F454635

General Info

Members Datasets Scaffolds Average Seq Length
494 288 988 157

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0038191|Ga0496121_0038191_402_947
Length 181
Sequence VQGFGLCRASALALSPAHEHAYLPMKVHEVAPAVDANALLSGAQFADAFRIEINDHDLDARRVAERMMARQPRWAEALVSLRNLLMAPLGLRTSGAGLVPPGDMIGIFPVVSQTPDRLIAGFNDHHLDFRVVVDVTAPGGVRQVTATTLVKTHNWFGRTYLAIIMPFHRLIVPALLRQVAG

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
272 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
276 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
281 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
282 2791355199
283 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
284 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
285 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
286 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
287 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
288 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.16
Nodule 1.01
Rhizoplane 5.87
Rhizosphere 73.08
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0038191 3300048924 Bacteria 4257
2 JGI25153J46596_10019392 3300003215 Bacteria 2608
3 JGI25153J46596_10026757 3300003215 Bacteria 2036
4 Ga0070658_10040304 3300005327 Bacteria 3768
5 Ga0070676_10062519 3300005328 Bacteria 2216
6 Ga0070690_100304214 3300005330 Bacteria 1144
7 Ga0068869_100129206 3300005334 Bacteria 1940
8 Ga0068869_100300183 3300005334 Bacteria 1296
9 Ga0070680_100279590 3300005336 Bacteria 1414
10 Ga0070682_100070125 3300005337 Bacteria 2240
11 Ga0070660_100540288 3300005339 Bacteria 972
12 Ga0070687_100494497 3300005343 Bacteria 822
13 Ga0070692_10335336 3300005345 Bacteria 935
14 Ga0070668_100039249 3300005347 Bacteria 3621
15 Ga0070668_100137307 3300005347 Bacteria 1967
16 Ga0070668_101343428 3300005347 Bacteria 650
17 Ga0070669_100065504 3300005353 Bacteria 2677
18 Ga0070669_100143328 3300005353 Bacteria 1844
19 Ga0070675_100622310 3300005354 Bacteria 980
20 Ga0070671_100315023 3300005355 Bacteria 1333
21 Ga0070659_100104819 3300005366 Bacteria 2278
22 Ga0070667_100214581 3300005367 Bacteria 1711
23 Ga0070714_100071067 3300005435 Bacteria 3009
24 Ga0070713_100012621 3300005436 Bacteria 6206
25 Ga0070694_100482480 3300005444 Bacteria 984
26 Ga0070708_100205286 3300005445 Bacteria 1846
27 Ga0070663_100015891 3300005455 Bacteria 4872
28 Ga0070663_100097424 3300005455 Bacteria 2189
29 Ga0070663_100375446 3300005455 Bacteria 1157
30 Ga0070678_100143672 3300005456 Bacteria 1913
31 Ga0070678_100184739 3300005456 Bacteria 1710
32 Ga0070678_100670680 3300005456 Bacteria 932
33 Ga0070678_100787573 3300005456 Bacteria 862
34 Ga0070662_100087518 3300005457 Bacteria 2332
35 Ga0070662_100146652 3300005457 Bacteria 1834
36 Ga0070681_10033292 3300005458 Bacteria 5173
37 Ga0070685_10268331 3300005466 Bacteria 1138
38 Ga0070706_100651548 3300005467 Bacteria 978
39 Ga0070684_100600657 3300005535 Bacteria 1023
40 Ga0068853_100034545 3300005539 Bacteria 4293
41 Ga0068853_100043440 3300005539 Bacteria 3845
42 Ga0068853_100291466 3300005539 Bacteria 1506
43 Ga0070672_101438559 3300005543 Bacteria 617
44 Ga0070695_100575817 3300005545 Bacteria 881
45 Ga0070696_100037600 3300005546 Bacteria 3340
46 Ga0070693_100065987 3300005547 Bacteria 2117
47 Ga0070693_100154151 3300005547 Bacteria 1457
48 Ga0070665_100289808 3300005548 Bacteria 1639
49 Ga0070665_101267990 3300005548 Bacteria 747
50 Ga0068855_100063077 3300005563 Bacteria 4325
51 Ga0068855_100066701 3300005563 Bacteria 4196
52 Ga0068857_100062328 3300005577 Bacteria 3315
53 Ga0068856_100390182 3300005614 Bacteria 1412
54 Ga0068852_100559150 3300005616 Bacteria 1145
55 Ga0068852_101405669 3300005616 Bacteria 720
56 Ga0068859_100838804 3300005617 Bacteria 1005
57 Ga0068859_101814644 3300005617 Bacteria 674
58 Ga0068864_100049366 3300005618 Bacteria 3620
59 Ga0068864_101247929 3300005618 Bacteria 743
60 Ga0068861_100042563 3300005719 Bacteria 3404
61 Ga0068861_100070762 3300005719 Bacteria 2702
62 Ga0068861_100072729 3300005719 Bacteria 2668
63 Ga0068861_101168530 3300005719 Bacteria 743
64 Ga0068863_100089973 3300005841 Bacteria 2911
65 Ga0068863_100134561 3300005841 Bacteria 2361
66 Ga0068863_101224103 3300005841 Bacteria 757
67 Ga0068858_100097589 3300005842 Bacteria 2739
68 Ga0068858_100706950 3300005842 Bacteria 981
69 Ga0068860_100147066 3300005843 Bacteria 2267
70 Ga0068860_100496871 3300005843 Bacteria 1217
71 Ga0068860_100588263 3300005843 Bacteria 1118
72 Ga0068860_100588964 3300005843 Bacteria 1117
73 Ga0068860_101029730 3300005843 Bacteria 842
74 Ga0068862_100041678 3300005844 Bacteria 3907
75 Ga0068862_100056256 3300005844 Bacteria 3370
76 Ga0068862_100146838 3300005844 Bacteria 2096
