156 Ga0105239_10614660 3300010375 Unclassified 1240
157 Ga0105239_10769853 3300010375 Bacteria 1102
158 Ga0105246_10029011 3300011119 Bacteria 3639
159 Ga0157371_10427135 3300013102 Bacteria 972
160 Ga0157370_10086832 3300013104 Bacteria 2938
161 Ga0157370_10294498 3300013104 Bacteria 1499
162 Ga0157369_10469733 3300013105 Bacteria 1302
163 Ga0157374_10235234 3300013296 Bacteria 1800
164 Ga0157378_10002943 3300013297 Bacteria 15146
165 Ga0157378_10149320 3300013297 Unclassified 2177
166 Ga0157378_10167866 3300013297 Unclassified 2057
167 Ga0157378_10999597 3300013297 Unclassified 871
168 Ga0163162_10023911 3300013306 Bacteria 6029
169 Ga0157375_10075762 3300013308 Bacteria 3389
170 Ga0163163_10037746 3300014325 Unclassified 4701
171 Ga0163163_10059219 3300014325 Bacteria 3787
172 Ga0163163_10134436 3300014325 Bacteria 2513
173 Ga0157380_10188852 3300014326 Bacteria 1817
174 Ga0157380_10255045 3300014326 Bacteria 1590
175 Ga0157379_10059470 3300014968 Bacteria 3417
176 Ga0157379_10143233 3300014968 Bacteria 2155
177 Ga0157376_10001972 3300014969 Bacteria 13728
178 Ga0157376_10413954 3300014969 Bacteria 1306
179 Ga0163161_10504538 3300017792 Bacteria 986
180 Ga0207688_10112226 3300025901 Bacteria 1584
181 Ga0207643_10007956 3300025908 Bacteria 5689
182 Ga0207684_10219127 3300025910 Bacteria 1642
183 Ga0207654_10291887 3300025911 Bacteria 1106
184 Ga0207707_10094747 3300025912 Bacteria 2609
185 Ga0207695_10367379 3300025913 Bacteria 1325
186 Ga0207695_10667298 3300025913 Bacteria 920
187 Ga0207693_10483370 3300025915 Bacteria 967
188 Ga0207663_10053592 3300025916 Unclassified 2521
189 Ga0207660_10002021 3300025917 Bacteria 13487
190 Ga0207660_10123594 3300025917 Bacteria 1963
191 Ga0207662_10000050 3300025918 Bacteria 51610
192 Ga0207652_10104896 3300025921 Bacteria 2501
193 Ga0207652_10249761 3300025921 Bacteria 1600
194 Ga0207646_10031789 3300025922 Bacteria 4778
195 Ga0207681_10510662 3300025923 Unclassified 985
196 Ga0207687_10002282 3300025927 Bacteria 13054
197 Ga0207687_10005719 3300025927 Bacteria 8226
198 Ga0207700_10084709 3300025928 Bacteria 2486
199 Ga0207664_10450903 3300025929 Bacteria 1148
200 Ga0207644_10718154 3300025931 Bacteria 834
201 Ga0207690_10358947 3300025932 Bacteria 1154
202 Ga0207706_10039571 3300025933 Unclassified 4180
203 Ga0207709_10001116 3300025935 Bacteria 19677
204 Ga0207670_10005774 3300025936 Bacteria 6831
205 Ga0207704_10000431 3300025938 Bacteria 18723
206 Ga0207665_10240954 3300025939 Bacteria 1332
207 Ga0207711_10026049 3300025941 Bacteria 4905
208 Ga0207711_10238400 3300025941 Bacteria 1667
209 Ga0207689_10002662 3300025942 Bacteria 16515
210 Ga0207689_10321695 3300025942 Bacteria 1284
211 Ga0207661_10400799 3300025944 Bacteria 1244
212 Ga0207667_10106016 3300025949 Unclassified 2900
213 Ga0207667_10212501 3300025949 Unclassified 1983
214 Ga0207667_10672856 3300025949 Bacteria 1039
215 Ga0207651_10167719 3300025960 Bacteria 1728
216 Ga0207651_10648493 3300025960 Bacteria 927
217 Ga0207712_10002625 3300025961 Bacteria 11514
218 Ga0207640_10035267 3300025981 Bacteria 3129
219 Ga0207677_11054670 3300026023 Bacteria 739
220 Ga0207703_10600159 3300026035 Bacteria 1041
221 Ga0207639_10035656 3300026041 Bacteria 3682
222 Ga0207639_10205227 3300026041 Bacteria 1693
223 Ga0207708_10000375 3300026075 Bacteria 34939
224 Ga0207708_10388217 3300026075 Bacteria 1152
225 Ga0207702_10004664 3300026078 Bacteria 12107
226 Ga0207702_10357172 3300026078 Bacteria 1400
227 Ga0207702_10423683 3300026078 Bacteria 1287
228 Ga0207641_10165657 3300026088 Bacteria 2013
229 Ga0207641_10746170 3300026088 Bacteria 966
230 Ga0207648_10000663 3300026089 Bacteria 38545
