F454664

General Info

Members Datasets Scaffolds Average Seq Length
495 289 990 138

Family's Representative Sequence

Representative Sequence 3300003347|JGI26128J50194_1001660|JGI26128J50194_10016603
Length 138
Sequence MLIPKKVKHRKWHKLKSSGLQKATTKLSLSFGEFGLKSLTPAWVTSRQIEAARRTMSRYIKRGGKIWIRIFPDKPVTMKGLEVPMGGGKGGVDHYVAIVRPGTVVFEMDGVPTETAREAMRLAAYKMPFRSRFITKHD

Samples

Sample ID Description Type Environment
1 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
90 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
91 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
92 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
110 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
190 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
215 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
220 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
221 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
281 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
282 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
283 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.29
Metatranscriptomes 10.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 3.03
Rhizosphere 92.32
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26128J50194_1001660 3300003347 Bacteria 1423
2 Ga0006770J48903_1047381 3300003305 Bacteria 2446
3 Ga0058859_10004809 3300004798 Bacteria 1399
4 Ga0058861_12045449 3300004800 Bacteria 2949
5 Ga0058860_11529881 3300004801 Bacteria 4893
6 Ga0058862_10205658 3300004803 Bacteria 5496
7 Ga0058862_12054985 3300004803 Bacteria 866
8 Ga0070658_10291680 3300005327 Bacteria 1390
9 Ga0070683_100024593 3300005329 Bacteria 5397
10 Ga0070690_100151257 3300005330 Bacteria 1584
11 Ga0070670_100021920 3300005331 Bacteria 5496
12 Ga0068869_101132162 3300005334 Bacteria 686
13 Ga0068869_101152083 3300005334 Bacteria 680
14 Ga0070666_10019820 3300005335 Bacteria 4345
15 Ga0070666_10103096 3300005335 Bacteria 1968
16 Ga0070680_100099052 3300005336 Bacteria 2418
17 Ga0068868_100005429 3300005338 Bacteria 8956
18 Ga0068868_100142507 3300005338 Bacteria 1969
19 Ga0070691_10001800 3300005341 Bacteria 9328
20 Ga0070691_10074126 3300005341 Bacteria 1655
21 Ga0070687_100068192 3300005343 Bacteria 1901
22 Ga0070661_100299926 3300005344 Bacteria 1250
23 Ga0070692_10264392 3300005345 Bacteria 1035
24 Ga0070692_10264461 3300005345 Bacteria 1035
25 Ga0070668_100444488 3300005347 Bacteria 1113
26 Ga0070675_100082619 3300005354 Bacteria 2680
27 Ga0070675_100339193 3300005354 Bacteria 1331
28 Ga0070671_100008454 3300005355 Bacteria 8250
29 Ga0070674_101338659 3300005356 Bacteria 639
30 Ga0070673_101812905 3300005364 Bacteria 578
31 Ga0070688_100424508 3300005365 Bacteria 989
32 Ga0070667_100015540 3300005367 Bacteria 6292
33 Ga0070709_10108236 3300005434 Bacteria 1864
34 Ga0070714_100296499 3300005435 Bacteria 1506
35 Ga0070714_100312366 3300005435 Bacteria 1468
36 Ga0070714_100497353 3300005435 Bacteria 1162
37 Ga0070713_101217351 3300005436 Bacteria 729
38 Ga0070701_10023289 3300005438 Bacteria 2980
39 Ga0070701_10548882 3300005438 Bacteria 758