77 Ga0068862_100562250 3300005844 Bacteria 1090
78 Ga0081455_10001940 3300005937 Bacteria 24852
79 Ga0081455_10106099 3300005937 Bacteria 2243
80 Ga0081540_1004623 3300005983 Bacteria 10414
81 Ga0081540_1016412 3300005983 Bacteria 4636
82 Ga0070717_10001641 3300006028 Bacteria 15545
83 Ga0075365_10090973 3300006038 Bacteria 2078
84 Ga0075365_10109595 3300006038 Bacteria 1897
85 Ga0075365_10712663 3300006038 Bacteria 709
86 Ga0075363_100009148 3300006048 Bacteria 4650
87 Ga0075363_100090418 3300006048 Bacteria 1684
88 Ga0075364_10042971 3300006051 Bacteria 2937
89 Ga0070716_100237905 3300006173 Bacteria 1233
90 Ga0070712_100548974 3300006175 Bacteria 973
91 Ga0075367_10049550 3300006178 Bacteria 2476
92 Ga0075367_10344261 3300006178 Bacteria 940
93 Ga0075367_10379966 3300006178 Bacteria 892
94 Ga0075369_10026198 3300006186 Bacteria 2429
95 Ga0075369_10122330 3300006186 Bacteria 1179
96 Ga0075366_10143859 3300006195 Bacteria 1442
97 Ga0097621_100071881 3300006237 Bacteria 2860
98 Ga0075370_10034491 3300006353 Bacteria 2836
99 Ga0068871_100197042 3300006358 Bacteria 1738
100 Ga0075434_100053305 3300006871 Bacteria 4019
101 Ga0075429_100957497 3300006880 Bacteria 749
102 Ga0068865_100265042 3300006881 Bacteria 1362
103 Ga0068865_100307585 3300006881 Bacteria 1271
104 Ga0097620_100838771 3300006931 Bacteria 1005
105 Ga0097620_101814645 3300006931 Bacteria 674
106 Ga0075435_100288054 3300007076 Bacteria 1403
107 Ga0099795_10083213 3300007788 Bacteria 1228
108 Ga0105240_10061283 3300009093 Bacteria 4688
109 Ga0111539_10093104 3300009094 Bacteria 3540
110 Ga0111539_10228637 3300009094 Bacteria 2166
111 Ga0111539_11357008 3300009094 Bacteria 825
112 Ga0105245_10022659 3300009098 Bacteria 5514
113 Ga0105245_10396935 3300009098 Bacteria 1377
114 Ga0105245_10725203 3300009098 Bacteria 1029
115 Ga0105245_11737158 3300009098 Bacteria 676
116 Ga0105245_12286845 3300009098 Bacteria 594
117 Ga0105247_10084233 3300009101 Bacteria 2009
118 Ga0105247_10096415 3300009101 Bacteria 1885
119 Ga0105247_10608604 3300009101 Bacteria 811
120 Ga0105243_10426070 3300009148 Bacteria 1239
121 Ga0105243_10438099 3300009148 Bacteria 1223
122 Ga0105242_10764184 3300009176 Bacteria 953
123 Ga0105242_11211587 3300009176 Bacteria 775
124 Ga0105248_10262604 3300009177 Bacteria 1944
125 Ga0105237_10072691 3300009545 Bacteria 3433
126 Ga0105237_10603271 3300009545 Bacteria 1105
127 Ga0105238_10430111 3300009551 Bacteria 1316
128 Ga0105238_10626465 3300009551 Bacteria 1085
129 Ga0105238_11075716 3300009551 Bacteria 826
130 Ga0105238_11211048 3300009551 Bacteria 780
131 Ga0105249_10089806 3300009553 Bacteria 2872
132 Ga0105249_10169933 3300009553 Bacteria 2113
133 Ga0105249_10518713 3300009553 Bacteria 1239
134 Ga0105249_11017700 3300009553 Bacteria 897
135 Ga0105239_10049024 3300010375 Bacteria 4631
136 Ga0105239_10258093 3300010375 Bacteria 1958
137 Ga0105239_10478839 3300010375 Bacteria 1414
138 Ga0105246_10226906 3300011119 Bacteria 1468
139 Ga0105246_10235840 3300011119 Bacteria 1443
140 Ga0105246_10274742 3300011119 Bacteria 1349
141 Ga0105246_10414015 3300011119 Bacteria 1123
142 Ga0157370_10254762 3300013104 Bacteria 1623
143 Ga0157374_10152209 3300013296 Bacteria 2249
144 Ga0157374_10700277 3300013296 Bacteria 1026
145 Ga0157378_10163006 3300013297 Bacteria 2086
146 Ga0157378_10243552 3300013297 Bacteria 1719
147 Ga0157378_10287688 3300013297 Bacteria 1586
148 Ga0163162_11277197 3300013306 Bacteria 834
149 Ga0157375_10590558 3300013308 Bacteria 1270
150 Ga0157375_11207804 3300013308 Bacteria 887
151 Ga0157375_11308328 3300013308 Bacteria 852
152 Ga0163163_10870676 3300014325 Bacteria 964
153 Ga0163163_11159248 3300014325 Bacteria 835
154 Ga0163163_11813883 3300014325 Bacteria 670
155 Ga0163163_12406164 3300014325 Bacteria 585
156 Ga0157380_10075941 3300014326 Bacteria 2733
157 Ga0157380_11290406 3300014326 Bacteria 777
158 Ga0157377_10203873 3300014745 Bacteria 1257
159 Ga0157377_10619059 3300014745 Bacteria 775
160 Ga0157377_10642821 3300014745 Bacteria 762
161 Ga0157379_10423564 3300014968 Bacteria 1226
162 Ga0157379_10656135 3300014968 Bacteria 982
163 Ga0157376_10097268 3300014969 Bacteria 2564
164 Ga0157376_12630806 3300014969 Bacteria 543
165 Ga0163161_10118197 3300017792 Bacteria 1989
166 Ga0163161_10523100 3300017792 Bacteria 969
167 Ga0207653_10263973 3300025885 Bacteria 662
168 Ga0207642_10094246 3300025899 Bacteria 1487
169 Ga0207710_10099161 3300025900 Bacteria 1372
170 Ga0207645_10076553 3300025907 Bacteria 2143
171 Ga0207643_10166428 3300025908 Bacteria 1328
172 Ga0207705_10037202 3300025909 Bacteria 3482
173 Ga0207684_10555414 3300025910 Bacteria 982
174 Ga0207654_10077849 3300025911 Bacteria 1989