231 Ga0207675_100000454 3300026118 Bacteria 39739
232 Ga0207675_101150102 3300026118 Bacteria 796
233 Ga0207428_10003019 3300027907 Bacteria 16581
234 Ga0207428_10011324 3300027907 Bacteria 7889
235 Ga0207428_10120703 3300027907 Unclassified 2010
236 Ga0207428_10203701 3300027907 Bacteria 1488
237 Ga0268265_10001189 3300028380 Bacteria 22690
238 Ga0268264_10002258 3300028381 Bacteria 17067
239 Ga0265337_1056358 3300028556 Bacteria 1096
240 Ga0265334_10008611 3300028573 Bacteria 4332
241 Ga0265334_10040985 3300028573 Bacteria 1811
242 Ga0265334_10077648 3300028573 Unclassified 1228
243 Ga0265318_10000007 3300028577 Bacteria 280699
244 Ga0265323_10014730 3300028653 Bacteria 3086
245 Ga0265322_10072800 3300028654 Bacteria 975
246 Ga0265336_10001353 3300028666 Bacteria 11359
247 Ga0265336_10018355 3300028666 Unclassified 2267
248 Ga0265338_10024630 3300028800 Bacteria 6141
249 Ga0265338_10058799 3300028800 Bacteria 3390
250 Ga0265338_10078097 3300028800 Bacteria 2794
251 Ga0265338_10391399 3300028800 Bacteria 992
252 Ga0265324_10000006 3300029957 Bacteria 267048
253 Ga0265324_10001274 3300029957 Bacteria 14809
254 Ga0265324_10014449 3300029957 Bacteria 2922
255 Ga0265330_10187845 3300031235 Bacteria 875
256 Ga0265328_10005997 3300031239 Bacteria 5175
257 Ga0265320_10040009 3300031240 Bacteria 2340
258 Ga0265325_10000767 3300031241 Bacteria 23240
259 Ga0265340_10122090 3300031247 Bacteria 1198
260 Ga0265331_10026866 3300031250 Bacteria 2890
261 Ga0265331_10094943 3300031250 Bacteria 1376
262 Ga0265316_10054216 3300031344 Unclassified 3140
263 Ga0307509_10403004 3300031507 Bacteria 1074
264 Ga0265313_10015730 3300031595 Bacteria 4386
265 Ga0265314_10000594 3300031711 Bacteria 45538
266 Ga0265314_10004530 3300031711 Bacteria 12844
267 Ga0265314_10197385 3300031711 Unclassified 1192
268 Ga0265314_10264023 3300031711 Bacteria 982
269 Ga0265342_10005610 3300031712 Bacteria 9512
270 Ga0265342_10009909 3300031712 Bacteria 6664
271 Ga0373930_0001188 3300034816 Bacteria 3821
272 Ga0373930_0028237 3300034816 Bacteria 1141
273 Ga0373959_0032979 3300034820 Bacteria 1055
274 Ga0373938_0003154 3300034957 Bacteria 2678
275 Ga0373934_0007838 3300035086 Bacteria 3970
276 Ga0373944_0015791 3300035089 Bacteria 2121
277 Ga0373932_0026808 3300035112 Bacteria 1571
278 Ga0373936_0021937 3300035113 Bacteria 2485
279 Ga0373945_0036345 3300035116 Bacteria 1764
280 Ga0373954_0003898 3300035118 Bacteria 6385
281 Ga0373956_0220660 3300035119 Unclassified 900
282 Ga0373957_0027242 3300035120 Bacteria 2075
283 Ga0373960_0032661 3300035121 Bacteria 1463
284 Ga0373946_0082710 3300035171 Bacteria 1409
285 Ga0373955_0014946 3300035172 Bacteria 3790
286 Ga0373955_0175439 3300035172 Bacteria 1270
287 Ga0373924_0020673 3300035410 Bacteria 2561
288 Ga0373931_0001986 3300035691 Bacteria 9001
289 Ga0373931_0004207 3300035691 Bacteria 6555
290 Ga0373935_0236273 3300035692 Bacteria 1274
291 Ga0373927_0045469 3300035695 Bacteria 2840
292 Ga0373927_0163508 3300035695 Bacteria 1458
293 Ga0373933_0000974 3300035724 Bacteria 17483
294 Ga0373933_0012850 3300035724 Bacteria 4630
295 Ga0373933_0052806 3300035724 Unclassified 2433
296 Ga0373933_0137047 3300035724 Bacteria 1543
297 Ga0373933_0212153 3300035724 Unclassified 1241
298 Ga0373947_0015528 3300035725 Bacteria 4373
299 Ga0373937_0000924 3300036401 Bacteria 24924
300 Ga0373937_0005804 3300036401 Bacteria 10612
301 Ga0373937_0021182 3300036401 Bacteria 5834
302 Ga0373937_0041786 3300036401 Unclassified 4183
303 Ga0373937_0221736 3300036401 Bacteria 1780
304 Ga0373937_0558530 3300036401 Bacteria 1087
305 Ga0373937_0598309 3300036401 Bacteria 1047
