F454622

General Info

Members Datasets Scaffolds Average Seq Length
494 260 988 194

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0077598|Ga0495650_0077598_222_908
Length 228
Sequence LVSGIKIFDALVHKTIAAVVILDTNYLILKNNNIMYDYISGKLVFKSPSHVVIDAGGIGYHINISLNTYSRLGDVENCKLFIWQYVKEDALTLYGFADDGERRLFLHLVSISGIGPNTGRMMLSSITPAEIQAAIVSGNVALIQRIKGIGPKSAQRIILELQDKLRKEGPDTLTVVPVSKTVKDEALSALVMLGFARNTAEKVLDQELNKNNGELTVEQLIKFALKTL

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
128 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
129 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
149 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
206 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
211 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
214 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
217 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
218 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
219 2738541283 Pedobacter sp. OK701 Isolate Unclassified
220 2738541284 Pedobacter sp. YR016 Isolate Unclassified
221 2738541302 Pedobacter sp. CF074 Isolate Unclassified
222 2738543023 Pedobacter sp. OK628 Isolate Unclassified
223 2739367651 Pedobacter sp. OK291 Isolate Unclassified
224 2739367656 Pedobacter sp. CF523 Isolate Unclassified
225 2739367663 Pedobacter sp. YR510 Isolate Unclassified
226 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
227 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
228 2818991437 Pedobacter terrae 518 Isolate Unclassified
229 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
230 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
231 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
232 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
233 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
234 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
235 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
236 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
237 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
238 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
239 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
240 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
241 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
242 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
243 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
244 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
245 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
246 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
247 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
248 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
249 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
250 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
251 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
252 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
253 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
254 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
255 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
256 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
257 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
258 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
259 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
260 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.69
Metatranscriptomes 0.2
Isolates 9.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.91
Nodule 0
Rhizoplane 0.81
Rhizosphere 79.96
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0077598 3300046471 Unclassified 1288
2 JGI24740J21852_10014328 3300001979 Bacteria 2927
3 JGI24740J21852_10053885 3300001979 Bacteria 1139
4 JGI24739J22299_10002988 3300001989 Bacteria 6469
5 JGI24737J22298_10008155 3300001990 Bacteria 3519
6 JGI24735J21928_10000015 3300002067 Bacteria 167231
7 JGI24735J21928_10016930 3300002067 Bacteria 2256
8 JGI25162J39368_1000016 3300002737 Bacteria 288734
9 JGI25162J39368_1002005 3300002737 Bacteria 9049
10 JGI25164J39214_1001542 3300002772 Bacteria 5076
11 JGI25152J39213_1000203 3300002773 Bacteria 39884
12 JGI25150J39212_1000025 3300002774 Bacteria 123597
13 JGI25151J46595_10000089 3300003187 Bacteria 123597
14 JGI25165J46597_1000941 3300003214 Bacteria 19943
15 JGI25153J46596_10000079 3300003215 Bacteria 113263
16 rootH1_10167736 3300003316 Bacteria 1604
17 rootH2_10016234 3300003320 Bacteria 4905
18 rootH2_10017735 3300003320 Bacteria 23373
19 rootH2_10019314 3300003320 Bacteria 7056
20 rootL2_10172251 3300003322 Bacteria 3053
21 rootL2_10258136 3300003322 Bacteria 2588
22 rootH1_10021718 3300003323 Bacteria 24181
23 rootH1_10032371 3300003323 Bacteria 11159
24 rootH1_10192780 3300003323 Bacteria 2125
25 rootH1_10204200 3300003323 Bacteria 1320
26 Ga0055530_10001794 3300003791 Bacteria 14900
27 Ga0058863_11855493 3300004799 Bacteria 3046
28 Ga0065714_10064503 3300005288 Bacteria 46875
29 Ga0065714_10067627 3300005288 Bacteria 5323
