F454637

General Info

Members Datasets Scaffolds Average Seq Length
494 277 988 162

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0193363|Ga0501036_0193363_558_1106
Length 182
Sequence MIERMLHGGAANSAEDFMAISVGDKLPQHTFTTIGGEGPEPITTADVFAGKKVALFAVPGAYTPTCHQQHMPGFVSRLGDLAAKGIDTVACTAVNDIFVLQNWAKDTGALGKVVMLADGSAEFARKIGLDIDLTTRGLGVRSKRYAMLVEDGVVKVLNVEDAPPQHDRSSAATLCSMIDYAI

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
142 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
143 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.12
Nodule 0
Rhizoplane 9.11
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0193363 3300049572 Bacteria 1712
2 LJNas_1011792 3300000546 Bacteria 931
3 JGI25405J52794_10034275 3300003911 Bacteria 1061
4 Ga0058861_11445454 3300004800 Bacteria 674
5 Ga0070658_10034310 3300005327 Bacteria 4083
6 Ga0070676_10003900 3300005328 Bacteria 7828
7 Ga0070676_10393138 3300005328 Bacteria 963
8 Ga0070676_10524868 3300005328 Bacteria 844
9 Ga0070676_10863177 3300005328 Bacteria 672
10 Ga0068869_100043663 3300005334 Bacteria 3221
11 Ga0068869_100429567 3300005334 Bacteria 1091
12 Ga0068869_100571923 3300005334 Bacteria 952
13 Ga0070680_100012963 3300005336 Bacteria 6484
14 Ga0070680_100042194 3300005336 Bacteria 3700
15 Ga0070682_100008980 3300005337 Bacteria 5648
16 Ga0070660_100039356 3300005339 Bacteria 3593
17 Ga0070687_100244839 3300005343 Bacteria 1111
18 Ga0070661_100462794 3300005344 Bacteria 1010
19 Ga0070692_10375646 3300005345 Bacteria 890
20 Ga0070668_100223682 3300005347 Bacteria 1553
21 Ga0070668_100265860 3300005347 Bacteria 1428
22 Ga0070668_101236339 3300005347 Bacteria 677
23 Ga0070675_100622145 3300005354 Bacteria 980
24 Ga0070674_100883085 3300005356 Bacteria 778
25 Ga0070688_100574285 3300005365 Bacteria 860
26 Ga0070659_100042196 3300005366 Bacteria 3566
27 Ga0070659_100886943 3300005366 Bacteria 779
28 Ga0070667_100398586 3300005367 Bacteria 1252
29 Ga0070703_10001032 3300005406 Bacteria 8712
30 Ga0070709_10513181 3300005434 Bacteria 912
31 Ga0070713_100127292 3300005436 Unclassified 2242
32 Ga0070701_10210988 3300005438 Bacteria 1153
33 Ga0070711_100206967 3300005439 Unclassified 1517
34 Ga0070711_100412875 3300005439 Bacteria 1098
35 Ga0070705_100000057 3300005440 Bacteria 58275
36 Ga0070705_100020481 3300005440 Bacteria 3502
37 Ga0070700_100024128 3300005441 Bacteria 3567
38 Ga0070700_100229525 3300005441 Bacteria 1320
39 Ga0070700_100512875 3300005441 Bacteria 925
40 Ga0070700_101185888 3300005441 Bacteria 637
41 Ga0070694_100101889 3300005444 Bacteria 2032
42 Ga0070708_100010655 3300005445 Bacteria 7456
43 Ga0070708_100181252 3300005445 Bacteria 1969
44 Ga0070663_100006259 3300005455 Bacteria 7138
45 Ga0070663_100839884 3300005455 Bacteria 790
46 Ga0070662_100445574 3300005457 Bacteria 1074
47 Ga0070662_100758756 3300005457 Bacteria 823
48 Ga0070662_101264619 3300005457 Bacteria 635
49 Ga0070681_10001360 3300005458 Bacteria 21379
50 Ga0070681_10054060 3300005458 Bacteria 4001
51 Ga0068867_100409284 3300005459 Bacteria 1146
52 Ga0068867_100717525 3300005459 Bacteria 884
53 Ga0070707_100011550 3300005468 Bacteria 8236
54 Ga0070698_100172967 3300005471 Bacteria 2100
55 Ga0070699_100000158 3300005518 Bacteria 64029
56 Ga0070679_100053846 3300005530 Bacteria 4006
57 Ga0070697_100142163 3300005536 Bacteria 2019
58 Ga0068853_100003714 3300005539 Bacteria 11721
59 Ga0070672_100422353 3300005543 Bacteria 1145
60 Ga0070695_100000439 3300005545 Bacteria 21648
61 Ga0070695_100073683 3300005545 Bacteria 2242
62 Ga0070695_100352627 3300005545 Bacteria 1103
63 Ga0070696_100009530 3300005546 Bacteria 6500
64 Ga0070696_100012791 3300005546 Bacteria 5635
65 Ga0070696_100042585 3300005546 Bacteria 3138
66 Ga0070693_100003679 3300005547 Bacteria 7168
67 Ga0070693_100866716 3300005547 Bacteria 674
68 Ga0070665_100319489 3300005548 Bacteria 1557
69 Ga0070665_101437852 3300005548 Bacteria 698
70 Ga0070665_102140687 3300005548 Bacteria 564
71 Ga0070704_100000383 3300005549 Bacteria 20192
72 Ga0070704_100066322 3300005549 Bacteria 2602
73 Ga0070704_100833917 3300005549 Bacteria 826
74 Ga0068855_100272718 3300005563 Bacteria 1881
75 Ga0068855_101251822 3300005563 Bacteria 770
76 Ga0068857_100017152 3300005577 Bacteria 6343
77 Ga0068857_100063586 3300005577 Bacteria 3281
78 Ga0070702_100048377 3300005615 Bacteria 2420
79 Ga0070702_100061875 3300005615 Bacteria 2181
80 Ga0068852_100109599 3300005616 Bacteria 2508
81 Ga0068859_100004801 3300005617 Bacteria 13760
82 Ga0068864_100215544 3300005618 Bacteria 1770
83 Ga0068861_100135274 3300005719 Bacteria 2005
84 Ga0068861_100156077 3300005719 Bacteria 1878
85 Ga0068861_100197926 3300005719 Bacteria 1685