306 Ga0373925_0172213 3300037068 Bacteria 1709
307 Ga0395900_0560718 3300037418 Bacteria 1086
308 Ga0436362_0187221 3300039453 Bacteria 736
309 Ga0451802_1021577 3300041460 Unclassified 718
310 Ga0439462_0021171 3300042015 Unclassified 1698
311 Ga0451577_0341339 3300042876 Bacteria 1358
312 Ga0451577_1271237 3300042876 Unclassified 655
313 Ga0453683_0012579 3300044673 Bacteria 5544
314 Ga0453683_0111262 3300044673 Bacteria 1722
315 Ga0453684_0121878 3300044712 Bacteria 3146
316 Ga0453684_0579852 3300044712 Unclassified 1232
317 Ga0451576_0001630 3300045051 Bacteria 37561
318 Ga0451576_0006369 3300045051 Bacteria 14494
319 Ga0451576_0116154 3300045051 Bacteria 2786
320 Ga0451576_0222538 3300045051 Bacteria 1970
321 Ga0451576_0450212 3300045051 Bacteria 1351
322 Ga0451576_0932945 3300045051 Unclassified 910
323 Ga0451576_1040521 3300045051 Bacteria 858
324 Ga0466967_0344392 3300045976 Bacteria 1442
325 Ga0495592_0039769 3300046454 Bacteria 3532
326 Ga0495603_0006754 3300046455 Bacteria 6885
327 Ga0495629_0002047 3300046459 Bacteria 15675
328 Ga0495629_0129217 3300046459 Bacteria 1760
329 Ga0495651_0000214 3300046462 Bacteria 44308
330 Ga0495653_0001647 3300046463 Bacteria 17541
331 Ga0495580_0005855 3300046472 Bacteria 10087
332 Ga0495580_0347653 3300046472 Bacteria 1005
333 Ga0495582_0039527 3300046473 Bacteria 2597
334 Ga0495662_0038562 3300046476 Bacteria 2309
335 Ga0495662_0053605 3300046476 Bacteria 1948
336 Ga0495664_0006909 3300046477 Bacteria 6282
337 Ga0495664_0011809 3300046477 Bacteria 4933
338 Ga0495594_0015299 3300046499 Bacteria 4028
339 Ga0495594_0274144 3300046499 Bacteria 961
340 Ga0495594_0376614 3300046499 Bacteria 808
341 Ga0495608_0009530 3300046511 Bacteria 6781
342 Ga0495618_0000537 3300046514 Bacteria 26842
343 Ga0495618_0001686 3300046514 Bacteria 14661
344 Ga0495618_0009614 3300046514 Bacteria 5839
345 Ga0495628_0030182 3300046516 Bacteria 4391
346 Ga0495630_0063234 3300046517 Bacteria 2780
347 Ga0495630_0087008 3300046517 Bacteria 2360
348 Ga0495630_0408732 3300046517 Bacteria 1040
349 Ga0495630_0475063 3300046517 Bacteria 958
350 Ga0495666_0045798 3300046526 Bacteria 2109
351 Ga0495652_0002479 3300046529 Bacteria 18959
352 Ga0495665_0181629 3300046531 Bacteria 1093
353 Ga0495640_0007570 3300046533 Bacteria 8532
354 Ga0495640_0057472 3300046533 Bacteria 2655
355 Ga0495640_0169488 3300046533 Bacteria 1395
356 Ga0495586_0004334 3300046535 Bacteria 7580
357 Ga0495587_0000715 3300046536 Bacteria 22151
358 Ga0495645_0008358 3300046543 Bacteria 7226
359 Ga0495667_0047639 3300046559 Bacteria 2831
360 Ga0495634_0003492 3300046642 Bacteria 12596
361 Ga0495634_0029297 3300046642 Bacteria 3812
362 Ga0495634_0089664 3300046642 Bacteria 1998
363 Ga0495634_0271576 3300046642 Bacteria 1032
364 Ga0495635_0000562 3300046663 Bacteria 23704
365 Ga0495635_0367398 3300046663 Bacteria 958
366 Ga0495635_0592665 3300046663 Unclassified 724
367 Ga0495588_0070957 3300046674 Bacteria 1811
368 Ga0495657_0109018 3300046675 Bacteria 1756
369 Ga0495599_0008513 3300046678 Bacteria 6240
370 Ga0495623_0001280 3300046679 Bacteria 17075
371 Ga0495623_0064891 3300046679 Bacteria 2284
372 Ga0495646_0002811 3300046680 Bacteria 10773
373 Ga0495647_0005582 3300046681 Bacteria 4130
374 Ga0495658_0002156 3300046683 Bacteria 9965
375 Ga0495658_0013385 3300046683 Bacteria 4175
376 Ga0495658_0016587 3300046683 Bacteria 3791
377 Ga0495613_0012341 3300046689 Bacteria 6347
378 Ga0495613_0049700 3300046689 Bacteria 3094
379 Ga0495624_0210442 3300046690 Bacteria 1180
380 Ga0495624_0243983 3300046690 Bacteria 1087
381 Ga0495600_0013786 3300046809 Bacteria 5090