40 Ga0070701_11281097 3300005438 Bacteria 523
41 Ga0070705_100957829 3300005440 Bacteria 692
42 Ga0070705_101009420 3300005440 Bacteria 676
43 Ga0070700_100015000 3300005441 Bacteria 4383
44 Ga0070694_100229937 3300005444 Bacteria 1395
45 Ga0070694_100313390 3300005444 Bacteria 1205
46 Ga0070694_101392436 3300005444 Bacteria 592
47 Ga0070708_100000874 3300005445 Bacteria 22766
48 Ga0070708_100113402 3300005445 Bacteria 2493
49 Ga0070663_100275041 3300005455 Bacteria 1340
50 Ga0070663_101007105 3300005455 Bacteria 725
51 Ga0070678_100081927 3300005456 Bacteria 2448
52 Ga0070678_100198172 3300005456 Bacteria 1655
53 Ga0070681_11229030 3300005458 Unclassified 671
54 Ga0068867_100244009 3300005459 Bacteria 1458
55 Ga0070685_10027522 3300005466 Bacteria 3143
56 Ga0070706_100001548 3300005467 Bacteria 24042
57 Ga0070706_100258240 3300005467 Bacteria 1626
58 Ga0070706_100396146 3300005467 Unclassified 1285
59 Ga0070706_100461309 3300005467 Bacteria 1182
60 Ga0070707_100012600 3300005468 Bacteria 7898
61 Ga0070707_100121056 3300005468 Bacteria 2541
62 Ga0070707_101006676 3300005468 Bacteria 799
63 Ga0070707_101472456 3300005468 Bacteria 647
64 Ga0070707_101584610 3300005468 Bacteria 622
65 Ga0070698_100013686 3300005471 Bacteria 8589
66 Ga0070698_100044815 3300005471 Bacteria 4527
67 Ga0070698_100843917 3300005471 Bacteria 861
68 Ga0070698_101469274 3300005471 Bacteria 633
69 Ga0070699_100007392 3300005518 Bacteria 9566
70 Ga0070699_100077781 3300005518 Unclassified 2888
71 Ga0070679_100035338 3300005530 Bacteria 4957
72 Ga0070679_100127909 3300005530 Bacteria 2522
73 Ga0070684_100064251 3300005535 Bacteria 3219
74 Ga0070684_100284339 3300005535 Bacteria 1516
75 Ga0070684_100751919 3300005535 Bacteria 910
76 Ga0070697_100008107 3300005536 Bacteria 8195
77 Ga0070697_100039169 3300005536 Bacteria 3832
78 Ga0070672_100610095 3300005543 Bacteria 951
79 Ga0070686_100078786 3300005544 Bacteria 2176
80 Ga0070686_100310412 3300005544 Bacteria 1173
81 Ga0070686_101292617 3300005544 Bacteria 609
82 Ga0070695_100024583 3300005545 Bacteria 3713
83 Ga0070695_100504712 3300005545 Bacteria 936
84 Ga0070696_101475304 3300005546 Bacteria 582
85 Ga0070665_100153752 3300005548 Bacteria 2303
86 Ga0070704_100030326 3300005549 Unclassified 3622
87 Ga0070704_100173962 3300005549 Bacteria 1715
88 Ga0070704_100213881 3300005549 Bacteria 1563
89 Ga0070704_100228861 3300005549 Bacteria 1515
90 Ga0070704_100753314 3300005549 Unclassified 867
91 Ga0068855_100517328 3300005563 Bacteria 1295
92 Ga0068855_100640954 3300005563 Bacteria 1142
93 Ga0068855_101148221 3300005563 Bacteria 810
94 Ga0070664_100350131 3300005564 Bacteria 1343
95 Ga0068857_100006631 3300005577 Bacteria 9944
96 Ga0068857_101911730 3300005577 Unclassified 581
97 Ga0068856_101122021 3300005614 Bacteria 803
98 Ga0068852_100744856 3300005616 Bacteria 992
99 Ga0068859_100012907 3300005617 Bacteria 8391
100 Ga0068859_100115965 3300005617 Bacteria 2743
101 Ga0068864_100022600 3300005618 Bacteria 5274
102 Ga0068861_100041069 3300005719 Bacteria 3463
103 Ga0068861_101088139 3300005719 Bacteria 768
104 Ga0068870_10276391 3300005840 Bacteria 1051