86 Ga0068861_101320587 3300005719 Bacteria 702
87 Ga0068851_10061132 3300005834 Bacteria 1930
88 Ga0068870_10167215 3300005840 Bacteria 1309
89 Ga0068858_100133314 3300005842 Bacteria 2330
90 Ga0068860_100035993 3300005843 Bacteria 4746
91 Ga0068860_100164644 3300005843 Bacteria 2140
92 Ga0068862_100001821 3300005844 Bacteria 19311
93 Ga0068862_101058162 3300005844 Bacteria 805
94 Ga0081455_10009824 3300005937 Bacteria 9800
95 Ga0081455_10482649 3300005937 Bacteria 837
96 Ga0081540_1000165 3300005983 Bacteria 68435
97 Ga0081540_1000873 3300005983 Bacteria 27254
98 Ga0075365_10014899 3300006038 Bacteria 4687
99 Ga0075365_10047112 3300006038 Bacteria 2833
100 Ga0075365_10091608 3300006038 Bacteria 2072
101 Ga0075365_10680443 3300006038 Unclassified 727
102 Ga0075368_10008257 3300006042 Bacteria 3701
103 Ga0075368_10019000 3300006042 Bacteria 2590
104 Ga0075363_100003941 3300006048 Bacteria 6409
105 Ga0075363_100016578 3300006048 Bacteria 3641
106 Ga0075363_100074091 3300006048 Bacteria 1853
107 Ga0075363_100124002 3300006048 Bacteria 1445
108 Ga0075363_100339105 3300006048 Bacteria 876
109 Ga0075364_10009087 3300006051 Bacteria 5952
110 Ga0070716_100623214 3300006173 Unclassified 814
111 Ga0075362_10169736 3300006177 Bacteria 1053
112 Ga0075367_10007360 3300006178 Bacteria 5629
113 Ga0075367_10129049 3300006178 Bacteria 1562
114 Ga0075369_10134750 3300006186 Bacteria 1124
115 Ga0075370_10719393 3300006353 Bacteria 607
116 Ga0075428_100003086 3300006844 Bacteria 18176
117 Ga0075428_100173041 3300006844 Bacteria 2340
118 Ga0075430_100046367 3300006846 Bacteria 3671
119 Ga0075431_100016100 3300006847 Bacteria 7586
120 Ga0075431_100026132 3300006847 Bacteria 5988
121 Ga0075433_10005783 3300006852 Bacteria 9734
122 Ga0075433_10727296 3300006852 Bacteria 869
123 Ga0075434_100055224 3300006871 Bacteria 3946
124 Ga0075434_100562246 3300006871 Bacteria 1160
125 Ga0068865_100127167 3300006881 Bacteria 1904
126 Ga0068865_100455148 3300006881 Bacteria 1059
127 Ga0097620_100004801 3300006931 Bacteria 13760
128 Ga0075435_100009318 3300007076 Bacteria 7100
129 Ga0099794_10177815 3300007265 Unclassified 1086
130 Ga0099794_10266434 3300007265 Bacteria 885
131 Ga0099795_10325785 3300007788 Bacteria 681
132 Ga0111539_10007284 3300009094 Bacteria 14165
133 Ga0111539_10095202 3300009094 Bacteria 3498
134 Ga0111539_10190885 3300009094 Bacteria 2390
135 Ga0111539_10219011 3300009094 Bacteria 2217
136 Ga0111539_12140740 3300009094 Bacteria 649
137 Ga0105247_10455656 3300009101 Bacteria 923
138 Ga0114129_10061159 3300009147 Bacteria 5264
139 Ga0114129_10369823 3300009147 Bacteria 1895
140 Ga0105243_10236470 3300009148 Bacteria 1623
141 Ga0105243_10260798 3300009148 Bacteria 1551
142 Ga0105241_10091409 3300009174 Bacteria 2401
143 Ga0105241_11272778 3300009174 Bacteria 699
144 Ga0105248_10083978 3300009177 Bacteria 3582
145 Ga0105237_10004832 3300009545 Bacteria 15478
146 Ga0105237_11059025 3300009545 Bacteria 818
147 Ga0105237_12089590 3300009545 Bacteria 575
148 Ga0105238_10608827 3300009551 Bacteria 1101
149 Ga0105249_10308927 3300009553 Bacteria 1589
150 Ga0105249_10369753 3300009553 Bacteria 1457
151 Ga0099796_10164801 3300010159 Bacteria 881
152 Ga0105239_10131194 3300010375 Bacteria 2787
153 Ga0105239_10510003 3300010375 Bacteria 1368
154 Ga0105239_10541082 3300010375 Bacteria 1326
155 Ga0105239_10733482 3300010375 Bacteria 1130
156 Ga0105246_10294155 3300011119 Unclassified 1308
157 Ga0105246_10322668 3300011119 Bacteria 1256
158 Ga0157378_11451519 3300013297 Bacteria 730
159 Ga0163162_10567298 3300013306 Bacteria 1262
160 Ga0157380_10342618 3300014326 Bacteria 1395
161 Ga0157377_10373783 3300014745 Bacteria 963
162 Ga0157379_10076461 3300014968 Bacteria 2998
163 Ga0157379_10370037 3300014968 Bacteria 1314
164 Ga0157379_10417927 3300014968 Bacteria 1235
165 Ga0157376_10116850 3300014969 Bacteria 2358
166 Ga0157376_11199974 3300014969 Bacteria 787
167 Ga0207656_10423866 3300025321 Bacteria 671
168 Ga0207653_10001713 3300025885 Bacteria 7010
169 Ga0207647_10004485 3300025904 Bacteria 10342
170 Ga0207645_10010078 3300025907 Bacteria 6506
171 Ga0207645_10127865 3300025907 Bacteria 1652
172 Ga0207705_10240566 3300025909 Bacteria 1379
173 Ga0207684_11163139 3300025910 Bacteria 640
174 Ga0207654_10344159 3300025911 Bacteria 1025
175 Ga0207707_10009970 3300025912 Bacteria 8238
176 Ga0207707_10018713 3300025912 Bacteria 6038
177 Ga0207695_10368296 3300025913 Bacteria 1323
178 Ga0207671_10048996 3300025914 Bacteria 3126
179 Ga0207663_10047945 3300025916 Bacteria 2641
180 Ga0207660_10002741 3300025917 Bacteria 11535
181 Ga0207660_10325505 3300025917 Bacteria 1228
182 Ga0207662_10468547 3300025918 Bacteria 864
183 Ga0207657_10051808 3300025919 Bacteria 3566