382 Ga0495600_0383198 3300046809 Bacteria 877
383 Ga0495581_0089301 3300047315 Bacteria 1787
384 Ga0495581_0178096 3300047315 Bacteria 1243
385 Ga0495604_0000382 3300047317 Bacteria 40024
386 Ga0495674_0003824 3300047319 Bacteria 14620
387 Ga0495674_0100098 3300047319 Bacteria 2467
388 Ga0495680_0001240 3300047322 Bacteria 27994
389 Ga0495680_0012581 3300047322 Bacteria 7436
390 Ga0495675_0001812 3300047444 Bacteria 12732
391 Ga0495684_0294040 3300047471 Bacteria 1168
392 Ga0495593_0057173 3300047673 Bacteria 2049
393 Ga0495602_0001751 3300048088 Bacteria 21661
394 Ga0495602_0321645 3300048088 Unclassified 1125
395 Ga0496100_0456019 3300048903 Bacteria 981
396 Ga0496106_0735135 3300048909 Bacteria 785
397 Ga0496107_0288316 3300048910 Bacteria 1222
398 Ga0496108_0416085 3300048911 Bacteria 1174
399 Ga0496109_0136610 3300048912 Bacteria 2291
400 Ga0496109_0877514 3300048912 Bacteria 835
401 Ga0496114_0035068 3300048917 Unclassified 4142
402 Ga0496115_0208839 3300048918 Bacteria 1613
403 Ga0501033_0005965 3300049570 Bacteria 9563
404 Ga0501033_0037825 3300049570 Bacteria 3611
405 Ga0501034_0495994 3300049571 Bacteria 1135
406 Ga0501036_0002300 3300049572 Bacteria 14940
407 Ga0501037_0011409 3300049573 Bacteria 6539
408 Ga0501037_0179566 3300049573 Bacteria 1502
409 Ga0501038_0016769 3300049574 Bacteria 6634
410 Ga0501039_0009384 3300049575 Bacteria 7458
411 Ga0501039_0753363 3300049575 Bacteria 760
412 Ga0501040_0009441 3300049576 Bacteria 6361
413 Ga0501040_0190712 3300049576 Bacteria 1454
414 Ga0501041_0001494 3300049577 Bacteria 12958
415 Ga0501041_0252075 3300049577 Bacteria 1109
416 Ga0501042_0001293 3300049578 Bacteria 14587
417 Ga0501043_0013889 3300049579 Bacteria 6301
418 Ga0501046_0005727 3300049580 Bacteria 11088
419 Ga0501047_0006762 3300049581 Bacteria 10774
420 Ga0501048_0055615 3300049582 Bacteria 2808
421 Ga0501068_0053576 3300049584 Bacteria 2443
422 Ga0501069_0041718 3300049585 Bacteria 2537
423 Ga0501070_0012341 3300049586 Bacteria 7208
424 Ga0501071_0007128 3300049587 Bacteria 7307
425 Ga0501071_0031340 3300049587 Bacteria 3768
426 Ga0501071_0344349 3300049587 Bacteria 1134
427 Ga0501072_0001780 3300049588 Bacteria 16027
428 Ga0501072_0261055 3300049588 Unclassified 1379
429 Ga0501073_0028416 3300049589 Bacteria 3996
430 Ga0501074_0006854 3300049590 Bacteria 8228
431 Ga0501074_0023638 3300049590 Bacteria 4467
432 Ga0501075_0039172 3300049591 Bacteria 3546
433 Ga0501076_0001146 3300049592 Bacteria 17555
434 Ga0501076_0297000 3300049592 Bacteria 1324
435 Ga0501077_0003582 3300049593 Bacteria 9330
436 Ga0501079_0002542 3300049741 Bacteria 13241
437 Ga0501079_0441980 3300049741 Bacteria 1021
438 Ga0501080_0236289 3300049742 Bacteria 1669
439 Ga0501081_0000579 3300049743 Bacteria 20804
440 Ga0501081_0012163 3300049743 Bacteria 5645
441 Ga0501081_0232471 3300049743 Bacteria 1343
442 Ga0501083_0369263 3300049744 Bacteria 933
443 Ga0501035_0081117 3300049822 Bacteria 2863
444 Ga0501035_0082106 3300049822 Bacteria 2844
445 Ga0501044_0015384 3300049823 Bacteria 8240
446 Ga0501045_0284596 3300049824 Unclassified 1231
447 nmdc:mga0k408_108228_c1 3300050493 Bacteria 1642
448 nmdc:mga05p37_1129375_c1 3300050507 Unclassified 817
449 nmdc:mga05p37_138229_c1 3300050507 Bacteria 2986
450 nmdc:mga05p37_1657_c2 3300050507 Bacteria 25223
451 nmdc:mga05p37_3701_c1 3300050507 Bacteria 17881
452 nmdc:mga05p37_450319_c1 3300050507 Unclassified 1490
453 nmdc:mga05p37_912149_c1 3300050507 Bacteria 946
454 nmdc:mga09592_199016_c1 3300050508 Unclassified 1735
455 nmdc:mga09592_2089_c1 3300050508 Bacteria 16115
456 nmdc:mga0qj67_164083_c1 3300050509 Bacteria 1803