105 Ga0068863_100026833 3300005841 Bacteria 5493
106 Ga0068863_100065194 3300005841 Bacteria 3446
107 Ga0068863_100158067 3300005841 Bacteria 2171
108 Ga0068858_100006142 3300005842 Bacteria 11717
109 Ga0068858_100047449 3300005842 Bacteria 3981
110 Ga0068858_100133258 3300005842 Bacteria 2331
111 Ga0068860_100030150 3300005843 Bacteria 5216
112 Ga0068860_100248305 3300005843 Bacteria 1732
113 Ga0068862_100019095 3300005844 Bacteria 5715
114 Ga0070717_10007950 3300006028 Bacteria 7898
115 Ga0070717_10008401 3300006028 Bacteria 7711
116 Ga0070717_10124937 3300006028 Bacteria 2208
117 Ga0070717_11037456 3300006028 Bacteria 747
118 Ga0075363_100988228 3300006048 Bacteria 518
119 Ga0075432_10071696 3300006058 Bacteria 1246
120 Ga0070715_10095950 3300006163 Bacteria 1374
121 Ga0070716_100341871 3300006173 Bacteria 1056
122 Ga0070716_101235599 3300006173 Bacteria 601
123 Ga0097621_100213717 3300006237 Bacteria 1678
124 Ga0097621_100751959 3300006237 Bacteria 900
125 Ga0068871_100945107 3300006358 Bacteria 801
126 Ga0075428_100417470 3300006844 Bacteria 1438
127 Ga0075428_102674639 3300006844 Bacteria 509
128 Ga0075431_101303920 3300006847 Bacteria 687
129 Ga0075433_10003136 3300006852 Bacteria 12736
130 Ga0075433_10038728 3300006852 Bacteria 4119
131 Ga0075433_10412685 3300006852 Bacteria 1191
132 Ga0075434_100001824 3300006871 Bacteria 18394
133 Ga0075434_100251409 3300006871 Bacteria 1787
134 Ga0075434_102348951 3300006871 Bacteria 536
135 Ga0075436_100063163 3300006914 Bacteria 2560
136 Ga0097620_100012907 3300006931 Bacteria 8391
137 Ga0097620_100115963 3300006931 Bacteria 2743
138 Ga0075435_100511865 3300007076 Bacteria 1038
139 Ga0075435_100955123 3300007076 Bacteria 748
140 Ga0099794_10128342 3300007265 Bacteria 1279
141 Ga0105251_10180668 3300009011 Bacteria 950
142 Ga0111539_10170443 3300009094 Bacteria 2543
143 Ga0111539_10885486 3300009094 Bacteria 1038
144 Ga0105245_10002979 3300009098 Bacteria 15190
145 Ga0105245_10196612 3300009098 Bacteria 1935
146 Ga0105247_10008115 3300009101 Bacteria 6415
147 Ga0114129_10281686 3300009147 Bacteria 2221
148 Ga0114129_10349037 3300009147 Bacteria 1961
149 Ga0114129_10737293 3300009147 Bacteria 1262
150 Ga0114129_10958639 3300009147 Bacteria 1080
151 Ga0105243_10110372 3300009148 Bacteria 2300
152 Ga0105243_10155490 3300009148 Bacteria 1966
153 Ga0105243_10539183 3300009148 Bacteria 1113
154 Ga0105243_11825785 3300009148 Bacteria 639
155 Ga0105242_10408060 3300009176 Bacteria 1270
156 Ga0105248_10011163 3300009177 Bacteria 9910
157 Ga0105238_10162346 3300009551 Bacteria 2210
158 Ga0105238_11213324 3300009551 Bacteria 779
159 Ga0130087_1081296 3300009828 Bacteria 997
160 Ga0130086_1092952 3300009829 Bacteria 997
161 Ga0130084_1046490 3300009835 Bacteria 997
162 Ga0130085_1007653 3300009850 Bacteria 997
163 Ga0105239_10348824 3300010375 Bacteria 1671
164 Ga0105246_10002426 3300011119 Bacteria 11243
165 Ga0105246_10211624 3300011119 Bacteria 1514
166 Ga0157369_10324820 3300013105 Bacteria 1599
167 Ga0157369_11556510 3300013105 Bacteria 672
168 Ga0157374_10064541 3300013296 Bacteria 3436