30 Ga0065714_10074116 3300005288 Bacteria 3076
31 Ga0065714_10149977 3300005288 Bacteria 1102
32 Ga0065714_10155198 3300005288 Bacteria 1083
33 Ga0070658_10032262 3300005327 Bacteria 4211
34 Ga0070658_10081448 3300005327 Bacteria 2659
35 Ga0070658_10106860 3300005327 Bacteria 2316
36 Ga0070658_10300906 3300005327 Bacteria 1368
37 Ga0070658_10785102 3300005327 Unclassified 827
38 Ga0070676_10000065 3300005328 Bacteria 35089
39 Ga0070683_100047229 3300005329 Bacteria 3978
40 Ga0070680_100107559 3300005336 Bacteria 2320
41 Ga0068868_100008458 3300005338 Bacteria 7369
42 Ga0070660_100019329 3300005339 Bacteria 4990
43 Ga0070660_100052746 3300005339 Bacteria 3136
44 Ga0070660_100158632 3300005339 Unclassified 1822
45 Ga0070671_100030727 3300005355 Bacteria 4433
46 Ga0070673_100063210 3300005364 Bacteria 2945
47 Ga0070659_100000094 3300005366 Bacteria 66823
48 Ga0070659_100109118 3300005366 Bacteria 2233
49 Ga0070713_100920571 3300005436 Bacteria 841
50 Ga0070710_10761628 3300005437 Bacteria 688
51 Ga0070711_100491873 3300005439 Bacteria 1010
52 Ga0070678_100036874 3300005456 Bacteria 3427
53 Ga0070662_100000472 3300005457 Bacteria 23890
54 Ga0070681_10131957 3300005458 Bacteria 2430
55 Ga0068867_100000211 3300005459 Bacteria 38776
56 Ga0070679_100002914 3300005530 Bacteria 15556
57 Ga0070679_100966545 3300005530 Bacteria 795
58 Ga0070684_100034759 3300005535 Bacteria 4311
59 Ga0070684_100937938 3300005535 Bacteria 811
60 Ga0068853_100061586 3300005539 Bacteria 3246
61 Ga0068853_100072386 3300005539 Bacteria 3003
62 Ga0070672_100399464 3300005543 Bacteria 1178
63 Ga0070665_100000061 3300005548 Bacteria 222138
64 Ga0068855_100000130 3300005563 Bacteria 95659
65 Ga0068855_100000204 3300005563 Bacteria 76041
66 Ga0068855_100011497 3300005563 Bacteria 10696
67 Ga0068855_100165024 3300005563 Bacteria 2511
68 Ga0068855_100326661 3300005563 Bacteria 1694
69 Ga0068855_100543848 3300005563 Bacteria 1258
70 Ga0068855_101119606 3300005563 Bacteria 822
71 Ga0068857_100011365 3300005577 Bacteria 7745
72 Ga0068857_101514627 3300005577 Bacteria 654
73 Ga0068854_100034110 3300005578 Bacteria 3553
74 Ga0068856_100000668 3300005614 Bacteria 37241
75 Ga0068856_100006357 3300005614 Bacteria 11592
76 Ga0068856_100174527 3300005614 Bacteria 2162
77 Ga0068856_100232415 3300005614 Bacteria 1859
78 Ga0068856_100987585 3300005614 Bacteria 860
79 Ga0068852_100013077 3300005616 Bacteria 6338
80 Ga0068852_100078425 3300005616 Bacteria 2922
81 Ga0068852_100126215 3300005616 Bacteria 2350
82 Ga0068852_100418502 3300005616 Bacteria 1321
83 Ga0068866_10104615 3300005718 Bacteria 1568
84 Ga0068851_10116131 3300005834 Bacteria 1434
85 Ga0068858_100232968 3300005842 Bacteria 1746
86 Ga0075366_10001058 3300006195 Bacteria 13506
87 Ga0075366_10004603 3300006195 Bacteria 7411
88 Ga0075366_10064246 3300006195 Bacteria 2183
89 Ga0075366_10178768 3300006195 Bacteria 1289
90 Ga0075366_10255927 3300006195 Bacteria 1068
91 Ga0097621_100000016 3300006237 Bacteria 91785
92 Ga0075370_10229268 3300006353 Bacteria 1099
93 Ga0075370_10428524 3300006353 Bacteria 795
94 Ga0068871_100000494 3300006358 Bacteria 26958
95 Ga0068865_100000063 3300006881 Bacteria 56994
96 Ga0105240_10000082 3300009093 Bacteria 195184
97 Ga0105240_10004807 3300009093 Bacteria 20358
98 Ga0105240_10044548 3300009093 Bacteria 5637
99 Ga0105240_10075639 3300009093 Bacteria 4153
100 Ga0105240_10125665 3300009093 Bacteria 3082
101 Ga0105240_10146613 3300009093 Bacteria 2816
102 Ga0105240_10248648 3300009093 Bacteria 2058
103 Ga0105240_10289317 3300009093 Bacteria 1879
104 Ga0105240_10561591 3300009093 Bacteria 1261
105 Ga0105240_11093512 3300009093 Bacteria 849
106 Ga0105245_10356436 3300009098 Bacteria 1451
107 Ga0105243_10000043 3300009148 Bacteria 158809
108 Ga0105243_10312612 3300009148 Bacteria 1428
109 Ga0105241_10000116 3300009174 Bacteria 57591
110 Ga0105241_10004841 3300009174 Bacteria 9927
111 Ga0105241_10007555 3300009174 Bacteria 7992
112 Ga0105241_10041392 3300009174 Bacteria 3481
113 Ga0105241_10058187 3300009174 Bacteria 2968
114 Ga0105241_10095707 3300009174 Bacteria 2351
115 Ga0105241_11250665 3300009174 Bacteria 705
116 Ga0105242_10026238 3300009176 Bacteria 4617
117 Ga0105237_10001495 3300009545 Bacteria 30789
118 Ga0105237_10002253 3300009545 Bacteria 24013
119 Ga0105237_10002788 3300009545 Bacteria 21223
120 Ga0105237_10004141 3300009545 Bacteria 16895
121 Ga0105237_10200781 3300009545 Bacteria 1994
122 Ga0105237_10201432 3300009545 Bacteria 1991
123 Ga0105237_10386692 3300009545 Bacteria 1404
124 Ga0105238_10007909 3300009551 Bacteria 10640
125 Ga0105238_10055866 3300009551 Bacteria 3962
126 Ga0105239_10000017 3300010375 Bacteria 290760
127 Ga0105239_10000049 3300010375 Bacteria 177578
128 Ga0105239_10000740 3300010375 Bacteria 46443
129 Ga0105239_10005220 3300010375 Bacteria 15288
130 Ga0105239_10007904 3300010375 Bacteria 12159
131 Ga0105239_10041419 3300010375 Bacteria 5048
132 Ga0105239_10120931 3300010375 Bacteria 2908
133 Ga0105239_10156072 3300010375 Bacteria 2549