175 Ga0207707_11110382 3300025912 Bacteria 644
176 Ga0207671_10087045 3300025914 Bacteria 2349
177 Ga0207671_10981190 3300025914 Bacteria 666
178 Ga0207662_10352902 3300025918 Bacteria 988
179 Ga0207657_10565863 3300025919 Bacteria 888
180 Ga0207649_10357428 3300025920 Bacteria 1083
181 Ga0207652_10017863 3300025921 Bacteria 5811
182 Ga0207681_10058561 3300025923 Bacteria 2638
183 Ga0207681_10628014 3300025923 Bacteria 889
184 Ga0207694_10064021 3300025924 Bacteria 2865
185 Ga0207694_10302178 3300025924 Bacteria 1318
186 Ga0207694_11469447 3300025924 Bacteria 575
187 Ga0207650_10415356 3300025925 Bacteria 1115
188 Ga0207700_10098074 3300025928 Bacteria 2330
189 Ga0207664_10508211 3300025929 Bacteria 1079
190 Ga0207644_10038089 3300025931 Bacteria 3385
191 Ga0207644_10340988 3300025931 Bacteria 1215
192 Ga0207690_10354821 3300025932 Bacteria 1160
193 Ga0207706_10106581 3300025933 Bacteria 2466
194 Ga0207709_10663608 3300025935 Bacteria 831
195 Ga0207670_10997987 3300025936 Bacteria 704
196 Ga0207669_11039466 3300025937 Bacteria 690
197 Ga0207704_10279425 3300025938 Bacteria 1268
198 Ga0207665_10259840 3300025939 Bacteria 1286
199 Ga0207691_10091610 3300025940 Bacteria 2724
200 Ga0207691_10560889 3300025940 Bacteria 968
201 Ga0207689_10044400 3300025942 Bacteria 3675
202 Ga0207689_10044768 3300025942 Bacteria 3659
203 Ga0207679_10493943 3300025945 Bacteria 1091
204 Ga0207679_11117852 3300025945 Bacteria 723
205 Ga0207667_10322668 3300025949 Bacteria 1577
206 Ga0207651_10175418 3300025960 Bacteria 1695
207 Ga0207712_10036657 3300025961 Bacteria 3342
208 Ga0207712_10293132 3300025961 Bacteria 1332
209 Ga0207712_10732725 3300025961 Bacteria 865
210 Ga0207668_10047772 3300025972 Bacteria 2932
211 Ga0207668_10085427 3300025972 Bacteria 2302
212 Ga0207668_10375370 3300025972 Bacteria 1195
213 Ga0207658_10676533 3300025986 Bacteria 931
214 Ga0207677_10254616 3300026023 Bacteria 1428
215 Ga0207703_10086562 3300026035 Bacteria 2625
216 Ga0207703_10324161 3300026035 Bacteria 1411
217 Ga0207639_10032015 3300026041 Bacteria 3868
218 Ga0207639_10050259 3300026041 Bacteria 3166
219 Ga0207639_10367964 3300026041 Bacteria 1288
220 Ga0207639_10412922 3300026041 Bacteria 1219
221 Ga0207678_10029356 3300026067 Bacteria 4799
222 Ga0207678_10031392 3300026067 Bacteria 4634
223 Ga0207678_10044322 3300026067 Bacteria 3848
224 Ga0207678_10101706 3300026067 Bacteria 2454
225 Ga0207678_10833361 3300026067 Bacteria 815
226 Ga0207678_10844545 3300026067 Bacteria 809
227 Ga0207702_10612601 3300026078 Bacteria 1069
228 Ga0207641_10191887 3300026088 Bacteria 1878
229 Ga0207641_10590940 3300026088 Bacteria 1086
230 Ga0207641_11445344 3300026088 Unclassified 689
231 Ga0207648_10118136 3300026089 Bacteria 2330
232 Ga0207676_10154596 3300026095 Bacteria 1980
233 Ga0207676_11073470 3300026095 Bacteria 795
234 Ga0207674_10179311 3300026116 Bacteria 2070
235 Ga0207675_100057476 3300026118 Bacteria 3630
236 Ga0207675_100067652 3300026118 Bacteria 3339
237 Ga0207675_100101942 3300026118 Bacteria 2705
238 Ga0207675_100502235 3300026118 Bacteria 1207
239 Ga0207683_10081631 3300026121 Bacteria 2870
240 Ga0207683_10133666 3300026121 Bacteria 2232
241 Ga0207683_10176518 3300026121 Bacteria 1936
242 Ga0207683_10181594 3300026121 Bacteria 1908
243 Ga0209813_10039310 3300027866 Bacteria 1434
244 Ga0268266_10017270 3300028379 Bacteria 6160
245 Ga0268266_10054920 3300028379 Bacteria 3423
246 Ga0268266_10708325 3300028379 Bacteria 970
247 Ga0268266_11055083 3300028379 Bacteria 786
248 Ga0268265_10038195 3300028380 Bacteria 3530
249 Ga0268265_10043499 3300028380 Bacteria 3339
250 Ga0268265_10709592 3300028380 Bacteria 972
251 Ga0268264_10080035 3300028381 Bacteria 2789
252 Ga0268264_10086271 3300028381 Bacteria 2696
253 Ga0268264_10760813 3300028381 Bacteria 966
254 Ga0268264_11487649 3300028381 Bacteria 688
255 Ga0307517_10210785 3300028786 Bacteria 1197
256 Ga0307517_10281373 3300028786 Bacteria 948
257 Ga0307515_10302831 3300028794 Bacteria 1282
258 Ga0307509_10109503 3300031507 Bacteria 2771
259 Ga0307408_100324539 3300031548 Bacteria 1298
260 Ga0307408_100793712 3300031548 Bacteria 859
261 Ga0307408_101331278 3300031548 Bacteria 674
262 Ga0307508_10087123 3300031616 Bacteria 2707
263 Ga0307516_10040019 3300031730 Bacteria 4668
264 Ga0307516_10068606 3300031730 Bacteria 3414
265 Ga0307516_10780144 3300031730 Bacteria 616
266 Ga0307413_10038674 3300031824 Bacteria 2768
267 Ga0307413_10149550 3300031824 Bacteria 1625
268 Ga0307410_10446878 3300031852 Bacteria 1054
269 Ga0307407_10434262 3300031903 Bacteria 949
270 Ga0307411_10068187 3300032005 Bacteria 2397
271 Ga0307411_10721645 3300032005 Bacteria 870
272 Ga0307415_100610274 3300032126 Bacteria 972