184 Ga0207649_10700715 3300025920 Bacteria 785
185 Ga0207652_10063744 3300025921 Bacteria 3188
186 Ga0207646_10053931 3300025922 Bacteria 3596
187 Ga0207694_10050597 3300025924 Bacteria 3219
188 Ga0207659_10629448 3300025926 Bacteria 916
189 Ga0207690_10006536 3300025932 Bacteria 6914
190 Ga0207690_10314264 3300025932 Bacteria 1229
191 Ga0207706_10033999 3300025933 Bacteria 4537
192 Ga0207706_10551380 3300025933 Bacteria 992
193 Ga0207686_10376526 3300025934 Bacteria 1075
194 Ga0207709_10318361 3300025935 Bacteria 1163
195 Ga0207670_11331945 3300025936 Bacteria 609
196 Ga0207669_10642724 3300025937 Bacteria 867
197 Ga0207669_10913578 3300025937 Bacteria 734
198 Ga0207704_10345240 3300025938 Bacteria 1157
199 Ga0207704_10421618 3300025938 Bacteria 1058
200 Ga0207665_10555041 3300025939 Unclassified 893
201 Ga0207711_10054032 3300025941 Bacteria 3445
202 Ga0207689_10144453 3300025942 Bacteria 1960
203 Ga0207667_10031461 3300025949 Bacteria 5728
204 Ga0207667_10863362 3300025949 Bacteria 899
205 Ga0207712_10040945 3300025961 Bacteria 3182
206 Ga0207668_10154905 3300025972 Bacteria 1779
207 Ga0207668_10356862 3300025972 Bacteria 1224
208 Ga0207640_11102589 3300025981 Bacteria 702
209 Ga0207658_10369961 3300025986 Bacteria 1253
210 Ga0207658_11002244 3300025986 Bacteria 762
211 Ga0207658_11313798 3300025986 Bacteria 661
212 Ga0207703_10116131 3300026035 Bacteria 2291
213 Ga0207678_10000049 3300026067 Bacteria 90312
214 Ga0207678_11023488 3300026067 Bacteria 731
215 Ga0207708_10100215 3300026075 Bacteria 2241
216 Ga0207708_11218246 3300026075 Bacteria 658
217 Ga0207648_10462900 3300026089 Unclassified 1156
218 Ga0207648_10653299 3300026089 Bacteria 972
219 Ga0207676_10114765 3300026095 Bacteria 2260
220 Ga0207674_10002164 3300026116 Bacteria 24857
221 Ga0207675_100018399 3300026118 Bacteria 6515
222 Ga0207675_100148176 3300026118 Bacteria 2233
223 Ga0207675_100173564 3300026118 Bacteria 2061
224 Ga0207698_10171092 3300026142 Bacteria 1913
225 Ga0209588_1099839 3300027671 Bacteria 934
226 Ga0209813_10004386 3300027866 Bacteria 3369
227 Ga0209813_10006413 3300027866 Bacteria 2905
228 Ga0207428_10193477 3300027907 Bacteria 1533
229 Ga0265354_1000582 3300028016 Bacteria 6172
230 Ga0265356_1000339 3300028017 Bacteria 8588
231 Ga0265355_1010605 3300028036 Bacteria 752
232 Ga0268266_11183106 3300028379 Bacteria 739
233 Ga0268265_10001771 3300028380 Bacteria 17321
234 Ga0268265_10137699 3300028380 Bacteria 2039
235 Ga0268265_10777811 3300028380 Bacteria 931
236 Ga0268264_10020410 3300028381 Bacteria 5416
237 Ga0268264_10145477 3300028381 Bacteria 2119
238 Ga0268264_10264660 3300028381 Bacteria 1604
239 Ga0265338_10182404 3300028800 Bacteria 1599
240 Ga0265765_1005906 3300030879 Unclassified 1293
241 Ga0265760_10001220 3300031090 Bacteria 7525
242 Ga0265760_10008637 3300031090 Bacteria 2911
243 Ga0265340_10056887 3300031247 Bacteria 1881
244 Ga0265340_10104127 3300031247 Bacteria 1317
245 Ga0265339_10136124 3300031249 Bacteria 1253
246 Ga0307513_10006480 3300031456 Bacteria 15285
247 Ga0307408_100188514 3300031548 Bacteria 1660
248 Ga0316579_10182410 3300031691 Bacteria 1015
249 Ga0316576_10014299 3300031727 Bacteria 5302
250 Ga0316578_10020177 3300031728 Bacteria 3679
251 Ga0307516_10000033 3300031730 Bacteria 155697
252 Ga0307405_10157201 3300031731 Bacteria 1606
253 Ga0307406_10091551 3300031901 Bacteria 2049
254 Ga0307406_10736809 3300031901 Bacteria 826
255 Ga0307415_100623095 3300032126 Bacteria 963
256 Ga0307510_10455513 3300033180 Bacteria 720
257 Ga0307510_10525719 3300033180 Bacteria 627
258 Ga0316214_1028342 3300033545 Unclassified 792
259 Ga0373929_0026734 3300035085 Bacteria 1208
260 Ga0373940_0003224 3300035088 Bacteria 3301
261 Ga0373949_0077570 3300035090 Bacteria 880
262 Ga0373939_0000782 3300035114 Bacteria 7839
263 Ga0373941_0342056 3300035115 Bacteria 606
264 Ga0373953_0023411 3300035117 Bacteria 2337
265 Ga0373954_0063711 3300035118 Bacteria 1742
266 Ga0373955_0009949 3300035172 Bacteria 4476
267 Ga0316574_0131058 3300035398 Bacteria 1613
268 Ga0316574_0386334 3300035398 Unclassified 883
269 Ga0373924_0152810 3300035410 Bacteria 1010
270 Ga0373931_0000272 3300035691 Bacteria 21907
271 Ga0373935_0220308 3300035692 Bacteria 1318
272 Ga0373933_0161144 3300035724 Bacteria 1424
273 Ga0373933_0818228 3300035724 Bacteria 613
274 Ga0373937_0346313 3300036401 Unclassified 1407
275 Ga0373937_0597626 3300036401 Bacteria 1047
276 Ga0316584_0006667 3300036712 Bacteria 7832
277 Ga0373925_0087452 3300037068 Unclassified 2379
278 Ga0395899_0038776 3300037312 Bacteria 3567
279 Ga0395900_0034029 3300037418 Bacteria 5245
280 Ga0395900_0803843 3300037418 Bacteria 868
281 Ga0395898_0025574 3300037466 Bacteria 5946