134 Ga0105246_10403629 3300011119 Bacteria 1136
135 Ga0157373_10000268 3300013100 Bacteria 41923
136 Ga0157373_10066488 3300013100 Bacteria 2550
137 Ga0157371_10000496 3300013102 Bacteria 47702
138 Ga0157371_10000511 3300013102 Bacteria 46681
139 Ga0157371_10014790 3300013102 Bacteria 5875
140 Ga0157371_10021294 3300013102 Bacteria 4761
141 Ga0157371_10079220 3300013102 Unclassified 2327
142 Ga0157370_10015806 3300013104 Bacteria 7659
143 Ga0157370_10020351 3300013104 Bacteria 6628
144 Ga0157370_10029716 3300013104 Bacteria 5360
145 Ga0157370_10045351 3300013104 Bacteria 4218
146 Ga0157370_10075426 3300013104 Bacteria 3179
147 Ga0157370_10121422 3300013104 Bacteria 2439
148 Ga0157370_10214222 3300013104 Bacteria 1785
149 Ga0157370_10678987 3300013104 Bacteria 941
150 Ga0157370_11059408 3300013104 Bacteria 733
151 Ga0157370_11090515 3300013104 Bacteria 722
152 Ga0157369_10000414 3300013105 Bacteria 56570
153 Ga0157369_10002910 3300013105 Bacteria 20469
154 Ga0157369_10047404 3300013105 Bacteria 4666
155 Ga0157369_10245042 3300013105 Unclassified 1871
156 Ga0157369_10941768 3300013105 Bacteria 885
157 Ga0157374_10000427 3300013296 Bacteria 38121
158 Ga0157374_10009450 3300013296 Bacteria 8370
159 Ga0157374_10029615 3300013296 Bacteria 4960
160 Ga0157374_10485813 3300013296 Bacteria 1238
161 Ga0157378_10031661 3300013297 Bacteria 4672
162 Ga0157378_10195784 3300013297 Bacteria 1909
163 Ga0157378_11612480 3300013297 Bacteria 695
164 Ga0163162_10000012 3300013306 Bacteria 292674
165 Ga0163162_10000343 3300013306 Bacteria 42312
166 Ga0163162_10008406 3300013306 Bacteria 10067
167 Ga0163162_10009090 3300013306 Bacteria 9659
168 Ga0163162_10163458 3300013306 Bacteria 2349
169 Ga0163162_10401948 3300013306 Bacteria 1502
170 Ga0163162_10580112 3300013306 Bacteria 1248
171 Ga0163162_11118618 3300013306 Bacteria 893
172 Ga0157372_10000039 3300013307 Bacteria 165839
173 Ga0157372_10000241 3300013307 Bacteria 60488
174 Ga0157372_10004067 3300013307 Bacteria 15680
175 Ga0157372_10007166 3300013307 Bacteria 11867
176 Ga0157372_10052944 3300013307 Bacteria 4522
177 Ga0157372_10142337 3300013307 Unclassified 2764
178 Ga0157372_10281243 3300013307 Bacteria 1934
179 Ga0157372_10416604 3300013307 Bacteria 1565
180 Ga0157372_11302242 3300013307 Bacteria 838
181 Ga0157375_10002335 3300013308 Bacteria 16398
182 Ga0157375_10170180 3300013308 Bacteria 2325
183 Ga0157375_10771493 3300013308 Bacteria 1112
184 Ga0157375_10776589 3300013308 Bacteria 1108
185 Ga0157380_10053197 3300014326 Bacteria 3209
186 Ga0182008_10000312 3300014497 Bacteria 38208
187 Ga0182008_10099571 3300014497 Bacteria 1436
188 Ga0182006_1000253 3300015261 Bacteria 49431
189 Ga0182007_10000009 3300015262 Bacteria 316298
190 Ga0182007_10027347 3300015262 Bacteria 1967
191 Ga0183373_1013 3300015682 Bacteria 112340
192 Ga0163161_10000475 3300017792 Bacteria 33301
193 Ga0163161_10000526 3300017792 Bacteria 31270
194 Ga0163161_10030359 3300017792 Bacteria 3846
195 Ga0163161_10600526 3300017792 Bacteria 907
196 Ga0163161_10708100 3300017792 Unclassified 839
197 Ga0213872_10014779 3300021361 Bacteria 3637
198 Ga0207427_100309 3300025231 Bacteria 33924
199 Ga0209437_100048 3300025233 Bacteria 405107
200 Ga0209437_100119 3300025233 Bacteria 206549
201 Ga0207425_1000008 3300025245 Bacteria 618024
202 Ga0209026_1000419 3300025250 Bacteria 36170
203 Ga0209026_1009807 3300025250 Bacteria 1844
204 Ga0209129_1000042 3300025258 Bacteria 305537
205 Ga0209233_1000029 3300025261 Bacteria 641642
206 Ga0209233_1002383 3300025261 Bacteria 6958
207 Ga0209233_1011559 3300025261 Bacteria 2597
208 Ga0209455_1001896 3300025272 Bacteria 8690
209 Ga0209455_1012553 3300025272 Bacteria 2020
210 Ga0209676_1000009 3300025292 Bacteria 981719
211 Ga0209025_1000020 3300025294 Bacteria 618024
212 Ga0209758_1000022 3300025297 Bacteria 618024
213 Ga0209050_1000103 3300025298 Bacteria 229225
214 Ga0207692_10636054 3300025898 Bacteria 688
215 Ga0207642_10046655 3300025899 Bacteria 1932
216 Ga0207647_10000018 3300025904 Bacteria 124816
217 Ga0207647_10002325 3300025904 Bacteria 14431
218 Ga0207647_10016353 3300025904 Bacteria 5065
219 Ga0207647_10325818 3300025904 Bacteria 872
220 Ga0207645_10000289 3300025907 Bacteria 42106
221 Ga0207705_10000035 3300025909 Bacteria 201649
222 Ga0207705_10082327 3300025909 Bacteria 2347
223 Ga0207705_10189175 3300025909 Bacteria 1556
224 Ga0207705_10454934 3300025909 Bacteria 993
225 Ga0207654_10001643 3300025911 Bacteria 11685
226 Ga0207654_10005186 3300025911 Bacteria 6574
227 Ga0207654_10038024 3300025911 Bacteria 2697
228 Ga0207654_10066913 3300025911 Bacteria 2121
229 Ga0207654_10072210 3300025911 Bacteria 2054
230 Ga0207654_10093142 3300025911 Bacteria 1841
231 Ga0207707_10022118 3300025912 Bacteria 5558
232 Ga0207695_10000053 3300025913 Bacteria 396740
233 Ga0207695_10013892 3300025913 Bacteria 9573
234 Ga0207695_10020284 3300025913 Bacteria 7617
235 Ga0207695_10030492 3300025913 Bacteria 5935