273 Ga0307510_10020563 3300033180 Bacteria 7711
274 Ga0373932_0201783 3300035112 Bacteria 707
275 Ga0373936_0059379 3300035113 Bacteria 1559
276 Ga0373936_0273552 3300035113 Bacteria 758
277 Ga0373942_0195510 3300035207 Bacteria 668
278 Ga0373962_0066823 3300035242 Bacteria 1067
279 Ga0373927_0587939 3300035695 Bacteria 736
280 Ga0439465_0232250 3300041413 Bacteria 679
281 Ga0451795_0546800 3300041456 Bacteria 920
282 Ga0451800_0330562 3300041459 Bacteria 784
283 Ga0451802_0947413 3300041460 Bacteria 757
284 Ga0451837_1593409 3300041494 Bacteria 688
285 Ga0451843_0185592 3300041509 Bacteria 521
286 Ga0439458_0182153 3300042157 Bacteria 570
287 Ga0495617_036716 3300046452 Bacteria 1642
288 Ga0495617_040122 3300046452 Bacteria 1566
289 Ga0495617_067189 3300046452 Bacteria 1181
290 Ga0495617_140109 3300046452 Bacteria 773
291 Ga0495627_224387 3300046453 Bacteria 516
292 Ga0495603_0048317 3300046455 Bacteria 2533
293 Ga0495590_0056684 3300046457 Bacteria 1369
294 Ga0495629_0061440 3300046459 Bacteria 2626
295 Ga0495629_0226700 3300046459 Bacteria 1288
296 Ga0495638_0051025 3300046460 Bacteria 2582
297 Ga0495638_0107547 3300046460 Bacteria 1660
298 Ga0495638_0127940 3300046460 Bacteria 1495
299 Ga0495638_0128498 3300046460 Bacteria 1491
300 Ga0495638_0227502 3300046460 Bacteria 1039
301 Ga0495641_0131063 3300046461 Bacteria 1119
302 Ga0495650_0057346 3300046471 Bacteria 1577
303 Ga0495580_0109504 3300046472 Bacteria 1918
304 Ga0495582_0122258 3300046473 Bacteria 1467
305 Ga0495582_0147648 3300046473 Bacteria 1334
306 Ga0495605_0042174 3300046474 Bacteria 2270
307 Ga0495584_0048526 3300046491 Bacteria 2140
308 Ga0495585_0157141 3300046492 Bacteria 1182
309 Ga0495585_0304247 3300046492 Bacteria 783
310 Ga0495594_0104878 3300046499 Bacteria 1591
311 Ga0495596_0066149 3300046500 Bacteria 1405
312 Ga0495596_0090481 3300046500 Bacteria 1188
313 Ga0495607_0233985 3300046501 Bacteria 892
314 Ga0495583_0243145 3300046506 Bacteria 723
315 Ga0495606_0174033 3300046507 Bacteria 1246
316 Ga0495608_0477380 3300046511 Bacteria 757
317 Ga0495610_0241091 3300046512 Bacteria 721
318 Ga0495620_0235297 3300046515 Bacteria 700
319 Ga0495631_0035888 3300046518 Bacteria 2216
320 Ga0495631_0040145 3300046518 Bacteria 2074
321 Ga0495631_0169867 3300046518 Bacteria 935
322 Ga0495631_0410969 3300046518 Bacteria 576
323 Ga0495632_0260536 3300046519 Bacteria 776
324 Ga0495637_0127374 3300046520 Bacteria 975
325 Ga0495643_0294917 3300046522 Bacteria 741
326 Ga0495648_0096810 3300046524 Bacteria 1639
327 Ga0495654_0274208 3300046530 Bacteria 696
328 Ga0495598_0040569 3300046537 Bacteria 1358
329 Ga0495598_0152442 3300046537 Bacteria 808
330 Ga0495609_0100585 3300046538 Bacteria 1253
331 Ga0495609_0429702 3300046538 Bacteria 526
332 Ga0495621_0012411 3300046539 Bacteria 2657
333 Ga0495597_0062040 3300046542 Bacteria 1627
334 Ga0495597_0110479 3300046542 Bacteria 1153
335 Ga0495645_0138259 3300046543 Bacteria 1702
336 Ga0495656_0007744 3300046615 Bacteria 3809
337 Ga0495656_0040383 3300046615 Bacteria 1944
338 Ga0495668_0053264 3300046616 Bacteria 2237
339 Ga0495668_0192540 3300046616 Bacteria 1117
340 Ga0495668_0396429 3300046616 Bacteria 758
341 Ga0495668_0435751 3300046616 Bacteria 721
342 Ga0495668_0464483 3300046616 Bacteria 697
343 Ga0495668_0472107 3300046616 Bacteria 691
344 Ga0495611_0006884 3300046648 Bacteria 4832
345 Ga0495611_0067872 3300046648 Bacteria 1627
346 Ga0495625_0290486 3300046660 Bacteria 1049
347 Ga0495625_0732249 3300046660 Bacteria 581
348 Ga0495659_0014402 3300046664 Bacteria 2587
349 Ga0495588_0007296 3300046674 Bacteria 5025
350 Ga0495588_0363026 3300046674 Bacteria 761
351 Ga0495658_0716169 3300046683 Bacteria 641
352 Ga0495669_0129485 3300046684 Bacteria 1187
353 Ga0495669_0158036 3300046684 Bacteria 1075
354 Ga0495670_0109832 3300046691 Bacteria 1426
355 Ga0495670_0199132 3300046691 Bacteria 1060
356 Ga0495671_0052115 3300046692 Bacteria 2034
357 Ga0495671_0073006 3300046692 Bacteria 1684
358 Ga0495671_0345444 3300046692 Bacteria 714
359 Ga0495649_0107856 3300046694 Bacteria 1478
360 Ga0495649_0161839 3300046694 Bacteria 1173
361 Ga0495649_0202357 3300046694 Bacteria 1031
362 Ga0495649_0307403 3300046694 Bacteria 806
363 Ga0495589_0049553 3300046794 Bacteria 2078
364 Ga0495600_0311633 3300046809 Bacteria 991
365 Ga0495636_0175616 3300047318 Bacteria 970
366 Ga0495636_0214529 3300047318 Bacteria 882
367 Ga0495674_0573350 3300047319 Bacteria 896
368 Ga0495683_0033013 3300047323 Bacteria 2636
369 Ga0495683_0211632 3300047323 Bacteria 869
370 Ga0495677_0103358 3300047445 Bacteria 1080
371 Ga0495677_0126188 3300047445 Bacteria 978
372 Ga0495673_0058492 3300047469 Bacteria 1661