282 Ga0395898_0257832 3300037466 Bacteria 1663
283 Ga0395898_0462559 3300037466 Bacteria 1208
284 Ga0395901_0237900 3300038443 Bacteria 1900
285 Ga0400483_055574 3300039062 Bacteria 1780
286 Ga0436362_0145567 3300039453 Bacteria 1414
287 Ga0451576_0127783 3300045051 Bacteria 2648
288 Ga0495651_0189031 3300046462 Bacteria 1451
289 Ga0495664_0085585 3300046477 Bacteria 1893
290 Ga0495584_0567732 3300046491 Bacteria 578
291 Ga0495652_0202075 3300046529 Bacteria 1507
292 Ga0495587_0081590 3300046536 Bacteria 1874
293 Ga0495668_0242951 3300046616 Bacteria 986
294 Ga0495659_0159407 3300046664 Bacteria 910
295 Ga0495669_0536724 3300046684 Bacteria 569
296 Ga0495604_0357218 3300047317 Bacteria 970
297 Ga0495674_0819303 3300047319 Bacteria 723
298 Ga0495680_0477821 3300047322 Bacteria 849
299 Ga0495675_0341556 3300047444 Bacteria 882
300 Ga0495673_0063019 3300047469 Bacteria 1582
301 Ga0495686_0000131 3300047472 Bacteria 152064
302 Ga0496100_0132157 3300048903 Bacteria 1759
303 Ga0496101_0195191 3300048904 Bacteria 1564
304 Ga0496101_0609407 3300048904 Bacteria 863
305 Ga0496102_0002036 3300048905 Bacteria 17466
306 Ga0496102_0006561 3300048905 Bacteria 9937
307 Ga0496102_0075957 3300048905 Bacteria 3089
308 Ga0496102_0138838 3300048905 Bacteria 2278
309 Ga0496102_0874884 3300048905 Bacteria 820
310 Ga0496103_0071483 3300048906 Bacteria 2171
311 Ga0496103_0131528 3300048906 Bacteria 1598
312 Ga0496103_0278140 3300048906 Bacteria 1077
313 Ga0496104_0001121 3300048907 Bacteria 22928
314 Ga0496104_0009288 3300048907 Bacteria 8745
315 Ga0496104_0024498 3300048907 Bacteria 5551
316 Ga0496104_0735204 3300048907 Bacteria 894
317 Ga0496104_1549736 3300048907 Bacteria 565
318 Ga0496105_0319961 3300048908 Unclassified 1243
319 Ga0496105_0623254 3300048908 Bacteria 835
320 Ga0496106_0003493 3300048909 Bacteria 11707
321 Ga0496106_0015956 3300048909 Bacteria 5554
322 Ga0496106_0196508 3300048909 Bacteria 1605
323 Ga0496107_0020753 3300048910 Bacteria 4642
324 Ga0496107_0052193 3300048910 Bacteria 2949
325 Ga0496107_0759377 3300048910 Unclassified 711
326 Ga0496107_1065074 3300048910 Bacteria 585
327 Ga0496108_0041999 3300048911 Bacteria 3816
328 Ga0496108_0049676 3300048911 Bacteria 3508
329 Ga0496108_1626330 3300048911 Bacteria 534
330 Ga0496109_0021712 3300048912 Bacteria 5681
331 Ga0496109_0125585 3300048912 Bacteria 2392
332 Ga0496109_1343841 3300048912 Bacteria 650
333 Ga0496110_0054366 3300048913 Bacteria 3522
334 Ga0496110_1178727 3300048913 Bacteria 675
335 Ga0496111_0036443 3300048914 Bacteria 3517
336 Ga0496111_0084786 3300048914 Bacteria 2316
337 Ga0496111_0572773 3300048914 Bacteria 828
338 Ga0496112_0059563 3300048915 Bacteria 3763
339 Ga0496113_0486610 3300048916 Bacteria 991
340 Ga0496114_0301616 3300048917 Bacteria 1414
341 Ga0496114_0329131 3300048917 Unclassified 1350
342 Ga0496114_0361235 3300048917 Bacteria 1285
343 Ga0496115_0017042 3300048918 Bacteria 5542
344 Ga0496115_0018108 3300048918 Bacteria 5399
345 Ga0496115_0061098 3300048918 Bacteria 3037
346 Ga0496115_0329371 3300048918 Bacteria 1248
347 Ga0496117_0059439 3300048920 Bacteria 2640
348 Ga0496118_0013943 3300048921 Bacteria 7559
349 Ga0496119_0017491 3300048922 Bacteria 5389
350 Ga0501032_0147108 3300049569 Bacteria 1551
351 Ga0501032_0254758 3300049569 Bacteria 1139
352 Ga0501033_0160474 3300049570 Bacteria 1619
353 Ga0501033_0402335 3300049570 Bacteria 955
354 Ga0501034_0000014 3300049571 Bacteria 297798
355 Ga0501034_0020034 3300049571 Bacteria 6832
356 Ga0501036_0830240 3300049572 Bacteria 760
357 Ga0501036_0973351 3300049572 Bacteria 695
358 Ga0501037_0023819 3300049573 Bacteria 4527
359 Ga0501037_0059866 3300049573 Bacteria 2778
360 Ga0501037_0533210 3300049573 Bacteria 794
361 Ga0501037_0618566 3300049573 Unclassified 726
362 Ga0501038_0160948 3300049574 Bacteria 1824
363 Ga0501038_0701898 3300049574 Bacteria 758
364 Ga0501039_0000252 3300049575 Bacteria 38995
365 Ga0501039_0133245 3300049575 Bacteria 1950
366 Ga0501039_0588023 3300049575 Bacteria 873
367 Ga0501040_0155110 3300049576 Bacteria 1617
368 Ga0501040_0242187 3300049576 Bacteria 1286
369 Ga0501041_0039799 3300049577 Bacteria 2853
370 Ga0501041_0139359 3300049577 Bacteria 1512
371 Ga0501041_0402475 3300049577 Bacteria 867
372 Ga0501042_0443824 3300049578 Bacteria 941
373 Ga0501043_0089462 3300049579 Bacteria 2420
374 Ga0501043_0417177 3300049579 Bacteria 1012
375 Ga0501046_0016378 3300049580 Bacteria 6211
376 Ga0501047_0000222 3300049581 Bacteria 67957
377 Ga0501047_0097183 3300049581 Bacteria 2823
378 Ga0501047_0237495 3300049581 Bacteria 1674
379 Ga0501047_0307512 3300049581 Bacteria 1426
380 Ga0501048_0001086 3300049582 Bacteria 20394
381 Ga0501048_0343511 3300049582 Bacteria 1064