236 Ga0207695_10147686 3300025913 Bacteria 2293
237 Ga0207695_10301185 3300025913 Bacteria 1494
238 Ga0207695_10352725 3300025913 Bacteria 1358
239 Ga0207695_10444700 3300025913 Bacteria 1179
240 Ga0207695_10742823 3300025913 Bacteria 862
241 Ga0207671_10001719 3300025914 Bacteria 24707
242 Ga0207671_10002791 3300025914 Bacteria 18216
243 Ga0207671_10003533 3300025914 Bacteria 15500
244 Ga0207671_10006920 3300025914 Bacteria 9994
245 Ga0207671_10063836 3300025914 Bacteria 2737
246 Ga0207671_10114809 3300025914 Bacteria 2053
247 Ga0207671_10207587 3300025914 Bacteria 1531
248 Ga0207660_10088309 3300025917 Bacteria 2292
249 Ga0207657_10029279 3300025919 Bacteria 5015
250 Ga0207652_10002435 3300025921 Bacteria 15712
251 Ga0207694_10018416 3300025924 Bacteria 5278
252 Ga0207644_10020780 3300025931 Bacteria 4465
253 Ga0207690_10000280 3300025932 Bacteria 36230
254 Ga0207690_10062966 3300025932 Bacteria 2528
255 Ga0207706_10000013 3300025933 Bacteria 188236
256 Ga0207709_10000021 3300025935 Bacteria 386722
257 Ga0207709_10239452 3300025935 Bacteria 1319
258 Ga0207669_10507615 3300025937 Bacteria 966
259 Ga0207704_10000344 3300025938 Bacteria 21602
260 Ga0207691_10430765 3300025940 Bacteria 1123
261 Ga0207661_10034561 3300025944 Bacteria 3933
262 Ga0207667_10000095 3300025949 Bacteria 143866
263 Ga0207667_10002675 3300025949 Bacteria 22033
264 Ga0207667_10043061 3300025949 Bacteria 4793
265 Ga0207667_10056304 3300025949 Bacteria 4131
266 Ga0207667_10105242 3300025949 Bacteria 2911
267 Ga0207667_10166587 3300025949 Bacteria 2265
268 Ga0207667_10281642 3300025949 Bacteria 1699
269 Ga0207651_10041958 3300025960 Bacteria 3041
270 Ga0207640_10033688 3300025981 Bacteria 3190
271 Ga0207658_10253599 3300025986 Bacteria 1496
272 Ga0207703_10167504 3300026035 Bacteria 1930
273 Ga0207703_10783497 3300026035 Bacteria 910
274 Ga0207639_10044277 3300026041 Bacteria 3347
275 Ga0207639_10418376 3300026041 Bacteria 1211
276 Ga0207702_10001661 3300026078 Bacteria 21973
277 Ga0207702_10017303 3300026078 Bacteria 5964
278 Ga0207702_10032012 3300026078 Bacteria 4386
279 Ga0207702_10168982 3300026078 Bacteria 2003
280 Ga0207648_10000081 3300026089 Bacteria 90676
281 Ga0207674_10104661 3300026116 Bacteria 2808
282 Ga0207674_10491384 3300026116 Bacteria 1186
283 Ga0207683_10013229 3300026121 Bacteria 7036
284 Ga0207698_10413124 3300026142 Bacteria 1293
285 Ga0268266_10000053 3300028379 Bacteria 295181
286 Ga0268264_10914996 3300028381 Bacteria 881
287 Ga0307517_10000447 3300028786 Bacteria 70799
288 Ga0307515_10000747 3300028794 Bacteria 75231
289 Ga0307515_10003911 3300028794 Bacteria 31075
290 Ga0307515_10020305 3300028794 Bacteria 11862
291 Ga0307515_10110788 3300028794 Bacteria 3208
292 Ga0307515_10281168 3300028794 Bacteria 1371
293 Ga0265338_10037933 3300028800 Bacteria 4575
294 Ga0265338_10411679 3300028800 Unclassified 962
295 Ga0316177_1048524 3300030731 Bacteria 9246
296 Ga0316176_1054302 3300030732 Bacteria 15983
297 Ga0316183_1057910 3300030742 Bacteria 15368
298 Ga0316181_1033982 3300030744 Bacteria 1548
299 Ga0316181_1167473 3300030744 Bacteria 10307
300 Ga0307509_10121170 3300031507 Bacteria 2593
301 Ga0307408_100001273 3300031548 Bacteria 18920
302 Ga0307408_100005345 3300031548 Bacteria 8604
303 Ga0307516_10599202 3300031730 Bacteria 756
304 Ga0307405_10000036 3300031731 Bacteria 91687
305 Ga0307407_10000006 3300031903 Bacteria 218714
306 Ga0307412_10004728 3300031911 Bacteria 7599
307 Ga0307412_10127168 3300031911 Bacteria 1845
308 Ga0307412_10152620 3300031911 Bacteria 1706
309 Ga0307409_101235591 3300031995 Bacteria 771
310 Ga0307416_100000058 3300032002 Bacteria 103674
311 Ga0307416_100443076 3300032002 Bacteria 1349
312 Ga0307414_10000116 3300032004 Bacteria 56780
313 Ga0307414_10001214 3300032004 Bacteria 13284
314 Ga0307414_10011868 3300032004 Bacteria 5131
315 Ga0307414_10042999 3300032004 Bacteria 3074
316 Ga0307414_10077029 3300032004 Bacteria 2425
317 Ga0307414_10113175 3300032004 Bacteria 2071
318 Ga0307414_10166635 3300032004 Bacteria 1756
319 Ga0307414_10201319 3300032004 Bacteria 1620
320 Ga0307414_10281122 3300032004 Unclassified 1398
321 Ga0307414_10573214 3300032004 Bacteria 1009
322 Ga0307414_10664267 3300032004 Bacteria 941
323 Ga0307414_10967802 3300032004 Bacteria 782
324 Ga0307414_11301013 3300032004 Bacteria 674
325 Ga0307411_10288063 3300032005 Bacteria 1311
326 Ga0307507_10002469 3300033179 Bacteria 38697
327 Ga0307510_10019236 3300033180 Bacteria 8013
328 Ga0395899_0000027 3300037312 Bacteria 337387
329 Ga0395899_0000282 3300037312 Bacteria 66053
330 Ga0395899_0002197 3300037312 Bacteria 15994
331 Ga0395899_0016492 3300037312 Bacteria 5634
332 Ga0395900_0000195 3300037418 Bacteria 97204
333 Ga0395900_0002539 3300037418 Bacteria 19977
334 Ga0395900_0048711 3300037418 Bacteria 4365
335 Ga0395898_0045320 3300037466 Bacteria 4323
336 Ga0395898_0134115 3300037466 Bacteria 2371
337 Ga0395905_0010085 3300037471 Bacteria 9208
338 Ga0395905_0049446 3300037471 Bacteria 3940