457 nmdc:mga0qj67_51159_c1 3300050509 Bacteria 3266
458 nmdc:mga06r32_254234_c1 3300050510 Unclassified 1745
459 nmdc:mga06r32_27446_c1 3300050510 Bacteria 5318
460 nmdc:mga06r32_840285_c1 3300050510 Bacteria 877
461 nmdc:mga08y16_235687_c1 3300050511 Bacteria 1893
462 nmdc:mga08y16_309225_c1 3300050511 Bacteria 1628
463 nmdc:mga08y16_59357_c1 3300050511 Unclassified 3996
464 nmdc:mga0n895_1877_c1 3300050512 Bacteria 16061
465 nmdc:mga0n895_205287_c1 3300050512 Unclassified 2001
466 nmdc:mga0n895_388879_c1 3300050512 Unclassified 1411
467 nmdc:mga0n895_43173_c2 3300050512 Bacteria 1410
468 nmdc:mga0n895_93081_c1 3300050512 Bacteria 3018
469 nmdc:mga0rr50_231521_c1 3300050513 Bacteria 1529
470 nmdc:mga0rr50_82541_c1 3300050513 Bacteria 2483
471 nmdc:mga08x19_2511_c1 3300050514 Bacteria 11151
472 nmdc:mga08x19_405939_c1 3300050514 Bacteria 956
473 nmdc:mga0a205_239550_c1 3300050515 Unclassified 1695
474 nmdc:mga0a205_24210_c1 3300050515 Bacteria 5768
475 nmdc:mga0a205_29218_c1 3300050515 Bacteria 5276
476 nmdc:mga0a205_413836_c1 3300050515 Bacteria 1211
477 nmdc:mga0a205_760677_c1 3300050515 Bacteria 817
478 nmdc:mga0a205_98374_c1 3300050515 Unclassified 2824
479 Ga0495601_0026105 3300053077 Unclassified 3605
480 Ga0495612_0001450 3300053078 Bacteria 9771
481 Ga0495595_0003038 3300053084 Bacteria 6636
482 Ga0495595_0255860 3300053084 Unclassified 877
483 Ga0495619_0003346 3300053085 Bacteria 10364
484 Ga0500559_0189046 3300053136 Bacteria 971
485 Ga0500552_030087 3300053733 Bacteria 831
486 Ga0501084_0015970 3300054114 Bacteria 6231
487 Ga0501084_0218208 3300054114 Bacteria 1609
488 Ga0590071_000266 3300059421 Bacteria 15231
489 Ga0590074_000639 3300059423 Bacteria 5279
490 Ga0590075_000189 3300059424 Bacteria 17095
491 Ga0590077_000037 3300059426 Bacteria 30721
492 Ga0501082_0018016 3300060353 Bacteria 6082
493 Ga0530510_0016366 3300061734 Bacteria 5248
494 Ga0530510_0106335 3300061734 Bacteria 2054
495 Ga0436364_1089434
496 JGI25156J39149_1001163
497 rootH1_10012424
498 Ga0058863_11092087
499 Ga0065712_10348092
500 Ga0065707_10103056
501 Ga0070658_10094802
502 Ga0070683_100032985
503 Ga0070683_100240705
504 Ga0070690_100000575
505 Ga0070690_100163015
506 Ga0070690_100233176
507 Ga0070670_101054593
508 Ga0068869_100001102
509 Ga0068869_100208441
510 Ga0070666_10198773
511 Ga0070666_10465528
512 Ga0070680_100024246
513 Ga0070680_100492952
514 Ga0070682_100005071
515 Ga0068868_100021926
516 Ga0068868_100531993
517 Ga0068868_100551003
518 Ga0070689_100000814
519 Ga0070689_100779427
520 Ga0070687_100000171
521 Ga0070692_10002591
522 Ga0070692_10138073
523 Ga0070669_100072368
524 Ga0070675_101142694
525 Ga0070671_100431679
526 Ga0070673_100141774
527 Ga0070673_100727504
528 Ga0070688_100666436
529 Ga0070659_100426577
530 Ga0070703_10015642
531 Ga0070703_10020760
532 Ga0070703_10133650
533 Ga0070713_100076875
534 Ga0070713_100532687
535 Ga0070713_101150198
536 Ga0070701_10000376
537 Ga0070701_10455238
538 Ga0070711_100107323
539 Ga0070705_100000270
540 Ga0070700_100002521
541 Ga0070694_100000941
542 Ga0070694_100849625
543 Ga0070708_100204035
544 Ga0070662_100033739
545 Ga0070681_10046516
546 Ga0070681_10049411
547 Ga0070681_10721441
548 Ga0068867_100000947
549 Ga0070707_100039874
550 Ga0070698_100156887
551 Ga0070699_100006690
552 Ga0070699_100192247
553 Ga0070679_100004354
554 Ga0070679_100263424
555 Ga0070684_100267973
556 Ga0070697_100117970
557 Ga0070697_100126144
558 Ga0068853_100081521
559 Ga0068853_101070345
560 Ga0070686_100000516
561 Ga0070686_100136201
562 Ga0070695_100000162
563 Ga0070696_100001207
564 Ga0070696_100001426
565 Ga0070696_100002453
566 Ga0070696_100006184