373 Ga0495673_0170456 3300047469 Bacteria 830
374 Ga0495593_0163738 3300047673 Bacteria 1122
375 Ga0495626_0100321 3300048091 Bacteria 1263
376 Ga0496100_0809276 3300048903 Bacteria 734
377 Ga0496101_0440088 3300048904 Bacteria 1028
378 Ga0496102_0058325 3300048905 Bacteria 3527
379 Ga0496102_0232194 3300048905 Bacteria 1739
380 Ga0496102_0404982 3300048905 Bacteria 1282
381 Ga0496102_0578677 3300048905 Bacteria 1046
382 Ga0496102_0704704 3300048905 Bacteria 932
383 Ga0496103_0316019 3300048906 Bacteria 1005
384 Ga0496103_0783746 3300048906 Bacteria 602
385 Ga0496104_0079874 3300048907 Bacteria 3118
386 Ga0496104_0081391 3300048907 Bacteria 3088
387 Ga0496104_1526208 3300048907 Unclassified 571
388 Ga0496104_1579669 3300048907 Bacteria 559
389 Ga0496105_0051952 3300048908 Bacteria 3384
390 Ga0496106_0078940 3300048909 Bacteria 2527
391 Ga0496106_0509081 3300048909 Bacteria 967
392 Ga0496107_0111869 3300048910 Bacteria 2007
393 Ga0496108_0019459 3300048911 Bacteria 5576
394 Ga0496108_0156718 3300048911 Bacteria 1967
395 Ga0496109_0267993 3300048912 Bacteria 1609
396 Ga0496110_0025389 3300048913 Bacteria 5062
397 Ga0496111_0050242 3300048914 Bacteria 3007
398 Ga0496112_0038796 3300048915 Bacteria 4653
399 Ga0496112_0808730 3300048915 Bacteria 862
400 Ga0496113_0013686 3300048916 Bacteria 5508
401 Ga0496114_0780780 3300048917 Bacteria 833
402 Ga0496117_0371711 3300048920 Bacteria 731
403 Ga0496118_0266132 3300048921 Bacteria 964
404 Ga0496119_0214365 3300048922 Bacteria 989
405 Ga0496121_0072689 3300048924 Bacteria 2760
406 Ga0496121_0132476 3300048924 Bacteria 1863
407 Ga0496121_0585327 3300048924 Bacteria 691
408 Ga0496121_0629606 3300048924 Bacteria 657
409 Ga0496124_0248300 3300048927 Bacteria 1318
410 Ga0496124_0469744 3300048927 Bacteria 852
411 Ga0496124_0863172 3300048927 Bacteria 553
412 Ga0496125_0199417 3300048928 Bacteria 1312
413 Ga0496125_0276635 3300048928 Bacteria 1043
414 Ga0496125_0377286 3300048928 Bacteria 837
415 Ga0496126_0016232 3300048929 Bacteria 7457
416 Ga0496126_0149205 3300048929 Bacteria 2005
417 Ga0496126_0175812 3300048929 Bacteria 1821
418 Ga0496126_0239000 3300048929 Bacteria 1518
419 Ga0496126_0256047 3300048929 Bacteria 1457
420 Ga0496126_0272161 3300048929 Bacteria 1405
421 Ga0501037_0900075 3300049573 Bacteria 580
422 Ga0501038_0518045 3300049574 Bacteria 910
423 Ga0501039_0216282 3300049575 Bacteria 1507
424 Ga0501067_0083204 3300049583 Bacteria 1775
425 Ga0501067_0717165 3300049583 Bacteria 562
426 Ga0501076_0312877 3300049592 Bacteria 1288
427 Ga0501079_1417639 3300049741 Bacteria 547
428 nmdc:mga03683_13407_c1 3300050489 Bacteria 3016
429 nmdc:mga03683_145314_c1 3300050489 Bacteria 1068
430 nmdc:mga03n38_13089_c1 3300050490 Bacteria 3141
431 nmdc:mga03n38_50337_c1 3300050490 Bacteria 1856
432 nmdc:mga00v17_102085_c1 3300050491 Bacteria 1811
433 nmdc:mga00v17_275156_c1 3300050491 Bacteria 1093
434 nmdc:mga00v17_59693_c1 3300050491 Bacteria 2341
435 nmdc:mga0yw44_372257_c1 3300050492 Bacteria 964
436 nmdc:mga0yw44_96132_c1 3300050492 Bacteria 1880
437 nmdc:mga0k408_189915_c1 3300050493 Bacteria 1226
438 nmdc:mga0k408_284250_c1 3300050493 Bacteria 987
439 nmdc:mga0k408_670700_c1 3300050493 Bacteria 609
440 nmdc:mga06z11_31048_c1 3300050494 Bacteria 2592
441 nmdc:mga06z11_38876_c1 3300050494 Bacteria 2365
442 nmdc:mga06z11_478722_c1 3300050494 Bacteria 753
443 nmdc:mga07m45_45660_c1 3300050496 Bacteria 2460
444 nmdc:mga07m45_92365_c1 3300050496 Bacteria 1735
445 nmdc:mga05p37_316773_c1 3300050507 Bacteria 1847
446 nmdc:mga08y16_1368922_c1 3300050511 Bacteria 672
447 nmdc:mga08y16_196384_c1 3300050511 Bacteria 2091
448 nmdc:mga0n895_608637_c1 3300050512 Bacteria 1094
449 nmdc:mga0rr50_533363_c1 3300050513 Bacteria 999
450 nmdc:mga0sz30_108137_c1 3300050516 Bacteria 1217
451 Ga0495601_0056936 3300053077 Bacteria 2476
452 Ga0495612_0524817 3300053078 Bacteria 544
453 Ga0495595_0011027 3300053084 Bacteria 3772
454 Ga0495619_0010414 3300053085 Bacteria 5851
455 Ga0495619_0541961 3300053085 Bacteria 799
456 Ga0500643_029159 3300053087 Bacteria 1701
457 Ga0500583_0042598 3300053092 Bacteria 2069
458 Ga0500566_0036503 3300053094 Bacteria 2850
459 Ga0500566_0294904 3300053094 Bacteria 766
460 Ga0500641_0012439 3300053096 Bacteria 3108
461 Ga0500641_0273139 3300053096 Bacteria 703
462 Ga0500554_040746 3300053102 Bacteria 1424
463 Ga0500562_008878 3300053108 Bacteria 2539
464 Ga0500595_000122 3300053119 Bacteria 51231
465 Ga0500595_016797 3300053119 Bacteria 2718
466 Ga0500595_058369 3300053119 Bacteria 1173
467 Ga0500642_0139966 3300053130 Bacteria 1135
468 Ga0500655_005491 3300053133 Bacteria 2287
469 Ga0500658_0012599 3300053134 Bacteria 3121