382 Ga0501048_0679581 3300049582 Unclassified 739
383 Ga0501048_0986477 3300049582 Bacteria 606
384 Ga0501067_0004360 3300049583 Bacteria 7794
385 Ga0501067_0015205 3300049583 Bacteria 4261
386 Ga0501067_0175698 3300049583 Bacteria 1193
387 Ga0501068_0791705 3300049584 Bacteria 622
388 Ga0501069_0496889 3300049585 Bacteria 728
389 Ga0501070_0039587 3300049586 Bacteria 3932
390 Ga0501070_0396179 3300049586 Bacteria 1117
391 Ga0501071_0035837 3300049587 Bacteria 3536
392 Ga0501071_0278970 3300049587 Bacteria 1265
393 Ga0501072_0113801 3300049588 Bacteria 2154
394 Ga0501072_0228292 3300049588 Bacteria 1483
395 Ga0501073_0036233 3300049589 Bacteria 3506
396 Ga0501073_0059780 3300049589 Bacteria 2661
397 Ga0501073_0326440 3300049589 Bacteria 1059
398 Ga0501074_0013397 3300049590 Bacteria 5961
399 Ga0501074_0458839 3300049590 Bacteria 903
400 Ga0501075_0362817 3300049591 Bacteria 1104
401 Ga0501075_0766701 3300049591 Bacteria 734
402 Ga0501076_0005392 3300049592 Bacteria 9192
403 Ga0501076_0215397 3300049592 Bacteria 1570
404 Ga0501076_0909014 3300049592 Bacteria 726
405 Ga0501077_0001336 3300049593 Bacteria 14904
406 Ga0501077_0034371 3300049593 Bacteria 3227
407 Ga0501077_0350553 3300049593 Bacteria 942
408 Ga0501077_0694919 3300049593 Bacteria 654
409 Ga0501077_0771623 3300049593 Bacteria 618
410 Ga0501079_0006446 3300049741 Bacteria 8814
411 Ga0501079_0126345 3300049741 Bacteria 1990
412 Ga0501080_0000907 3300049742 Bacteria 24268
413 Ga0501080_0322082 3300049742 Bacteria 1399
414 Ga0501081_0021006 3300049743 Bacteria 4357
415 Ga0501081_0044600 3300049743 Bacteria 3044
416 Ga0501081_0175462 3300049743 Bacteria 1549
417 Ga0501081_0193362 3300049743 Bacteria 1474
418 Ga0501081_0213504 3300049743 Bacteria 1402
419 Ga0501035_0000034 3300049822 Bacteria 174589
420 Ga0501044_0000039 3300049823 Bacteria 158218
421 Ga0501044_0001983 3300049823 Bacteria 23662
422 Ga0501044_0058601 3300049823 Bacteria 3949
423 Ga0501044_0388807 3300049823 Bacteria 1309
424 Ga0501045_0228731 3300049824 Bacteria 1384
425 nmdc:mga03683_10698_c1 3300050489 Bacteria 3296
426 nmdc:mga03683_346738_c1 3300050489 Bacteria 702
427 nmdc:mga03n38_23089_c1 3300050490 Bacteria 2526
428 nmdc:mga03n38_248897_c1 3300050490 Bacteria 938
429 nmdc:mga03n38_4837_c1 3300050490 Bacteria 4512
430 nmdc:mga03n38_4918_c2 3300050490 Bacteria 3731
431 nmdc:mga03n38_64554_c1 3300050490 Bacteria 1676
432 nmdc:mga03n38_76060_c1 3300050490 Bacteria 1565
433 nmdc:mga00v17_2197_c1 3300050491 Bacteria 10030
434 nmdc:mga00v17_274108_c1 3300050491 Bacteria 1095
435 nmdc:mga0yw44_1063425_c1 3300050492 Bacteria 547
436 nmdc:mga0yw44_46136_c1 3300050492 Bacteria 2615
437 nmdc:mga0yw44_5020_c1 3300050492 Bacteria 6183
438 nmdc:mga0k408_603207_c1 3300050493 Bacteria 647
439 nmdc:mga06z11_116676_c1 3300050494 Bacteria 1485
440 nmdc:mga06z11_29564_c1 3300050494 Bacteria 2641
441 nmdc:mga06z11_296824_c1 3300050494 Bacteria 960
442 nmdc:mga06z11_4683_c1 3300050494 Bacteria 5402
443 nmdc:mga06z11_70971_c1 3300050494 Bacteria 1843
444 nmdc:mga04h51_119614_c1 3300050495 Bacteria 980
445 nmdc:mga04h51_154307_c1 3300050495 Bacteria 880
446 nmdc:mga04h51_190156_c1 3300050495 Bacteria 803
447 nmdc:mga04h51_7147_c1 3300050495 Bacteria 2555
448 nmdc:mga07m45_295981_c1 3300050496 Bacteria 941
449 nmdc:mga07m45_634680_c1 3300050496 Bacteria 616
450 nmdc:mga05p37_312242_c1 3300050507 Bacteria 1863
451 nmdc:mga05p37_332773_c1 3300050507 Bacteria 1793
452 nmdc:mga05p37_555519_c1 3300050507 Bacteria 1306
453 nmdc:mga09592_110810_c1 3300050508 Bacteria 2355
454 nmdc:mga09592_729379_c1 3300050508 Bacteria 842
455 nmdc:mga0qj67_5071_c1 3300050509 Bacteria 9583
456 nmdc:mga0qj67_77784_c1 3300050509 Bacteria 2655
457 nmdc:mga06r32_117974_c1 3300050510 Bacteria 2616
458 nmdc:mga06r32_17231_c1 3300050510 Bacteria 6594
459 nmdc:mga06r32_209279_c1 3300050510 Bacteria 1938
460 nmdc:mga06r32_452343_c1 3300050510 Bacteria 1264
461 nmdc:mga06r32_61975_c1 3300050510 Bacteria 3602
462 nmdc:mga08y16_10691_c1 3300050511 Bacteria 9631
463 nmdc:mga08y16_1299626_c1 3300050511 Bacteria 694
464 nmdc:mga08y16_308291_c1 3300050511 Bacteria 1630
465 nmdc:mga08y16_730271_c1 3300050511 Bacteria 988
466 nmdc:mga08y16_882464_c1 3300050511 Bacteria 882
467 nmdc:mga0n895_1273_c1 3300050512 Bacteria 18618
468 nmdc:mga0n895_308240_c1 3300050512 Bacteria 1605
469 nmdc:mga0rr50_17097_c1 3300050513 Bacteria 4832
470 nmdc:mga0a205_54545_c1 3300050515 Bacteria 3860
471 Ga0495601_0433315 3300053077 Unclassified 851
472 Ga0495601_0584205 3300053077 Bacteria 717
473 Ga0495612_0030314 3300053078 Bacteria 2178
474 Ga0495612_0282110 3300053078 Unclassified 743
475 Ga0495595_0165305 3300053084 Bacteria 1093