567 Ga0070696_100155479
568 Ga0070693_100000071
569 Ga0070704_100001539
570 Ga0070704_100210879
571 Ga0068855_100004363
572 Ga0068855_100120314
573 Ga0068855_100260216
574 Ga0068854_100004587
575 Ga0068856_100006005
576 Ga0068856_100231269
577 Ga0070702_100000211
578 Ga0068852_100404194
579 Ga0068852_100636692
580 Ga0068859_100001726
581 Ga0068859_100131079
582 Ga0068859_100955216
583 Ga0068861_100138348
584 Ga0068870_10002272
585 Ga0068863_100268894
586 Ga0068858_100001499
587 Ga0068858_100775325
588 Ga0068860_100001892
589 Ga0068860_100340829
590 Ga0068862_100004151
591 Ga0068862_100620310
592 Ga0070717_10062554
593 Ga0075366_10158785
594 Ga0097621_100001372
595 Ga0068871_100001218
596 Ga0068871_100312456
597 Ga0075428_100002539
598 Ga0075428_100017442
599 Ga0075428_100108989
600 Ga0075430_100036869
601 Ga0075430_100059571
602 Ga0075430_100137138
603 Ga0075430_100150465
604 Ga0075431_100015650
605 Ga0075431_100667690
606 Ga0075433_10009944
607 Ga0075433_10045538
608 Ga0075433_10231962
609 Ga0075433_10280195
610 Ga0075433_10886946
611 Ga0075433_10956674
612 Ga0075434_100001831
613 Ga0075434_100025766
614 Ga0075434_100336546
615 Ga0075434_100495130
616 Ga0075429_100005800
617 Ga0068865_100000407
618 Ga0075436_100009289
619 Ga0075436_100173322
620 Ga0097620_100001726
621 Ga0097620_100131079
622 Ga0097620_100955446
623 Ga0075435_100008379
624 Ga0075435_100153002
625 Ga0105240_10103152
626 Ga0105240_10508208
627 Ga0105240_10537942
628 Ga0105240_10937698
629 Ga0111539_10013487
630 Ga0111539_10034696
631 Ga0111539_10386804
632 Ga0105245_10003506
633 Ga0105245_10010072
634 Ga0105245_10016870
635 Ga0114129_10002308
636 Ga0114129_10006698
637 Ga0114129_10037806
638 Ga0114129_10223362
639 Ga0114129_10530866
640 Ga0114129_11600472
641 Ga0105243_10000583
642 Ga0105241_10059707
643 Ga0105242_10003882
644 Ga0105248_10012840
645 Ga0105248_10041798
646 Ga0105248_10539172
647 Ga0105237_10137006
648 Ga0105249_10195820
649 Ga0105249_10259769
650 Ga0105239_10614660
651 Ga0105239_10769853
652 Ga0105246_10029011
653 Ga0157371_10427135
654 Ga0157370_10086832
655 Ga0157370_10294498
656 Ga0157369_10469733
657 Ga0157374_10235234
658 Ga0157378_10002943
659 Ga0157378_10149320
660 Ga0157378_10167866
661 Ga0157378_10999597
662 Ga0163162_10023911
663 Ga0157375_10075762
664 Ga0163163_10037746
665 Ga0163163_10059219
666 Ga0163163_10134436
667 Ga0157380_10188852
668 Ga0157380_10255045
669 Ga0157379_10059470
670 Ga0157379_10143233
671 Ga0157376_10001972
672 Ga0157376_10413954
673 Ga0163161_10504538
674 Ga0207688_10112226
675 Ga0207643_10007956
676 Ga0207684_10219127
677 Ga0207654_10291887
678 Ga0207707_10094747
679 Ga0207695_10367379
680 Ga0207695_10667298
681 Ga0207693_10483370
682 Ga0207663_10053592
683 Ga0207660_10002021
684 Ga0207660_10123594
685 Ga0207662_10000050
686 Ga0207652_10104896
687 Ga0207652_10249761
688 Ga0207646_10031789
689 Ga0207681_10510662
690 Ga0207687_10002282
691 Ga0207687_10005719
692 Ga0207700_10084709
693 Ga0207664_10450903
694 Ga0207644_10718154
695 Ga0207690_10358947
696 Ga0207706_10039571
697 Ga0207709_10001116
698 Ga0207670_10005774
699 Ga0207704_10000431
700 Ga0207665_10240954
701 Ga0207711_10026049
702 Ga0207711_10238400
703 Ga0207689_10002662
704 Ga0207689_10321695
705 Ga0207661_10400799
706 Ga0207667_10106016
707 Ga0207667_10212501
708 Ga0207667_10672856
709 Ga0207651_10167719
710 Ga0207651_10648493
711 Ga0207712_10002625
712 Ga0207640_10035267
713 Ga0207677_11054670
714 Ga0207703_10600159
715 Ga0207639_10035656
716 Ga0207639_10205227
717 Ga0207708_10000375
718 Ga0207708_10388217
719 Ga0207702_10004664
720 Ga0207702_10357172
721 Ga0207702_10423683