470 Ga0500658_0034673 3300053134 Bacteria 1993
471 Ga0500559_0280015 3300053136 Bacteria 784
472 Ga0500561_0135893 3300053137 Bacteria 759
473 Ga0500577_0015094 3300053142 Bacteria 2404
474 Ga0500577_0345383 3300053142 Bacteria 650
475 Ga0500589_019801 3300053147 Bacteria 3065
476 Ga0500590_041576 3300053148 Bacteria 2363
477 Ga0500604_0087171 3300053151 Bacteria 1016
478 Ga0500604_0343069 3300053151 Bacteria 519
479 Ga0500622_0069554 3300053156 Bacteria 1783
480 Ga0500633_0137049 3300053160 Bacteria 915
481 Ga0500638_000905 3300053162 Bacteria 8406
482 Ga0500638_098052 3300053162 Bacteria 1371
483 Ga0500636_0144134 3300053177 Bacteria 1315
484 Ga0500637_0000124 3300053178 Bacteria 27835
485 Ga0500645_087279 3300053730 Bacteria 886
486 Ga0500661_000160 3300055283 Bacteria 11605
487 2723841443 2721755755 Bacteria 8322773
488 2793083708
489 2879112970 2879110137 Bacteria 8907982
490 2889035714 2889033259 Bacteria 9099371
491 2922392763 2922386360 Bacteria 7017218
492 8006969535 8006964411 Bacteria 8966052
493 8006989153 8006984368 Bacteria 9651211
494 8056677802 8056673599 Bacteria 7871253
495 Ga0496121_0038191
496 JGI25153J46596_10019392
497 JGI25153J46596_10026757
498 Ga0070658_10040304
499 Ga0070676_10062519
500 Ga0070690_100304214
501 Ga0068869_100129206
502 Ga0068869_100300183
503 Ga0070680_100279590
504 Ga0070682_100070125
505 Ga0070660_100540288
506 Ga0070687_100494497
507 Ga0070692_10335336
508 Ga0070668_100039249
509 Ga0070668_100137307
510 Ga0070668_101343428
511 Ga0070669_100065504
512 Ga0070669_100143328
513 Ga0070675_100622310
514 Ga0070671_100315023
515 Ga0070659_100104819
516 Ga0070667_100214581
517 Ga0070714_100071067
518 Ga0070713_100012621
519 Ga0070694_100482480
520 Ga0070708_100205286
521 Ga0070663_100015891
522 Ga0070663_100097424
523 Ga0070663_100375446
524 Ga0070678_100143672
525 Ga0070678_100184739
526 Ga0070678_100670680
527 Ga0070678_100787573
528 Ga0070662_100087518
529 Ga0070662_100146652
530 Ga0070681_10033292
531 Ga0070685_10268331
532 Ga0070706_100651548
533 Ga0070684_100600657
534 Ga0068853_100034545
535 Ga0068853_100043440
536 Ga0068853_100291466
537 Ga0070672_101438559
538 Ga0070695_100575817
539 Ga0070696_100037600
540 Ga0070693_100065987
541 Ga0070693_100154151
542 Ga0070665_100289808
543 Ga0070665_101267990
544 Ga0068855_100063077
545 Ga0068855_100066701
546 Ga0068857_100062328
547 Ga0068856_100390182
548 Ga0068852_100559150
549 Ga0068852_101405669
550 Ga0068859_100838804
551 Ga0068859_101814644
552 Ga0068864_100049366
553 Ga0068864_101247929
554 Ga0068861_100042563
555 Ga0068861_100070762
556 Ga0068861_100072729
557 Ga0068861_101168530
558 Ga0068863_100089973
559 Ga0068863_100134561
560 Ga0068863_101224103
561 Ga0068858_100097589
562 Ga0068858_100706950
563 Ga0068860_100147066
564 Ga0068860_100496871
565 Ga0068860_100588263
566 Ga0068860_100588964
567 Ga0068860_101029730
568 Ga0068862_100041678
569 Ga0068862_100056256
570 Ga0068862_100146838
571 Ga0068862_100562250
572 Ga0081455_10001940
573 Ga0081455_10106099
574 Ga0081540_1004623
575 Ga0081540_1016412
576 Ga0070717_10001641
577 Ga0075365_10090973
578 Ga0075365_10109595
579 Ga0075365_10712663
580 Ga0075363_100009148
581 Ga0075363_100090418
582 Ga0075364_10042971
583 Ga0070716_100237905
584 Ga0070712_100548974
585 Ga0075367_10049550
586 Ga0075367_10344261
587 Ga0075367_10379966
588 Ga0075369_10026198
589 Ga0075369_10122330
590 Ga0075366_10143859
591 Ga0097621_100071881
592 Ga0075370_10034491
593 Ga0068871_100197042
594 Ga0075434_100053305
595 Ga0075429_100957497
596 Ga0068865_100265042
597 Ga0068865_100307585
598 Ga0097620_100838771
599 Ga0097620_101814645
600 Ga0075435_100288054
601 Ga0099795_10083213
602 Ga0105240_10061283
603 Ga0111539_10093104
604 Ga0111539_10228637
605 Ga0111539_11357008
606 Ga0105245_10022659
607 Ga0105245_10396935
608 Ga0105245_10725203
609 Ga0105245_11737158
610 Ga0105245_12286845
611 Ga0105247_10084233
612 Ga0105247_10096415
613 Ga0105247_10608604
614 Ga0105243_10426070
615 Ga0105243_10438099
616 Ga0105242_10764184
617 Ga0105242_11211587
618 Ga0105248_10262604
619 Ga0105237_10072691
620 Ga0105237_10603271
621 Ga0105238_10430111
622 Ga0105238_10626465
623 Ga0105238_11075716
624 Ga0105238_11211048
625 Ga0105249_10089806
626 Ga0105249_10169933
627 Ga0105249_10518713
628 Ga0105249_11017700
629 Ga0105239_10049024
630 Ga0105239_10258093
631 Ga0105239_10478839
632 Ga0105246_10226906
633 Ga0105246_10235840
634 Ga0105246_10274742
635 Ga0105246_10414015
636 Ga0157370_10254762
637 Ga0157374_10152209
638 Ga0157374_10700277
639 Ga0157378_10163006
640 Ga0157378_10243552
641 Ga0157378_10287688
642 Ga0163162_11277197
643 Ga0157375_10590558
644 Ga0157375_11207804
645 Ga0157375_11308328
646 Ga0163163_10870676