339 Ga0395901_0000565 3300038443 Bacteria 42982
340 Ga0395901_0002787 3300038443 Bacteria 17632
341 Ga0395901_0071171 3300038443 Bacteria 3624
342 Ga0400488_27043 3300038741 Bacteria 1999
343 Ga0400483_040298 3300039062 Bacteria 25488
344 Ga0400483_235084 3300039062 Bacteria 30922
345 Ga0436361_0055297 3300039447 Bacteria 3792
346 Ga0451793_0680901 3300041452 Bacteria 777
347 Ga0451795_1478778 3300041456 Bacteria 2282
348 Ga0451802_2167694 3300041460 Bacteria 1108
349 Ga0439448_0024151 3300042005 Bacteria 1900
350 Ga0439457_009000 3300042014 Bacteria 2336
351 Ga0451577_0036919 3300042876 Bacteria 4399
352 Ga0453683_0229945 3300044673 Bacteria 1180
353 Ga0466966_0007819 3300044684 Bacteria 7079
354 Ga0466966_0549781 3300044684 Bacteria 695
355 Ga0466961_0081486 3300044693 Bacteria 2047
356 Ga0453684_0030253 3300044712 Bacteria 7656
357 Ga0453684_0090929 3300044712 Bacteria 3770
358 Ga0453684_0316695 3300044712 Bacteria 1768
359 Ga0466968_0244809 3300044735 Bacteria 850
360 Ga0466959_0110101 3300045049 Bacteria 1966
361 Ga0451576_0000529 3300045051 Bacteria 82682
362 Ga0466958_0070829 3300045836 Bacteria 2134
363 Ga0495627_014728 3300046453 Bacteria 2721
364 Ga0495629_0211578 3300046459 Bacteria 1339
365 Ga0495638_0116572 3300046460 Bacteria 1582
366 Ga0495638_0382351 3300046460 Bacteria 735
367 Ga0495651_0125254 3300046462 Bacteria 1882
368 Ga0495651_0253073 3300046462 Bacteria 1202
369 Ga0495653_0347886 3300046463 Bacteria 954
370 Ga0495650_0000144 3300046471 Bacteria 165957
371 Ga0495585_0000091 3300046492 Bacteria 95620
372 Ga0495585_0001011 3300046492 Bacteria 23448
373 Ga0495596_0006000 3300046500 Bacteria 5668
374 Ga0495596_0272660 3300046500 Bacteria 657
375 Ga0495583_0086133 3300046506 Bacteria 1359
376 Ga0495606_0000430 3300046507 Bacteria 69872
377 Ga0495606_0005234 3300046507 Bacteria 12524
378 Ga0495606_0056926 3300046507 Bacteria 2520
379 Ga0495606_0117870 3300046507 Bacteria 1593
380 Ga0495606_0319318 3300046507 Unclassified 835
381 Ga0495610_0001278 3300046512 Bacteria 22504
382 Ga0495610_0001431 3300046512 Bacteria 21101
383 Ga0495616_0037851 3300046513 Bacteria 2479
384 Ga0495631_0002175 3300046518 Bacteria 11315
385 Ga0495631_0044093 3300046518 Unclassified 1967
386 Ga0495631_0059950 3300046518 Bacteria 1652
387 Ga0495637_0025261 3300046520 Bacteria 2678
388 Ga0495637_0036175 3300046520 Bacteria 2152
389 Ga0495648_0014170 3300046524 Bacteria 5849
390 Ga0495648_0038704 3300046524 Bacteria 3045
391 Ga0495663_0232284 3300046525 Bacteria 651
392 Ga0495642_0157733 3300046528 Bacteria 983
393 Ga0495642_0232518 3300046528 Bacteria 805
394 Ga0495652_0048603 3300046529 Bacteria 3634
395 Ga0495652_0300169 3300046529 Bacteria 1168
396 Ga0495654_0014970 3300046530 Bacteria 4122
397 Ga0495609_0005752 3300046538 Bacteria 6443
398 Ga0495622_0143894 3300046557 Bacteria 1081
399 Ga0495633_0000157 3300046558 Bacteria 89236
400 Ga0495633_0005191 3300046558 Bacteria 8046
401 Ga0495633_0029364 3300046558 Bacteria 2676
402 Ga0495668_0000086 3300046616 Bacteria 151960
403 Ga0495625_0002989 3300046660 Bacteria 17514
404 Ga0495625_0071584 3300046660 Bacteria 2433
405 Ga0495625_0139092 3300046660 Bacteria 1639
406 Ga0495625_0398389 3300046660 Unclassified 860
407 Ga0495625_0624116 3300046660 Bacteria 644
408 Ga0495661_0001791 3300046665 Bacteria 17283
409 Ga0495661_0003188 3300046665 Bacteria 12264
410 Ga0495661_0090222 3300046665 Bacteria 1745
411 Ga0495661_0254821 3300046665 Bacteria 894
412 Ga0495658_0047514 3300046683 Bacteria 2417
413 Ga0495660_0008203 3300046810 Bacteria 6123
414 Ga0495660_0012038 3300046810 Bacteria 5018
415 Ga0495683_0247489 3300047323 Bacteria 784
416 Ga0495687_000220 3300047443 Bacteria 80993
417 Ga0495687_001613 3300047443 Bacteria 20326
418 Ga0495687_106133 3300047443 Bacteria 1043
419 Ga0495685_019128 3300047447 Bacteria 2352
420 Ga0495673_0077675 3300047469 Bacteria 1382
421 Ga0495686_0000585 3300047472 Bacteria 51508
422 Ga0495686_0000621 3300047472 Bacteria 48956
423 Ga0495686_0051582 3300047472 Bacteria 2581
424 Ga0495614_0016669 3300048089 Bacteria 3196
425 Ga0496116_0001728 3300048919 Bacteria 23852
426 Ga0496117_0001632 3300048920 Bacteria 31619
427 Ga0496118_0101906 3300048921 Bacteria 1937
428 Ga0496122_0009922 3300048925 Bacteria 9921
429 Ga0496123_0003787 3300048926 Bacteria 16562
430 Ga0496126_0285536 3300048929 Bacteria 1366
431 Ga0501198_027507 3300049649 Unclassified 934
432 Ga0501223_000201 3300049663 Bacteria 15501
433 Ga0501238_016185 3300049671 Bacteria 1032
434 Ga0501240_001980 3300049673 Bacteria 2097
435 nmdc:mga0k408_108872_c1 3300050493 Bacteria 919
436 nmdc:mga0k408_12828_c1 3300050493 Bacteria 4587
437 nmdc:mga0k408_156411_c1 3300050493 Bacteria 1358
438 nmdc:mga0k408_172285_c1 3300050493 Bacteria 1290
439 nmdc:mga0k408_384_c1 3300050493 Bacteria 24251
440 nmdc:mga07m45_222531_c1 3300050496 Bacteria 1098
441 Ga0500608_001571 3300053122 Bacteria 8196
442 Ga0500608_011768 3300053122 Bacteria 3812
443 Ga0500618_000018 3300053125 Bacteria 163272