476 Ga0495619_0029946 3300053085 Bacteria 3520
477 Ga0500651_0186440 3300053093 Bacteria 1230
478 Ga0500641_0074935 3300053096 Bacteria 1430
479 Ga0500650_0379082 3300053098 Bacteria 615
480 Ga0500555_056605 3300053103 Bacteria 1063
481 Ga0500642_0027873 3300053130 Bacteria 2324
482 Ga0500616_0266934 3300053153 Bacteria 724
483 Ga0501084_0004508 3300054114 Bacteria 11385
484 Ga0501084_0190944 3300054114 Bacteria 1728
485 Ga0501084_1350900 3300054114 Bacteria 597
486 Ga0501084_1374492 3300054114 Bacteria 592
487 Ga0501082_0003580 3300060353 Bacteria 13565
488 Ga0501082_0066797 3300060353 Bacteria 3097
489 Ga0501082_0076619 3300060353 Bacteria 2883
490 Ga0501082_0602029 3300060353 Bacteria 962
491 Ga0501082_0932897 3300060353 Bacteria 759
492 Ga0501082_1004652 3300060353 Bacteria 729
493 Ga0530510_0224243 3300061734 Bacteria 1397
494 Ga0530510_0317947 3300061734 Bacteria 1167
495 Ga0501036_0193363
496 LJNas_1011792
497 JGI25405J52794_10034275
498 Ga0058861_11445454
499 Ga0070658_10034310
500 Ga0070676_10003900
501 Ga0070676_10393138
502 Ga0070676_10524868
503 Ga0070676_10863177
504 Ga0068869_100043663
505 Ga0068869_100429567
506 Ga0068869_100571923
507 Ga0070680_100012963
508 Ga0070680_100042194
509 Ga0070682_100008980
510 Ga0070660_100039356
511 Ga0070687_100244839
512 Ga0070661_100462794
513 Ga0070692_10375646
514 Ga0070668_100223682
515 Ga0070668_100265860
516 Ga0070668_101236339
517 Ga0070675_100622145
518 Ga0070674_100883085
519 Ga0070688_100574285
520 Ga0070659_100042196
521 Ga0070659_100886943
522 Ga0070667_100398586
523 Ga0070703_10001032
524 Ga0070709_10513181
525 Ga0070713_100127292
526 Ga0070701_10210988
527 Ga0070711_100206967
528 Ga0070711_100412875
529 Ga0070705_100000057
530 Ga0070705_100020481
531 Ga0070700_100024128
532 Ga0070700_100229525
533 Ga0070700_100512875
534 Ga0070700_101185888
535 Ga0070694_100101889
536 Ga0070708_100010655
537 Ga0070708_100181252
538 Ga0070663_100006259
539 Ga0070663_100839884
540 Ga0070662_100445574
541 Ga0070662_100758756
542 Ga0070662_101264619
543 Ga0070681_10001360
544 Ga0070681_10054060
545 Ga0068867_100409284
546 Ga0068867_100717525
547 Ga0070707_100011550
548 Ga0070698_100172967
549 Ga0070699_100000158
550 Ga0070679_100053846
551 Ga0070697_100142163
552 Ga0068853_100003714
553 Ga0070672_100422353
554 Ga0070695_100000439
555 Ga0070695_100073683
556 Ga0070695_100352627
557 Ga0070696_100009530
558 Ga0070696_100012791
559 Ga0070696_100042585
560 Ga0070693_100003679
561 Ga0070693_100866716
562 Ga0070665_100319489
563 Ga0070665_101437852
564 Ga0070665_102140687
565 Ga0070704_100000383
566 Ga0070704_100066322
567 Ga0070704_100833917
568 Ga0068855_100272718
569 Ga0068855_101251822
570 Ga0068857_100017152
571 Ga0068857_100063586
572 Ga0070702_100048377
573 Ga0070702_100061875
574 Ga0068852_100109599
575 Ga0068859_100004801
576 Ga0068864_100215544
577 Ga0068861_100135274
578 Ga0068861_100156077
579 Ga0068861_100197926
580 Ga0068861_101320587
581 Ga0068851_10061132
582 Ga0068870_10167215
583 Ga0068858_100133314
584 Ga0068860_100035993
585 Ga0068860_100164644
586 Ga0068862_100001821
587 Ga0068862_101058162
588 Ga0081455_10009824
589 Ga0081455_10482649
590 Ga0081540_1000165
591 Ga0081540_1000873
592 Ga0075365_10014899
593 Ga0075365_10047112
594 Ga0075365_10091608
595 Ga0075365_10680443
596 Ga0075368_10008257
597 Ga0075368_10019000
598 Ga0075363_100003941
599 Ga0075363_100016578
600 Ga0075363_100074091
601 Ga0075363_100124002
602 Ga0075363_100339105
603 Ga0075364_10009087
604 Ga0070716_100623214
605 Ga0075362_10169736
606 Ga0075367_10007360
607 Ga0075367_10129049
608 Ga0075369_10134750
609 Ga0075370_10719393
610 Ga0075428_100003086
611 Ga0075428_100173041
612 Ga0075430_100046367
613 Ga0075431_100016100
614 Ga0075431_100026132
615 Ga0075433_10005783
616 Ga0075433_10727296
617 Ga0075434_100055224
618 Ga0075434_100562246
619 Ga0068865_100127167
620 Ga0068865_100455148
621 Ga0097620_100004801
622 Ga0075435_100009318
623 Ga0099794_10177815
624 Ga0099794_10266434
625 Ga0099795_10325785
626 Ga0111539_10007284
627 Ga0111539_10095202
628 Ga0111539_10190885
629 Ga0111539_10219011
630 Ga0111539_12140740
631 Ga0105247_10455656
632 Ga0114129_10061159
633 Ga0114129_10369823
634 Ga0105243_10236470
635 Ga0105243_10260798
636 Ga0105241_10091409
637 Ga0105241_11272778
638 Ga0105248_10083978
639 Ga0105237_10004832
640 Ga0105237_11059025
641 Ga0105237_12089590
642 Ga0105238_10608827
643 Ga0105249_10308927
644 Ga0105249_10369753
645 Ga0099796_10164801
646 Ga0105239_10131194
647 Ga0105239_10510003
648 Ga0105239_10541082
649 Ga0105239_10733482
650 Ga0105246_10294155
651 Ga0105246_10322668
652 Ga0157378_11451519
653 Ga0163162_10567298
654 Ga0157380_10342618
655 Ga0157377_10373783
656 Ga0157379_10076461