169 Ga0157374_10273310 3300013296 Bacteria 1667
170 Ga0157378_10536401 3300013297 Bacteria 1174
171 Ga0163162_10013077 3300013306 Bacteria 8103
172 Ga0157372_10432521 3300013307 Unclassified 1534
173 Ga0157372_10702327 3300013307 Bacteria 1177
174 Ga0157372_12988836 3300013307 Bacteria 541
175 Ga0157375_10002567 3300013308 Bacteria 15778
176 Ga0157375_10330035 3300013308 Bacteria 1690
177 Ga0157375_11023668 3300013308 Bacteria 965
178 Ga0163163_10007782 3300014325 Bacteria 9471
179 Ga0157380_10016532 3300014326 Bacteria 5442
180 Ga0157379_10011980 3300014968 Bacteria 7576
181 Ga0157376_10035934 3300014969 Bacteria 4010
182 Ga0163161_10128102 3300017792 Bacteria 1913
183 Ga0197907_10745673 3300020069 Bacteria 7235
184 Ga0197907_10877974 3300020069 Bacteria 6483
185 Ga0206356_10428095 3300020070 Bacteria 1547
186 Ga0206356_10714059 3300020070 Bacteria 898
187 Ga0206356_11304877 3300020070 Bacteria 1117
188 Ga0206356_11819515 3300020070 Bacteria 3331
189 Ga0206356_11883346 3300020070 Bacteria 18415
190 Ga0206349_1115449 3300020075 Bacteria 9518
191 Ga0206349_1801976 3300020075 Bacteria 1143
192 Ga0206355_1170795 3300020076 Bacteria 555
193 Ga0206355_1280405 3300020076 Bacteria 595
194 Ga0206351_10190749 3300020077 Bacteria 2676
195 Ga0206351_10317479 3300020077 Bacteria 5434
196 Ga0206351_10639866 3300020077 Bacteria 3626
197 Ga0206352_10193538 3300020078 Bacteria 21551
198 Ga0206352_10481195 3300020078 Bacteria 3039
199 Ga0206352_11228573 3300020078 Bacteria 1092
200 Ga0206352_11251130 3300020078 Unclassified 1075
201 Ga0206350_10234328 3300020080 Bacteria 18042
202 Ga0206350_10242664 3300020080 Bacteria 1945
203 Ga0206350_10325577 3300020080 Bacteria 21530
204 Ga0206350_10691352 3300020080 Bacteria 1423
205 Ga0206350_10928407 3300020080 Bacteria 960
206 Ga0206350_11530023 3300020080 Bacteria 3967
207 Ga0206354_10421436 3300020081 Bacteria 3704
208 Ga0206353_11499008 3300020082 Bacteria 4127
209 Ga0213874_10002780 3300021377 Bacteria 3808
210 Ga0213876_10098333 3300021384 Unclassified 1551
211 Ga0213875_10303365 3300021388 Bacteria 756
212 Ga0224712_10000319 3300022467 Bacteria 9030
213 Ga0224712_10000482 3300022467 Bacteria 7993
214 Ga0224712_10000817 3300022467 Bacteria 6591
215 Ga0224712_10159097 3300022467 Bacteria 1006
216 Ga0224712_10461405 3300022467 Bacteria 611
217 Ga0207653_10006632 3300025885 Bacteria 3613
218 Ga0207642_10311815 3300025899 Bacteria 916
219 Ga0207688_10110081 3300025901 Bacteria 1598
220 Ga0207680_10156401 3300025903 Bacteria 1524
221 Ga0207680_10191041 3300025903 Bacteria 1390
222 Ga0207647_10039593 3300025904 Bacteria 2972
223 Ga0207685_10092131 3300025905 Bacteria 1278
224 Ga0207699_10620682 3300025906 Unclassified 788
225 Ga0207645_10238744 3300025907 Bacteria 1201
226 Ga0207643_10374428 3300025908 Bacteria 897
227 Ga0207684_10001602 3300025910 Bacteria 24043
228 Ga0207684_10009986 3300025910 Bacteria 8370
229 Ga0207684_10015824 3300025910 Bacteria 6486
230 Ga0207684_10681369 3300025910 Bacteria 875
231 Ga0207707_10927208 3300025912 Unclassified 719
232 Ga0207693_10250796 3300025915 Bacteria 1389