722 Ga0207641_10165657
723 Ga0207641_10746170
724 Ga0207648_10000663
725 Ga0207675_100000454
726 Ga0207675_101150102
727 Ga0207428_10003019
728 Ga0207428_10011324
729 Ga0207428_10120703
730 Ga0207428_10203701
731 Ga0268265_10001189
732 Ga0268264_10002258
733 Ga0265337_1056358
734 Ga0265334_10008611
735 Ga0265334_10040985
736 Ga0265334_10077648
737 Ga0265318_10000007
738 Ga0265323_10014730
739 Ga0265322_10072800
740 Ga0265336_10001353
741 Ga0265336_10018355
742 Ga0265338_10024630
743 Ga0265338_10058799
744 Ga0265338_10078097
745 Ga0265338_10391399
746 Ga0265324_10000006
747 Ga0265324_10001274
748 Ga0265324_10014449
749 Ga0265330_10187845
750 Ga0265328_10005997
751 Ga0265320_10040009
752 Ga0265325_10000767
753 Ga0265340_10122090
754 Ga0265331_10026866
755 Ga0265331_10094943
756 Ga0265316_10054216
757 Ga0307509_10403004
758 Ga0265313_10015730
759 Ga0265314_10000594
760 Ga0265314_10004530
761 Ga0265314_10197385
762 Ga0265314_10264023
763 Ga0265342_10005610
764 Ga0265342_10009909
765 Ga0373930_0001188
766 Ga0373930_0028237
767 Ga0373959_0032979
768 Ga0373938_0003154
769 Ga0373934_0007838
770 Ga0373944_0015791
771 Ga0373932_0026808
772 Ga0373936_0021937
773 Ga0373945_0036345
774 Ga0373954_0003898
775 Ga0373956_0220660
776 Ga0373957_0027242
777 Ga0373960_0032661
778 Ga0373946_0082710
779 Ga0373955_0014946
780 Ga0373955_0175439
781 Ga0373924_0020673
782 Ga0373931_0001986
783 Ga0373931_0004207
784 Ga0373935_0236273
785 Ga0373927_0045469
786 Ga0373927_0163508
787 Ga0373933_0000974
788 Ga0373933_0012850
789 Ga0373933_0052806
790 Ga0373933_0137047
791 Ga0373933_0212153
792 Ga0373947_0015528
793 Ga0373937_0000924
794 Ga0373937_0005804
795 Ga0373937_0021182
796 Ga0373937_0041786
797 Ga0373937_0221736
798 Ga0373937_0558530
799 Ga0373937_0598309
800 Ga0373925_0172213
801 Ga0395900_0560718
802 Ga0436362_0187221
803 Ga0451802_1021577
804 Ga0439462_0021171
805 Ga0451577_0341339
806 Ga0451577_1271237
807 Ga0453683_0012579
808 Ga0453683_0111262
809 Ga0453684_0121878
810 Ga0453684_0579852
811 Ga0451576_0001630
812 Ga0451576_0006369
813 Ga0451576_0116154
814 Ga0451576_0222538
815 Ga0451576_0450212
816 Ga0451576_0932945
817 Ga0451576_1040521
818 Ga0466967_0344392
819 Ga0495592_0039769
820 Ga0495603_0006754
821 Ga0495629_0002047
822 Ga0495629_0129217
823 Ga0495651_0000214
824 Ga0495653_0001647
825 Ga0495580_0005855
826 Ga0495580_0347653
827 Ga0495582_0039527
828 Ga0495662_0038562
829 Ga0495662_0053605
830 Ga0495664_0006909
831 Ga0495664_0011809
832 Ga0495594_0015299
833 Ga0495594_0274144
834 Ga0495594_0376614
835 Ga0495608_0009530
836 Ga0495618_0000537
837 Ga0495618_0001686
838 Ga0495618_0009614
839 Ga0495628_0030182
840 Ga0495630_0063234
841 Ga0495630_0087008
842 Ga0495630_0408732
843 Ga0495630_0475063
844 Ga0495666_0045798
845 Ga0495652_0002479
846 Ga0495665_0181629
847 Ga0495640_0007570
848 Ga0495640_0057472
849 Ga0495640_0169488
850 Ga0495586_0004334
851 Ga0495587_0000715
852 Ga0495645_0008358
853 Ga0495667_0047639
854 Ga0495634_0003492
855 Ga0495634_0029297
856 Ga0495634_0089664
857 Ga0495634_0271576
858 Ga0495635_0000562
859 Ga0495635_0367398
860 Ga0495635_0592665
861 Ga0495588_0070957
862 Ga0495657_0109018
863 Ga0495599_0008513
864 Ga0495623_0001280
865 Ga0495623_0064891
866 Ga0495646_0002811
867 Ga0495647_0005582
868 Ga0495658_0002156
869 Ga0495658_0013385
870 Ga0495658_0016587
871 Ga0495613_0012341
872 Ga0495613_0049700
873 Ga0495624_0210442
874 Ga0495624_0243983
875 Ga0495600_0013786
876 Ga0495600_0383198
877 Ga0495581_0089301
878 Ga0495581_0178096
879 Ga0495604_0000382
880 Ga0495674_0003824
881 Ga0495674_0100098
882 Ga0495680_0001240
883 Ga0495680_0012581
884 Ga0495675_0001812