657 Ga0157379_10370037
658 Ga0157379_10417927
659 Ga0157376_10116850
660 Ga0157376_11199974
661 Ga0207656_10423866
662 Ga0207653_10001713
663 Ga0207647_10004485
664 Ga0207645_10010078
665 Ga0207645_10127865
666 Ga0207705_10240566
667 Ga0207684_11163139
668 Ga0207654_10344159
669 Ga0207707_10009970
670 Ga0207707_10018713
671 Ga0207695_10368296
672 Ga0207671_10048996
673 Ga0207663_10047945
674 Ga0207660_10002741
675 Ga0207660_10325505
676 Ga0207662_10468547
677 Ga0207657_10051808
678 Ga0207649_10700715
679 Ga0207652_10063744
680 Ga0207646_10053931
681 Ga0207694_10050597
682 Ga0207659_10629448
683 Ga0207690_10006536
684 Ga0207690_10314264
685 Ga0207706_10033999
686 Ga0207706_10551380
687 Ga0207686_10376526
688 Ga0207709_10318361
689 Ga0207670_11331945
690 Ga0207669_10642724
691 Ga0207669_10913578
692 Ga0207704_10345240
693 Ga0207704_10421618
694 Ga0207665_10555041
695 Ga0207711_10054032
696 Ga0207689_10144453
697 Ga0207667_10031461
698 Ga0207667_10863362
699 Ga0207712_10040945
700 Ga0207668_10154905
701 Ga0207668_10356862
702 Ga0207640_11102589
703 Ga0207658_10369961
704 Ga0207658_11002244
705 Ga0207658_11313798
706 Ga0207703_10116131
707 Ga0207678_10000049
708 Ga0207678_11023488
709 Ga0207708_10100215
710 Ga0207708_11218246
711 Ga0207648_10462900
712 Ga0207648_10653299
713 Ga0207676_10114765
714 Ga0207674_10002164
715 Ga0207675_100018399
716 Ga0207675_100148176
717 Ga0207675_100173564
718 Ga0207698_10171092
719 Ga0209588_1099839
720 Ga0209813_10004386
721 Ga0209813_10006413
722 Ga0207428_10193477
723 Ga0265354_1000582
724 Ga0265356_1000339
725 Ga0265355_1010605
726 Ga0268266_11183106
727 Ga0268265_10001771
728 Ga0268265_10137699
729 Ga0268265_10777811
730 Ga0268264_10020410
731 Ga0268264_10145477
732 Ga0268264_10264660
733 Ga0265338_10182404
734 Ga0265765_1005906
735 Ga0265760_10001220
736 Ga0265760_10008637
737 Ga0265340_10056887
738 Ga0265340_10104127
739 Ga0265339_10136124
740 Ga0307513_10006480
741 Ga0307408_100188514
742 Ga0316579_10182410
743 Ga0316576_10014299
744 Ga0316578_10020177
745 Ga0307516_10000033
746 Ga0307405_10157201
747 Ga0307406_10091551
748 Ga0307406_10736809
749 Ga0307415_100623095
750 Ga0307510_10455513
751 Ga0307510_10525719
752 Ga0316214_1028342
753 Ga0373929_0026734
754 Ga0373940_0003224
755 Ga0373949_0077570
756 Ga0373939_0000782
757 Ga0373941_0342056
758 Ga0373953_0023411
759 Ga0373954_0063711
760 Ga0373955_0009949
761 Ga0316574_0131058
762 Ga0316574_0386334
763 Ga0373924_0152810
764 Ga0373931_0000272
765 Ga0373935_0220308
766 Ga0373933_0161144
767 Ga0373933_0818228
768 Ga0373937_0346313
769 Ga0373937_0597626
770 Ga0316584_0006667
771 Ga0373925_0087452
772 Ga0395899_0038776
773 Ga0395900_0034029
774 Ga0395900_0803843
775 Ga0395898_0025574
776 Ga0395898_0257832
777 Ga0395898_0462559
778 Ga0395901_0237900
779 Ga0400483_055574
780 Ga0436362_0145567
781 Ga0451576_0127783
782 Ga0495651_0189031
783 Ga0495664_0085585
784 Ga0495584_0567732
785 Ga0495652_0202075
786 Ga0495587_0081590
787 Ga0495668_0242951
788 Ga0495659_0159407
789 Ga0495669_0536724
790 Ga0495604_0357218
791 Ga0495674_0819303
792 Ga0495680_0477821
793 Ga0495675_0341556
794 Ga0495673_0063019
795 Ga0495686_0000131
796 Ga0496100_0132157
797 Ga0496101_0195191
798 Ga0496101_0609407
799 Ga0496102_0002036
800 Ga0496102_0006561
801 Ga0496102_0075957
802 Ga0496102_0138838
803 Ga0496102_0874884
804 Ga0496103_0071483
805 Ga0496103_0131528
806 Ga0496103_0278140
807 Ga0496104_0001121
808 Ga0496104_0009288
809 Ga0496104_0024498
810 Ga0496104_0735204
811 Ga0496104_1549736
812 Ga0496105_0319961
813 Ga0496105_0623254
814 Ga0496106_0003493
815 Ga0496106_0015956
816 Ga0496106_0196508
817 Ga0496107_0020753
818 Ga0496107_0052193
819 Ga0496107_0759377
820 Ga0496107_1065074
821 Ga0496108_0041999
822 Ga0496108_0049676
823 Ga0496108_1626330
824 Ga0496109_0021712
825 Ga0496109_0125585
826 Ga0496109_1343841
827 Ga0496110_0054366
828 Ga0496110_1178727
829 Ga0496111_0036443
830 Ga0496111_0084786
831 Ga0496111_0572773
832 Ga0496112_0059563
833 Ga0496113_0486610
834 Ga0496114_0301616
835 Ga0496114_0329131
836 Ga0496114_0361235
837 Ga0496115_0017042
838 Ga0496115_0018108
839 Ga0496115_0061098
840 Ga0496115_0329371
841 Ga0496117_0059439
842 Ga0496118_0013943
843 Ga0496119_0017491
844 Ga0501032_0147108
845 Ga0501032_0254758
846 Ga0501033_0160474
847 Ga0501033_0402335
848 Ga0501034_0000014
849 Ga0501034_0020034
850 Ga0501036_0830240
851 Ga0501036_0973351
852 Ga0501037_0023819
853 Ga0501037_0059866
854 Ga0501037_0533210
855 Ga0501037_0618566
856 Ga0501038_0160948
857 Ga0501038_0701898
858 Ga0501039_0000252
859 Ga0501039_0133245
860 Ga0501039_0588023
861 Ga0501040_0155110
862 Ga0501040_0242187
863 Ga0501041_0039799
864 Ga0501041_0139359