444 Ga0500618_007457 3300053125 Bacteria 3121
445 Ga0500564_110610 3300053138 Bacteria 1206
446 Ga0500616_0033826 3300053153 Bacteria 2788
447 Ga0500624_000172 3300053157 Bacteria 25880
448 Ga0500552_015966 3300053733 Bacteria 1010
449 Ga0466962_0107269 3300061719 Bacteria 1343
450 2586209249 2585427687 Bacteria 5544917
451 2599481655 2599185184 Bacteria 6430550
452 2722726350 2721755487 Bacteria 6357185
453 2738758290 2738541283 Bacteria 7222293
454 2738763169 2738541284 Bacteria 5199923
455 2738854052 2738541302 Bacteria 5944758
456 2739302062 2738543023 Bacteria 6767879
457 2739587527 2739367651 Bacteria 6359826
458 2739618128 2739367656 Bacteria 5152243
459 2739646218 2739367663 Bacteria 5040914
460 2740031628 2739367866 Bacteria 4215900
461 2776616288 2775506987 Bacteria 5373360
462 2819545439 2818991437 Bacteria 5805520
463 2839991686 2839989709 Bacteria 3773432
464 2842724684 2842722452 Bacteria 6263924
465 2842909613 2842903701 Bacteria 6986368
466 2842911820 2842909656 Bacteria 6185908
467 2849285696 2849281842 Bacteria 6065644
468 2852625609 2852623160 Bacteria 4376875
469 2852629679 2852627209 Bacteria 5896285
470 2857631563 2857627736 Bacteria 5625397
471 2884636564 2884634485 Bacteria 3928637
472 2884934607 2884933994 Bacteria 4535041
473 2890740705 2890737413 Bacteria 4269751
474 2895500956 2895498888 Bacteria 5283788
475 2896319317 2896317667 Bacteria 4606601
476 2896346144 2896344016 Bacteria 3811746
477 2898716266 2898713307 Bacteria 4110805
478 2902052977 2902048731 Bacteria 4976191
479 2904447924 2904445276 Bacteria 5310396
480 2904783765 2904780799 Bacteria 5840761
481 2910249657 2910245624 Bacteria 6935613
482 2919181985 2919177583 Bacteria 5641607
483 2919191047 2919186247 Bacteria 6244071
484 2919440567 2919437846 Bacteria 6199444
485 2919697147 2919692658 Bacteria 5943958
486 2928082138 2928078545 Bacteria 6534839
487 2928149285 2928147474 Bacteria 6512076
488 2932087980 2932082852 Bacteria 6563563
489 2939669327 2939664404 Bacteria 6364494
490 2945998450 2945997725 Bacteria 6404843
491 2954020925 2954016120 Bacteria 6446024
492 2977234228 2977232053 Bacteria 5485925
493 3003237231 3003233435 Bacteria 4458031
494 8055590146 8055588893 Bacteria 3619545
495 Ga0495650_0077598
496 JGI24740J21852_10014328
497 JGI24740J21852_10053885
498 JGI24739J22299_10002988
499 JGI24737J22298_10008155
500 JGI24735J21928_10000015
501 JGI24735J21928_10016930
502 JGI25162J39368_1000016
503 JGI25162J39368_1002005
504 JGI25164J39214_1001542
505 JGI25152J39213_1000203
506 JGI25150J39212_1000025
507 JGI25151J46595_10000089
508 JGI25165J46597_1000941
509 JGI25153J46596_10000079
510 rootH1_10167736
511 rootH2_10016234
512 rootH2_10017735
513 rootH2_10019314
514 rootL2_10172251
515 rootL2_10258136
516 rootH1_10021718
517 rootH1_10032371
518 rootH1_10192780
519 rootH1_10204200
520 Ga0055530_10001794
521 Ga0058863_11855493
522 Ga0065714_10064503
523 Ga0065714_10067627
524 Ga0065714_10074116
525 Ga0065714_10149977
526 Ga0065714_10155198
527 Ga0070658_10032262
528 Ga0070658_10081448
529 Ga0070658_10106860
530 Ga0070658_10300906
531 Ga0070658_10785102
532 Ga0070676_10000065
533 Ga0070683_100047229
534 Ga0070680_100107559
535 Ga0068868_100008458
536 Ga0070660_100019329
537 Ga0070660_100052746
538 Ga0070660_100158632
539 Ga0070671_100030727
540 Ga0070673_100063210
541 Ga0070659_100000094
542 Ga0070659_100109118
543 Ga0070713_100920571
544 Ga0070710_10761628
545 Ga0070711_100491873
546 Ga0070678_100036874
547 Ga0070662_100000472
548 Ga0070681_10131957
549 Ga0068867_100000211
550 Ga0070679_100002914
551 Ga0070679_100966545
552 Ga0070684_100034759
553 Ga0070684_100937938
554 Ga0068853_100061586
555 Ga0068853_100072386
556 Ga0070672_100399464
557 Ga0070665_100000061
558 Ga0068855_100000130
559 Ga0068855_100000204
560 Ga0068855_100011497
561 Ga0068855_100165024
562 Ga0068855_100326661
563 Ga0068855_100543848
564 Ga0068855_101119606
565 Ga0068857_100011365
566 Ga0068857_101514627
567 Ga0068854_100034110
568 Ga0068856_100000668
569 Ga0068856_100006357
570 Ga0068856_100174527
571 Ga0068856_100232415
572 Ga0068856_100987585
573 Ga0068852_100013077
574 Ga0068852_100078425
575 Ga0068852_100126215
576 Ga0068852_100418502
577 Ga0068866_10104615
578 Ga0068851_10116131
579 Ga0068858_100232968
580 Ga0075366_10001058
581 Ga0075366_10004603
582 Ga0075366_10064246
583 Ga0075366_10178768
584 Ga0075366_10255927
585 Ga0097621_100000016
586 Ga0075370_10229268
587 Ga0075370_10428524
588 Ga0068871_100000494
589 Ga0068865_100000063
590 Ga0105240_10000082
591 Ga0105240_10004807
592 Ga0105240_10044548
593 Ga0105240_10075639
594 Ga0105240_10125665
595 Ga0105240_10146613
596 Ga0105240_10248648
597 Ga0105240_10289317
598 Ga0105240_10561591
599 Ga0105240_11093512
600 Ga0105245_10356436
601 Ga0105243_10000043
602 Ga0105243_10312612
603 Ga0105241_10000116
604 Ga0105241_10004841
605 Ga0105241_10007555
606 Ga0105241_10041392
607 Ga0105241_10058187
608 Ga0105241_10095707
609 Ga0105241_11250665
610 Ga0105242_10026238