647 Ga0163163_11159248
648 Ga0163163_11813883
649 Ga0163163_12406164
650 Ga0157380_10075941
651 Ga0157380_11290406
652 Ga0157377_10203873
653 Ga0157377_10619059
654 Ga0157377_10642821
655 Ga0157379_10423564
656 Ga0157379_10656135
657 Ga0157376_10097268
658 Ga0157376_12630806
659 Ga0163161_10118197
660 Ga0163161_10523100
661 Ga0207653_10263973
662 Ga0207642_10094246
663 Ga0207710_10099161
664 Ga0207645_10076553
665 Ga0207643_10166428
666 Ga0207705_10037202
667 Ga0207684_10555414
668 Ga0207654_10077849
669 Ga0207707_11110382
670 Ga0207671_10087045
671 Ga0207671_10981190
672 Ga0207662_10352902
673 Ga0207657_10565863
674 Ga0207649_10357428
675 Ga0207652_10017863
676 Ga0207681_10058561
677 Ga0207681_10628014
678 Ga0207694_10064021
679 Ga0207694_10302178
680 Ga0207694_11469447
681 Ga0207650_10415356
682 Ga0207700_10098074
683 Ga0207664_10508211
684 Ga0207644_10038089
685 Ga0207644_10340988
686 Ga0207690_10354821
687 Ga0207706_10106581
688 Ga0207709_10663608
689 Ga0207670_10997987
690 Ga0207669_11039466
691 Ga0207704_10279425
692 Ga0207665_10259840
693 Ga0207691_10091610
694 Ga0207691_10560889
695 Ga0207689_10044400
696 Ga0207689_10044768
697 Ga0207679_10493943
698 Ga0207679_11117852
699 Ga0207667_10322668
700 Ga0207651_10175418
701 Ga0207712_10036657
702 Ga0207712_10293132
703 Ga0207712_10732725
704 Ga0207668_10047772
705 Ga0207668_10085427
706 Ga0207668_10375370
707 Ga0207658_10676533
708 Ga0207677_10254616
709 Ga0207703_10086562
710 Ga0207703_10324161
711 Ga0207639_10032015
712 Ga0207639_10050259
713 Ga0207639_10367964
714 Ga0207639_10412922
715 Ga0207678_10029356
716 Ga0207678_10031392
717 Ga0207678_10044322
718 Ga0207678_10101706
719 Ga0207678_10833361
720 Ga0207678_10844545
721 Ga0207702_10612601
722 Ga0207641_10191887
723 Ga0207641_10590940
724 Ga0207641_11445344
725 Ga0207648_10118136
726 Ga0207676_10154596
727 Ga0207676_11073470
728 Ga0207674_10179311
729 Ga0207675_100057476
730 Ga0207675_100067652
731 Ga0207675_100101942
732 Ga0207675_100502235
733 Ga0207683_10081631
734 Ga0207683_10133666
735 Ga0207683_10176518
736 Ga0207683_10181594
737 Ga0209813_10039310
738 Ga0268266_10017270
739 Ga0268266_10054920
740 Ga0268266_10708325
741 Ga0268266_11055083
742 Ga0268265_10038195
743 Ga0268265_10043499
744 Ga0268265_10709592
745 Ga0268264_10080035
746 Ga0268264_10086271
747 Ga0268264_10760813
748 Ga0268264_11487649
749 Ga0307517_10210785
750 Ga0307517_10281373
751 Ga0307515_10302831
752 Ga0307509_10109503
753 Ga0307408_100324539
754 Ga0307408_100793712
755 Ga0307408_101331278
756 Ga0307508_10087123
757 Ga0307516_10040019
758 Ga0307516_10068606
759 Ga0307516_10780144
760 Ga0307413_10038674
761 Ga0307413_10149550
762 Ga0307410_10446878
763 Ga0307407_10434262
764 Ga0307411_10068187
765 Ga0307411_10721645
766 Ga0307415_100610274
767 Ga0307510_10020563
768 Ga0373932_0201783
769 Ga0373936_0059379
770 Ga0373936_0273552
771 Ga0373942_0195510
772 Ga0373962_0066823
773 Ga0373927_0587939
774 Ga0439465_0232250
775 Ga0451795_0546800
776 Ga0451800_0330562
777 Ga0451802_0947413
778 Ga0451837_1593409
779 Ga0451843_0185592
780 Ga0439458_0182153
781 Ga0495617_036716
782 Ga0495617_040122
783 Ga0495617_067189
784 Ga0495617_140109
785 Ga0495627_224387
786 Ga0495603_0048317
787 Ga0495590_0056684
788 Ga0495629_0061440
789 Ga0495629_0226700
790 Ga0495638_0051025
791 Ga0495638_0107547
792 Ga0495638_0127940
793 Ga0495638_0128498
794 Ga0495638_0227502
795 Ga0495641_0131063
796 Ga0495650_0057346
797 Ga0495580_0109504
798 Ga0495582_0122258
799 Ga0495582_0147648
800 Ga0495605_0042174
801 Ga0495584_0048526
802 Ga0495585_0157141
803 Ga0495585_0304247
804 Ga0495594_0104878
805 Ga0495596_0066149
806 Ga0495596_0090481
807 Ga0495607_0233985
808 Ga0495583_0243145
809 Ga0495606_0174033
810 Ga0495608_0477380
811 Ga0495610_0241091
812 Ga0495620_0235297
813 Ga0495631_0035888
814 Ga0495631_0040145
815 Ga0495631_0169867
816 Ga0495631_0410969
817 Ga0495632_0260536
818 Ga0495637_0127374
819 Ga0495643_0294917
820 Ga0495648_0096810
821 Ga0495654_0274208
822 Ga0495598_0040569
823 Ga0495598_0152442
824 Ga0495609_0100585
825 Ga0495609_0429702
826 Ga0495621_0012411
827 Ga0495597_0062040
828 Ga0495597_0110479
829 Ga0495645_0138259
830 Ga0495656_0007744
831 Ga0495656_0040383
832 Ga0495668_0053264
833 Ga0495668_0192540
834 Ga0495668_0396429
835 Ga0495668_0435751
836 Ga0495668_0464483
837 Ga0495668_0472107
838 Ga0495611_0006884
839 Ga0495611_0067872
840 Ga0495625_0290486
841 Ga0495625_0732249
842 Ga0495659_0014402
843 Ga0495588_0007296
844 Ga0495588_0363026
845 Ga0495658_0716169
846 Ga0495669_0129485
847 Ga0495669_0158036
848 Ga0495670_0109832
849 Ga0495670_0199132
850 Ga0495671_0052115
851 Ga0495671_0073006
852 Ga0495671_0345444