865 Ga0501041_0402475
866 Ga0501042_0443824
867 Ga0501043_0089462
868 Ga0501043_0417177
869 Ga0501046_0016378
870 Ga0501047_0000222
871 Ga0501047_0097183
872 Ga0501047_0237495
873 Ga0501047_0307512
874 Ga0501048_0001086
875 Ga0501048_0343511
876 Ga0501048_0679581
877 Ga0501048_0986477
878 Ga0501067_0004360
879 Ga0501067_0015205
880 Ga0501067_0175698
881 Ga0501068_0791705
882 Ga0501069_0496889
883 Ga0501070_0039587
884 Ga0501070_0396179
885 Ga0501071_0035837
886 Ga0501071_0278970
887 Ga0501072_0113801
888 Ga0501072_0228292
889 Ga0501073_0036233
890 Ga0501073_0059780
891 Ga0501073_0326440
892 Ga0501074_0013397
893 Ga0501074_0458839
894 Ga0501075_0362817
895 Ga0501075_0766701
896 Ga0501076_0005392
897 Ga0501076_0215397
898 Ga0501076_0909014
899 Ga0501077_0001336
900 Ga0501077_0034371
901 Ga0501077_0350553
902 Ga0501077_0694919
903 Ga0501077_0771623
904 Ga0501079_0006446
905 Ga0501079_0126345
906 Ga0501080_0000907
907 Ga0501080_0322082
908 Ga0501081_0021006
909 Ga0501081_0044600
910 Ga0501081_0175462
911 Ga0501081_0193362
912 Ga0501081_0213504
913 Ga0501035_0000034
914 Ga0501044_0000039
915 Ga0501044_0001983
916 Ga0501044_0058601
917 Ga0501044_0388807
918 Ga0501045_0228731
919 nmdc:mga03683_10698_c1
920 nmdc:mga03683_346738_c1
921 nmdc:mga03n38_23089_c1
922 nmdc:mga03n38_248897_c1
923 nmdc:mga03n38_4837_c1
924 nmdc:mga03n38_4918_c2
925 nmdc:mga03n38_64554_c1
926 nmdc:mga03n38_76060_c1
927 nmdc:mga00v17_2197_c1
928 nmdc:mga00v17_274108_c1
929 nmdc:mga0yw44_1063425_c1
930 nmdc:mga0yw44_46136_c1
931 nmdc:mga0yw44_5020_c1
932 nmdc:mga0k408_603207_c1
933 nmdc:mga06z11_116676_c1
934 nmdc:mga06z11_29564_c1
935 nmdc:mga06z11_296824_c1
936 nmdc:mga06z11_4683_c1
937 nmdc:mga06z11_70971_c1
938 nmdc:mga04h51_119614_c1
939 nmdc:mga04h51_154307_c1
940 nmdc:mga04h51_190156_c1
941 nmdc:mga04h51_7147_c1
942 nmdc:mga07m45_295981_c1
943 nmdc:mga07m45_634680_c1
944 nmdc:mga05p37_312242_c1
945 nmdc:mga05p37_332773_c1
946 nmdc:mga05p37_555519_c1
947 nmdc:mga09592_110810_c1
948 nmdc:mga09592_729379_c1
949 nmdc:mga0qj67_5071_c1
950 nmdc:mga0qj67_77784_c1
951 nmdc:mga06r32_117974_c1
952 nmdc:mga06r32_17231_c1
953 nmdc:mga06r32_209279_c1
954 nmdc:mga06r32_452343_c1
955 nmdc:mga06r32_61975_c1
956 nmdc:mga08y16_10691_c1
957 nmdc:mga08y16_1299626_c1
958 nmdc:mga08y16_308291_c1
959 nmdc:mga08y16_730271_c1
960 nmdc:mga08y16_882464_c1
961 nmdc:mga0n895_1273_c1
962 nmdc:mga0n895_308240_c1
963 nmdc:mga0rr50_17097_c1
964 nmdc:mga0a205_54545_c1
965 Ga0495601_0433315
966 Ga0495601_0584205
967 Ga0495612_0030314
968 Ga0495612_0282110
969 Ga0495595_0165305
970 Ga0495619_0029946
971 Ga0500651_0186440
972 Ga0500641_0074935
973 Ga0500650_0379082
974 Ga0500555_056605
975 Ga0500642_0027873
976 Ga0500616_0266934
977 Ga0501084_0004508
978 Ga0501084_0190944
979 Ga0501084_1350900
980 Ga0501084_1374492
981 Ga0501082_0003580
982 Ga0501082_0066797
983 Ga0501082_0076619
984 Ga0501082_0602029
985 Ga0501082_0932897
986 Ga0501082_1004652
987 Ga0530510_0224243
988 Ga0530510_0317947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

21

175

0.9

PF00578

AhpC-TSA

AhpC/TSA family

22

157

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k1g-assembly1.cif.gz_A-2 crystal structure of reduced prx3 from vibrio vulnificus 0.9837 2 159
4f82-assembly1.cif.gz_B x-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia 0.9836 1 160
5k2j-assembly4.cif.gz_H crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9821 2 159
5k2j-assembly6.cif.gz_K crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9799 2 160
3uma-assembly3.cif.gz_C crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti 0.9797 1 160
ID Description Score Start End Superfamily
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9836 1 160 3.40.30.10
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9776 1 160 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9643 1 160 3.40.30.10
3umaA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9616 1 160 3.40.30.10
af_A0A1D6HW14_71_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9613 6 160 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A534EDJ2-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 1.002 1 160 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A4V1SR03-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 1.002 39 160 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A537RAC6-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9994 1 115 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A523MNG4-F1-model_v4 Peroxiredoxin 0.9977 74 160 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A1Q7TUM0-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9967 1 141 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454

Map