885 Ga0495684_0294040
886 Ga0495593_0057173
887 Ga0495602_0001751
888 Ga0495602_0321645
889 Ga0496100_0456019
890 Ga0496106_0735135
891 Ga0496107_0288316
892 Ga0496108_0416085
893 Ga0496109_0136610
894 Ga0496109_0877514
895 Ga0496114_0035068
896 Ga0496115_0208839
897 Ga0501033_0005965
898 Ga0501033_0037825
899 Ga0501034_0495994
900 Ga0501036_0002300
901 Ga0501037_0011409
902 Ga0501037_0179566
903 Ga0501038_0016769
904 Ga0501039_0009384
905 Ga0501039_0753363
906 Ga0501040_0009441
907 Ga0501040_0190712
908 Ga0501041_0001494
909 Ga0501041_0252075
910 Ga0501042_0001293
911 Ga0501043_0013889
912 Ga0501046_0005727
913 Ga0501047_0006762
914 Ga0501048_0055615
915 Ga0501068_0053576
916 Ga0501069_0041718
917 Ga0501070_0012341
918 Ga0501071_0007128
919 Ga0501071_0031340
920 Ga0501071_0344349
921 Ga0501072_0001780
922 Ga0501072_0261055
923 Ga0501073_0028416
924 Ga0501074_0006854
925 Ga0501074_0023638
926 Ga0501075_0039172
927 Ga0501076_0001146
928 Ga0501076_0297000
929 Ga0501077_0003582
930 Ga0501079_0002542
931 Ga0501079_0441980
932 Ga0501080_0236289
933 Ga0501081_0000579
934 Ga0501081_0012163
935 Ga0501081_0232471
936 Ga0501083_0369263
937 Ga0501035_0081117
938 Ga0501035_0082106
939 Ga0501044_0015384
940 Ga0501045_0284596
941 nmdc:mga0k408_108228_c1
942 nmdc:mga05p37_1129375_c1
943 nmdc:mga05p37_138229_c1
944 nmdc:mga05p37_1657_c2
945 nmdc:mga05p37_3701_c1
946 nmdc:mga05p37_450319_c1
947 nmdc:mga05p37_912149_c1
948 nmdc:mga09592_199016_c1
949 nmdc:mga09592_2089_c1
950 nmdc:mga0qj67_164083_c1
951 nmdc:mga0qj67_51159_c1
952 nmdc:mga06r32_254234_c1
953 nmdc:mga06r32_27446_c1
954 nmdc:mga06r32_840285_c1
955 nmdc:mga08y16_235687_c1
956 nmdc:mga08y16_309225_c1
957 nmdc:mga08y16_59357_c1
958 nmdc:mga0n895_1877_c1
959 nmdc:mga0n895_205287_c1
960 nmdc:mga0n895_388879_c1
961 nmdc:mga0n895_43173_c2
962 nmdc:mga0n895_93081_c1
963 nmdc:mga0rr50_231521_c1
964 nmdc:mga0rr50_82541_c1
965 nmdc:mga08x19_2511_c1
966 nmdc:mga08x19_405939_c1
967 nmdc:mga0a205_239550_c1
968 nmdc:mga0a205_24210_c1
969 nmdc:mga0a205_29218_c1
970 nmdc:mga0a205_413836_c1
971 nmdc:mga0a205_760677_c1
972 nmdc:mga0a205_98374_c1
973 Ga0495601_0026105
974 Ga0495612_0001450
975 Ga0495595_0003038
976 Ga0495595_0255860
977 Ga0495619_0003346
978 Ga0500559_0189046
979 Ga0500552_030087
980 Ga0501084_0015970
981 Ga0501084_0218208
982 Ga0590071_000266
983 Ga0590074_000639
984 Ga0590075_000189
985 Ga0590077_000037
986 Ga0501082_0018016
987 Ga0530510_0016366
988 Ga0530510_0106335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

18

109

0.96

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

18

113

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9896 2 31
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9855 2 28
4j33-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9852 2 30
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9833 1 31
5x6r-assembly1.cif.gz_A crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9775 2 30
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9855 2 28 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9779 2 30 3.50.50.60
4k7zA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.972 2 32 3.50.50.60
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9695 2 30 3.50.50.60
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.968 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2N1T0K2-F1-model_v4 deleted 0.9914 1 211
AF-A0A1G3IN80-F1-model_v4 DNA-binding protein 0.9898 1 189 GO:0003677
AF-A0A2P1QY54-F1-model_v4 NADP oxidoreductase coenzyme F420-dependent 0.9879 2 211
AF-A0A2N1T0K2-F1-model_v4 deleted 0.9867 1 211
AF-M6X3P1-F1-model_v4 deleted 0.9838 44 211

Map