611 Ga0105237_10001495
612 Ga0105237_10002253
613 Ga0105237_10002788
614 Ga0105237_10004141
615 Ga0105237_10200781
616 Ga0105237_10201432
617 Ga0105237_10386692
618 Ga0105238_10007909
619 Ga0105238_10055866
620 Ga0105239_10000017
621 Ga0105239_10000049
622 Ga0105239_10000740
623 Ga0105239_10005220
624 Ga0105239_10007904
625 Ga0105239_10041419
626 Ga0105239_10120931
627 Ga0105239_10156072
628 Ga0105246_10403629
629 Ga0157373_10000268
630 Ga0157373_10066488
631 Ga0157371_10000496
632 Ga0157371_10000511
633 Ga0157371_10014790
634 Ga0157371_10021294
635 Ga0157371_10079220
636 Ga0157370_10015806
637 Ga0157370_10020351
638 Ga0157370_10029716
639 Ga0157370_10045351
640 Ga0157370_10075426
641 Ga0157370_10121422
642 Ga0157370_10214222
643 Ga0157370_10678987
644 Ga0157370_11059408
645 Ga0157370_11090515
646 Ga0157369_10000414
647 Ga0157369_10002910
648 Ga0157369_10047404
649 Ga0157369_10245042
650 Ga0157369_10941768
651 Ga0157374_10000427
652 Ga0157374_10009450
653 Ga0157374_10029615
654 Ga0157374_10485813
655 Ga0157378_10031661
656 Ga0157378_10195784
657 Ga0157378_11612480
658 Ga0163162_10000012
659 Ga0163162_10000343
660 Ga0163162_10008406
661 Ga0163162_10009090
662 Ga0163162_10163458
663 Ga0163162_10401948
664 Ga0163162_10580112
665 Ga0163162_11118618
666 Ga0157372_10000039
667 Ga0157372_10000241
668 Ga0157372_10004067
669 Ga0157372_10007166
670 Ga0157372_10052944
671 Ga0157372_10142337
672 Ga0157372_10281243
673 Ga0157372_10416604
674 Ga0157372_11302242
675 Ga0157375_10002335
676 Ga0157375_10170180
677 Ga0157375_10771493
678 Ga0157375_10776589
679 Ga0157380_10053197
680 Ga0182008_10000312
681 Ga0182008_10099571
682 Ga0182006_1000253
683 Ga0182007_10000009
684 Ga0182007_10027347
685 Ga0183373_1013
686 Ga0163161_10000475
687 Ga0163161_10000526
688 Ga0163161_10030359
689 Ga0163161_10600526
690 Ga0163161_10708100
691 Ga0213872_10014779
692 Ga0207427_100309
693 Ga0209437_100048
694 Ga0209437_100119
695 Ga0207425_1000008
696 Ga0209026_1000419
697 Ga0209026_1009807
698 Ga0209129_1000042
699 Ga0209233_1000029
700 Ga0209233_1002383
701 Ga0209233_1011559
702 Ga0209455_1001896
703 Ga0209455_1012553
704 Ga0209676_1000009
705 Ga0209025_1000020
706 Ga0209758_1000022
707 Ga0209050_1000103
708 Ga0207692_10636054
709 Ga0207642_10046655
710 Ga0207647_10000018
711 Ga0207647_10002325
712 Ga0207647_10016353
713 Ga0207647_10325818
714 Ga0207645_10000289
715 Ga0207705_10000035
716 Ga0207705_10082327
717 Ga0207705_10189175
718 Ga0207705_10454934
719 Ga0207654_10001643
720 Ga0207654_10005186
721 Ga0207654_10038024
722 Ga0207654_10066913
723 Ga0207654_10072210
724 Ga0207654_10093142
725 Ga0207707_10022118
726 Ga0207695_10000053
727 Ga0207695_10013892
728 Ga0207695_10020284
729 Ga0207695_10030492
730 Ga0207695_10147686
731 Ga0207695_10301185
732 Ga0207695_10352725
733 Ga0207695_10444700
734 Ga0207695_10742823
735 Ga0207671_10001719
736 Ga0207671_10002791
737 Ga0207671_10003533
738 Ga0207671_10006920
739 Ga0207671_10063836
740 Ga0207671_10114809
741 Ga0207671_10207587
742 Ga0207660_10088309
743 Ga0207657_10029279
744 Ga0207652_10002435
745 Ga0207694_10018416
746 Ga0207644_10020780
747 Ga0207690_10000280
748 Ga0207690_10062966
749 Ga0207706_10000013
750 Ga0207709_10000021
751 Ga0207709_10239452
752 Ga0207669_10507615
753 Ga0207704_10000344
754 Ga0207691_10430765
755 Ga0207661_10034561
756 Ga0207667_10000095
757 Ga0207667_10002675
758 Ga0207667_10043061
759 Ga0207667_10056304
760 Ga0207667_10105242
761 Ga0207667_10166587
762 Ga0207667_10281642
763 Ga0207651_10041958
764 Ga0207640_10033688
765 Ga0207658_10253599
766 Ga0207703_10167504
767 Ga0207703_10783497
768 Ga0207639_10044277
769 Ga0207639_10418376
770 Ga0207702_10001661
771 Ga0207702_10017303
772 Ga0207702_10032012
773 Ga0207702_10168982
774 Ga0207648_10000081
775 Ga0207674_10104661
776 Ga0207674_10491384
777 Ga0207683_10013229
778 Ga0207698_10413124
779 Ga0268266_10000053
780 Ga0268264_10914996
781 Ga0307517_10000447
782 Ga0307515_10000747
783 Ga0307515_10003911
784 Ga0307515_10020305
785 Ga0307515_10110788
786 Ga0307515_10281168
787 Ga0265338_10037933
788 Ga0265338_10411679
789 Ga0316177_1048524
790 Ga0316176_1054302
791 Ga0316183_1057910
792 Ga0316181_1033982
793 Ga0316181_1167473
794 Ga0307509_10121170
795 Ga0307408_100001273
796 Ga0307408_100005345
797 Ga0307516_10599202
798 Ga0307405_10000036
799 Ga0307407_10000006
800 Ga0307412_10004728
801 Ga0307412_10127168
802 Ga0307412_10152620
803 Ga0307409_101235591
804 Ga0307416_100000058
805 Ga0307416_100443076
806 Ga0307414_10000116
807 Ga0307414_10001214
808 Ga0307414_10011868
809 Ga0307414_10042999
810 Ga0307414_10077029
811 Ga0307414_10113175
812 Ga0307414_10166635
813 Ga0307414_10201319
814 Ga0307414_10281122
815 Ga0307414_10573214
816 Ga0307414_10664267
817 Ga0307414_10967802
818 Ga0307414_11301013
819 Ga0307411_10288063
820 Ga0307507_10002469
821 Ga0307510_10019236
822 Ga0395899_0000027
823 Ga0395899_0000282
824 Ga0395899_0002197
825 Ga0395899_0016492
826 Ga0395900_0000195
827 Ga0395900_0002539
828 Ga0395900_0048711