233 Ga0207663_11001187 3300025916 Bacteria 670
234 Ga0207660_10236434 3300025917 Bacteria 1438
235 Ga0207649_10109527 3300025920 Bacteria 1843
236 Ga0207652_10032320 3300025921 Bacteria 4398
237 Ga0207652_10248801 3300025921 Bacteria 1603
238 Ga0207652_10416516 3300025921 Bacteria 1212
239 Ga0207646_10000708 3300025922 Bacteria 43282
240 Ga0207646_10005612 3300025922 Bacteria 13177
241 Ga0207646_11443225 3300025922 Bacteria 597
242 Ga0207694_10430980 3300025924 Bacteria 1099
243 Ga0207650_10020266 3300025925 Bacteria 4688
244 Ga0207650_10565044 3300025925 Bacteria 954
245 Ga0207659_10066584 3300025926 Bacteria 2615
246 Ga0207687_10057696 3300025927 Bacteria 2728
247 Ga0207687_10065150 3300025927 Bacteria 2587
248 Ga0207687_11801996 3300025927 Bacteria 524
249 Ga0207700_10913592 3300025928 Bacteria 786
250 Ga0207664_10234452 3300025929 Bacteria 1596
251 Ga0207664_11423070 3300025929 Bacteria 614
252 Ga0207644_10114383 3300025931 Bacteria 2045
253 Ga0207644_10998205 3300025931 Bacteria 702
254 Ga0207686_10298110 3300025934 Bacteria 1196
255 Ga0207709_10119923 3300025935 Bacteria 1774
256 Ga0207709_10708593 3300025935 Bacteria 806
257 Ga0207709_10797618 3300025935 Bacteria 762
258 Ga0207670_10154813 3300025936 Bacteria 1705
259 Ga0207670_10275281 3300025936 Bacteria 1310
260 Ga0207670_10716662 3300025936 Bacteria 829
261 Ga0207669_10506201 3300025937 Bacteria 967
262 Ga0207704_10735083 3300025938 Bacteria 820
263 Ga0207665_10164414 3300025939 Bacteria 1599
264 Ga0207691_10120453 3300025940 Bacteria 2326
265 Ga0207691_10315142 3300025940 Bacteria 1342
266 Ga0207711_10004853 3300025941 Bacteria 11432
267 Ga0207661_10095905 3300025944 Bacteria 2481
268 Ga0207679_10253337 3300025945 Bacteria 1498
269 Ga0207679_10326957 3300025945 Bacteria 1329
270 Ga0207667_10552933 3300025949 Bacteria 1164
271 Ga0207667_10885607 3300025949 Bacteria 885
272 Ga0207712_10133642 3300025961 Bacteria 1894
273 Ga0207712_10744596 3300025961 Bacteria 858
274 Ga0207668_10090451 3300025972 Bacteria 2247
275 Ga0207640_11561211 3300025981 Bacteria 594
276 Ga0207658_10040394 3300025986 Bacteria 3372
277 Ga0207677_10407797 3300026023 Bacteria 1154
278 Ga0207703_10021325 3300026035 Bacteria 5073
279 Ga0207703_10026000 3300026035 Bacteria 4607
280 Ga0207639_10963133 3300026041 Bacteria 799
281 Ga0207678_10399019 3300026067 Bacteria 1191
282 Ga0207678_10694368 3300026067 Bacteria 895
283 Ga0207708_10015186 3300026075 Bacteria 5772
284 Ga0207708_10364317 3300026075 Bacteria 1189
285 Ga0207702_11625909 3300026078 Bacteria 639
286 Ga0207641_10005619 3300026088 Bacteria 10682
287 Ga0207641_10734376 3300026088 Bacteria 974
288 Ga0207648_10055268 3300026089 Bacteria 3466
289 Ga0207648_11427627 3300026089 Bacteria 651
290 Ga0207676_10003106 3300026095 Bacteria 11850
291 Ga0207674_10011465 3300026116 Bacteria 9959
292 Ga0207674_11283247 3300026116 Bacteria 702
293 Ga0207675_100012427 3300026118 Bacteria 7956
294 Ga0207675_100495212 3300026118 Bacteria 1216
295 Ga0207683_10222016 3300026121 Bacteria 1722
296 Ga0207698_10026842 3300026142 Bacteria 4079
297 Ga0209966_1000144 3300027695 Bacteria 30303