853 Ga0495649_0107856
854 Ga0495649_0161839
855 Ga0495649_0202357
856 Ga0495649_0307403
857 Ga0495589_0049553
858 Ga0495600_0311633
859 Ga0495636_0175616
860 Ga0495636_0214529
861 Ga0495674_0573350
862 Ga0495683_0033013
863 Ga0495683_0211632
864 Ga0495677_0103358
865 Ga0495677_0126188
866 Ga0495673_0058492
867 Ga0495673_0170456
868 Ga0495593_0163738
869 Ga0495626_0100321
870 Ga0496100_0809276
871 Ga0496101_0440088
872 Ga0496102_0058325
873 Ga0496102_0232194
874 Ga0496102_0404982
875 Ga0496102_0578677
876 Ga0496102_0704704
877 Ga0496103_0316019
878 Ga0496103_0783746
879 Ga0496104_0079874
880 Ga0496104_0081391
881 Ga0496104_1526208
882 Ga0496104_1579669
883 Ga0496105_0051952
884 Ga0496106_0078940
885 Ga0496106_0509081
886 Ga0496107_0111869
887 Ga0496108_0019459
888 Ga0496108_0156718
889 Ga0496109_0267993
890 Ga0496110_0025389
891 Ga0496111_0050242
892 Ga0496112_0038796
893 Ga0496112_0808730
894 Ga0496113_0013686
895 Ga0496114_0780780
896 Ga0496117_0371711
897 Ga0496118_0266132
898 Ga0496119_0214365
899 Ga0496121_0072689
900 Ga0496121_0132476
901 Ga0496121_0585327
902 Ga0496121_0629606
903 Ga0496124_0248300
904 Ga0496124_0469744
905 Ga0496124_0863172
906 Ga0496125_0199417
907 Ga0496125_0276635
908 Ga0496125_0377286
909 Ga0496126_0016232
910 Ga0496126_0149205
911 Ga0496126_0175812
912 Ga0496126_0239000
913 Ga0496126_0256047
914 Ga0496126_0272161
915 Ga0501037_0900075
916 Ga0501038_0518045
917 Ga0501039_0216282
918 Ga0501067_0083204
919 Ga0501067_0717165
920 Ga0501076_0312877
921 Ga0501079_1417639
922 nmdc:mga03683_13407_c1
923 nmdc:mga03683_145314_c1
924 nmdc:mga03n38_13089_c1
925 nmdc:mga03n38_50337_c1
926 nmdc:mga00v17_102085_c1
927 nmdc:mga00v17_275156_c1
928 nmdc:mga00v17_59693_c1
929 nmdc:mga0yw44_372257_c1
930 nmdc:mga0yw44_96132_c1
931 nmdc:mga0k408_189915_c1
932 nmdc:mga0k408_284250_c1
933 nmdc:mga0k408_670700_c1
934 nmdc:mga06z11_31048_c1
935 nmdc:mga06z11_38876_c1
936 nmdc:mga06z11_478722_c1
937 nmdc:mga07m45_45660_c1
938 nmdc:mga07m45_92365_c1
939 nmdc:mga05p37_316773_c1
940 nmdc:mga08y16_1368922_c1
941 nmdc:mga08y16_196384_c1
942 nmdc:mga0n895_608637_c1
943 nmdc:mga0rr50_533363_c1
944 nmdc:mga0sz30_108137_c1
945 Ga0495601_0056936
946 Ga0495612_0524817
947 Ga0495595_0011027
948 Ga0495619_0010414
949 Ga0495619_0541961
950 Ga0500643_029159
951 Ga0500583_0042598
952 Ga0500566_0036503
953 Ga0500566_0294904
954 Ga0500641_0012439
955 Ga0500641_0273139
956 Ga0500554_040746
957 Ga0500562_008878
958 Ga0500595_000122
959 Ga0500595_016797
960 Ga0500595_058369
961 Ga0500642_0139966
962 Ga0500655_005491
963 Ga0500658_0012599
964 Ga0500658_0034673
965 Ga0500559_0280015
966 Ga0500561_0135893
967 Ga0500577_0015094
968 Ga0500577_0345383
969 Ga0500589_019801
970 Ga0500590_041576
971 Ga0500604_0087171
972 Ga0500604_0343069
973 Ga0500622_0069554
974 Ga0500633_0137049
975 Ga0500638_000905
976 Ga0500638_098052
977 Ga0500636_0144134
978 Ga0500637_0000124
979 Ga0500645_087279
980 Ga0500661_000160
981 2723841443
982 2793083708
983 2879112970
984 2889035714
985 2922392763
986 8006969535
987 8006989153
988 8056677802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11066

DUF2867

Protein of unknown function (DUF2867)

39

175

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qrc-assembly1.cif.gz_A the crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate 0.7271 93 127
3qrc-assembly2.cif.gz_B the crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate 0.7269 93 127
1qj8-assembly1.cif.gz_A crystal structure of the outer membrane protein ompx from escherichia coli 0.7265 93 127
3qra-assembly1.cif.gz_A the crystal structure of ail, the attachment invasion locus protein of yersinia pestis 0.7239 93 127
3qq2-assembly1.cif.gz_A-2 crystal structure of the beta domain of the bordetella autotransporter brka 0.5982 93 127
ID Description Score Start End Superfamily
3ni8A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7784 84 124 3.30.530.20
3qrcB00 Mainly Beta;Beta Barrel;Porin; 0.7269 93 127 2.40.160.20
af_Q9SXB7_84_423_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.716 93 128 2.40.160.40
af_O53408_30_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.6986 80 153 3.30.530.20
1kacA00 Mainly Beta;Sandwich;Adenovirus Type 5 Fiber Protein (Receptor Binding Domain);Adenovirus pIV-related, attachment domain 0.6621 91 124 2.60.90.10
ID Description Score Start End GO Terms
AF-H0TPZ5-F1-model_v4 DUF2867 domain-containing protein 0.9359 1 155
AF-A0A316H504-F1-model_v4 Uncharacterized protein DUF2867 0.9352 12 155
AF-W3RFP0-F1-model_v4 DUF2867 domain-containing protein 0.9305 1 156
AF-A0A503ZWC8-F1-model_v4 deleted 0.9302 1 154
AF-W3RFP0-F1-model_v4 DUF2867 domain-containing protein 0.9248 1 156

Map