829 Ga0395898_0045320
830 Ga0395898_0134115
831 Ga0395905_0010085
832 Ga0395905_0049446
833 Ga0395901_0000565
834 Ga0395901_0002787
835 Ga0395901_0071171
836 Ga0400488_27043
837 Ga0400483_040298
838 Ga0400483_235084
839 Ga0436361_0055297
840 Ga0451793_0680901
841 Ga0451795_1478778
842 Ga0451802_2167694
843 Ga0439448_0024151
844 Ga0439457_009000
845 Ga0451577_0036919
846 Ga0453683_0229945
847 Ga0466966_0007819
848 Ga0466966_0549781
849 Ga0466961_0081486
850 Ga0453684_0030253
851 Ga0453684_0090929
852 Ga0453684_0316695
853 Ga0466968_0244809
854 Ga0466959_0110101
855 Ga0451576_0000529
856 Ga0466958_0070829
857 Ga0495627_014728
858 Ga0495629_0211578
859 Ga0495638_0116572
860 Ga0495638_0382351
861 Ga0495651_0125254
862 Ga0495651_0253073
863 Ga0495653_0347886
864 Ga0495650_0000144
865 Ga0495585_0000091
866 Ga0495585_0001011
867 Ga0495596_0006000
868 Ga0495596_0272660
869 Ga0495583_0086133
870 Ga0495606_0000430
871 Ga0495606_0005234
872 Ga0495606_0056926
873 Ga0495606_0117870
874 Ga0495606_0319318
875 Ga0495610_0001278
876 Ga0495610_0001431
877 Ga0495616_0037851
878 Ga0495631_0002175
879 Ga0495631_0044093
880 Ga0495631_0059950
881 Ga0495637_0025261
882 Ga0495637_0036175
883 Ga0495648_0014170
884 Ga0495648_0038704
885 Ga0495663_0232284
886 Ga0495642_0157733
887 Ga0495642_0232518
888 Ga0495652_0048603
889 Ga0495652_0300169
890 Ga0495654_0014970
891 Ga0495609_0005752
892 Ga0495622_0143894
893 Ga0495633_0000157
894 Ga0495633_0005191
895 Ga0495633_0029364
896 Ga0495668_0000086
897 Ga0495625_0002989
898 Ga0495625_0071584
899 Ga0495625_0139092
900 Ga0495625_0398389
901 Ga0495625_0624116
902 Ga0495661_0001791
903 Ga0495661_0003188
904 Ga0495661_0090222
905 Ga0495661_0254821
906 Ga0495658_0047514
907 Ga0495660_0008203
908 Ga0495660_0012038
909 Ga0495683_0247489
910 Ga0495687_000220
911 Ga0495687_001613
912 Ga0495687_106133
913 Ga0495685_019128
914 Ga0495673_0077675
915 Ga0495686_0000585
916 Ga0495686_0000621
917 Ga0495686_0051582
918 Ga0495614_0016669
919 Ga0496116_0001728
920 Ga0496117_0001632
921 Ga0496118_0101906
922 Ga0496122_0009922
923 Ga0496123_0003787
924 Ga0496126_0285536
925 Ga0501198_027507
926 Ga0501223_000201
927 Ga0501238_016185
928 Ga0501240_001980
929 nmdc:mga0k408_108872_c1
930 nmdc:mga0k408_12828_c1
931 nmdc:mga0k408_156411_c1
932 nmdc:mga0k408_172285_c1
933 nmdc:mga0k408_384_c1
934 nmdc:mga07m45_222531_c1
935 Ga0500608_001571
936 Ga0500608_011768
937 Ga0500618_000018
938 Ga0500618_007457
939 Ga0500564_110610
940 Ga0500616_0033826
941 Ga0500624_000172
942 Ga0500552_015966
943 Ga0466962_0107269
944 2586209249
945 2599481655
946 2722726350
947 2738758290
948 2738763169
949 2738854052
950 2739302062
951 2739587527
952 2739618128
953 2739646218
954 2740031628
955 2776616288
956 2819545439
957 2839991686
958 2842724684
959 2842909613
960 2842911820
961 2849285696
962 2852625609
963 2852629679
964 2857631563
965 2884636564
966 2884934607
967 2890740705
968 2895500956
969 2896319317
970 2896346144
971 2898716266
972 2902052977
973 2904447924
974 2904783765
975 2910249657
976 2919181985
977 2919191047
978 2919440567
979 2919697147
980 2928082138
981 2928149285
982 2932087980
983 2939669327
984 2945998450
985 2954020925
986 2977234228
987 3003237231
988 8055590146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

35

95

0.99

PF07499

RuvA_C

RuvA, C-terminal domain

181

228

0.93

PF14520

HHH_5

Helix-hairpin-helix domain

105

163

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ixs-assembly1.cif.gz_A structure of ruvb complexed with ruva domain iii 0.9469 148 194
2zte-assembly1.cif.gz_A mtruva form iv 0.9451 1 130
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.9394 1 138
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9375 1 131
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9272 1 133
ID Description Score Start End Superfamily
2h5xD03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9661 148 193 1.10.8.10
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9661 64 130 1.10.150.20
2h5xB03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9648 148 193 1.10.8.10
2h5xA03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9644 148 193 1.10.8.10
af_P9WGW3_135_196_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.964 148 193 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A7Y3FSE1-F1-model_v4 Holliday junction branch migration protein RuvA 0.9913 1 81 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A2D9B9D4-F1-model_v4 Holliday junction branch migration protein RuvA 0.991 1 64 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A7Y3FSE1-F1-model_v4 Holliday junction branch migration protein RuvA 0.9793 1 81 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A2D9B9D4-F1-model_v4 Holliday junction branch migration protein RuvA 0.9759 1 64 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A4Q3D615-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9747 1 143 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518

Map