298 Ga0209966_1060914 3300027695 Bacteria 815
299 Ga0209998_10017366 3300027717 Bacteria 1520
300 Ga0209974_10134498 3300027876 Bacteria 883
301 Ga0207428_10417557 3300027907 Bacteria 981
302 Ga0268266_10128636 3300028379 Bacteria 2263
303 Ga0268265_10068794 3300028380 Bacteria 2747
304 Ga0268264_10047743 3300028381 Bacteria 3560
305 Ga0268264_10223378 3300028381 Bacteria 1735
306 Ga0268264_12628548 3300028381 Bacteria 508
307 Ga0265323_10001746 3300028653 Bacteria 10314
308 Ga0265322_10006215 3300028654 Unclassified 3512
309 Ga0265338_10000066 3300028800 Bacteria 188576
310 Ga0265338_10006640 3300028800 Bacteria 14651
311 Ga0265338_10105522 3300028800 Bacteria 2283
312 Ga0265338_10280682 3300028800 Bacteria 1217
313 Ga0265324_10005363 3300029957 Bacteria 5553
314 Ga0265324_10157622 3300029957 Bacteria 771
315 Ga0265330_10001813 3300031235 Bacteria 11981
316 Ga0265330_10109961 3300031235 Unclassified 1178
317 Ga0265332_10003909 3300031238 Bacteria 7106
318 Ga0265320_10014760 3300031240 Bacteria 4433
319 Ga0265325_10014664 3300031241 Bacteria 4422
320 Ga0265325_10221813 3300031241 Unclassified 865
321 Ga0265340_10028017 3300031247 Bacteria 2836
322 Ga0265339_10069350 3300031249 Bacteria 1882
323 Ga0265316_10060043 3300031344 Bacteria 2956
324 Ga0265316_10232543 3300031344 Bacteria 1357
325 Ga0316575_10051113 3300031665 Bacteria 1646
326 Ga0316579_10025655 3300031691 Bacteria 2663
327 Ga0316576_10034427 3300031727 Bacteria 3610
328 Ga0316576_10585840 3300031727 Bacteria 815
329 Ga0307405_10303640 3300031731 Bacteria 1212
330 Ga0316577_10002971 3300031733 Bacteria 8490
331 Ga0316577_10011751 3300031733 Bacteria 4750
332 Ga0316577_10022947 3300031733 Bacteria 3465
333 Ga0316577_10027167 3300031733 Bacteria 3191
334 Ga0307406_10125971 3300031901 Bacteria 1790
335 Ga0307416_100120431 3300032002 Bacteria 2337
336 Ga0307416_101492843 3300032002 Bacteria 782
337 Ga0307416_101925559 3300032002 Bacteria 694
338 Ga0307415_100057134 3300032126 Bacteria 2680
339 Ga0316593_10001038 3300032168 Bacteria 5773
340 Ga0316593_10040395 3300032168 Bacteria 1550
341 Ga0316593_10120304 3300032168 Bacteria 943
342 Ga0316593_10179544 3300032168 Bacteria 778
343 Ga0316592_1000011 3300033524 Bacteria 13521
344 Ga0316587_1000243 3300033529 Bacteria 4897
345 Ga0316596_1000864 3300033541 Bacteria 5686
346 Ga0316596_1039156 3300033541 Bacteria 1243
347 Ga0373949_0032430 3300035090 Bacteria 1251
348 Ga0373954_0003959 3300035118 Bacteria 6336
349 Ga0373956_0000071 3300035119 Bacteria 33353
350 Ga0373943_0773748 3300035170 Bacteria 571
351 Ga0373946_0092226 3300035171 Bacteria 1344
352 Ga0373955_0478557 3300035172 Bacteria 760
353 Ga0373927_0000098 3300035695 Bacteria 65705
354 Ga0373933_0202020 3300035724 Bacteria 1272
355 Ga0373937_1792279 3300036401 Bacteria 560
356 Ga0316582_0001185 3300036647 Bacteria 11174
357 Ga0316582_0014880 3300036647 Bacteria 4431
358 Ga0316582_0158653 3300036647 Bacteria 1531
359 Ga0316582_0237856 3300036647 Bacteria 1247
360 Ga0316582_1265406 3300036647 Bacteria 502
361 Ga0316584_0018626 3300036712 Bacteria 5011
362 Ga0316584_0158681 3300036712 Bacteria 1681
363 Ga0316584_0187273 3300036712 Unclassified 1531
364 Ga0316584_0213764 3300036712 Bacteria 1418
365 Ga0316584_0336501 3300036712 Bacteria 1086
366 Ga0316584_0345105 3300036712 Bacteria 1070
367 Ga0436364_0593199 3300037853 Unclassified 1361
368 Ga0436364_1010524 3300037853 Bacteria 918
369 Ga0436364_1340585 3300037853 Bacteria 943
370 Ga0395901_0840682 3300038443 Bacteria 904
371 Ga0400490_36008 3300038726 Bacteria 1015
372 Ga0400489_86969 3300039093 Bacteria 10581
373 Ga0436365_0043253 3300039437 Unclassified 1132
374 Ga0436365_0312958 3300039437 Bacteria 697
375 Ga0436365_0728443 3300039437 Bacteria 740
376 Ga0436363_0098679 3300039450 Bacteria 662
377 Ga0436363_0788412 3300039450 Bacteria 10830
378 Ga0436362_0967168 3300039453 Bacteria 567
379 Ga0451797_0793319 3300041453 Bacteria 573
380 Ga0450894_021901 3300042131 Bacteria 865
381 Ga0439464_0267854 3300042439 Bacteria 554
382 Ga0451577_0004031 3300042876 Bacteria 15798
383 Ga0466972_0002629 3300044658 Bacteria 8898
384 Ga0466972_0017726 3300044658 Unclassified 3563
385 Ga0466972_0102824 3300044658 Bacteria 1351
386 Ga0453683_0302995 3300044673 Unclassified 1022
387 Ga0453683_0549292 3300044673 Bacteria 751
388 Ga0466965_0013757 3300044683 Bacteria 3822
389 Ga0466965_0015475 3300044683 Bacteria 3624
390 Ga0466965_0225385 3300044683 Bacteria 1000
391 Ga0466966_0006034 3300044684 Bacteria 8000
392 Ga0466966_0310717 3300044684 Unclassified 947
393 Ga0466966_0376785 3300044684 Bacteria 852
394 Ga0466961_0011434 3300044693 Bacteria 5676
395 Ga0466961_0011530 3300044693 Bacteria 5652
396 Ga0466961_0094335 3300044693 Bacteria 1888
397 Ga0466961_0497879 3300044693 Bacteria 736
398 Ga0466963_0082364 3300044694 Bacteria 2181
399 Ga0466963_0255557 3300044694 Bacteria 1230
400 Ga0466964_0000286 3300044706 Bacteria 14798
401 Ga0453684_0035849 3300044712 Unclassified 6847
402 Ga0453684_0523205 3300044712 Unclassified 1310
403 Ga0453684_0600770 3300044712 Bacteria 1206
404 Ga0453684_0738589 3300044712 Unclassified 1066
405 Ga0453684_1077645 3300044712 Bacteria 850
406 Ga0453684_1197166 3300044712 Bacteria 798
407 Ga0466971_0229855 3300044719 Bacteria 880
408 Ga0466968_0000631 3300044735 Bacteria 12053
409 Ga0466968_0002163 3300044735 Bacteria 7173
410 Ga0466970_0000735 3300044765 Bacteria 15951
411 Ga0466970_0102314 3300044765 Bacteria 1560
412 Ga0466970_0641775 3300044765 Unclassified 617
413 Ga0466957_0011212 3300044842 Bacteria 5162
414 Ga0466960_0002207 3300044901 Bacteria 7269
415 Ga0466959_0001979 3300045049 Bacteria 12901
416 Ga0466959_0064314 3300045049 Bacteria 2663
417 Ga0466959_0232191 3300045049 Bacteria 1276
418 Ga0466959_0479620 3300045049 Unclassified 842
419 Ga0451576_0000048 3300045051 Unclassified 325145
420 Ga0451576_0000789 3300045051 Bacteria 62266
421 Ga0451576_0003567 3300045051 Bacteria 21187
422 Ga0451576_0034776 3300045051 Bacteria 5351
423 Ga0451576_0233331 3300045051 Bacteria 1922
424 Ga0451576_0701418 3300045051 Bacteria 1063
425 Ga0466958_0022910 3300045836 Bacteria 3661
426 Ga0466967_0835807 3300045976 Unclassified 915
427 Ga0466967_2094396 3300045976 Bacteria 562
428 Ga0495580_0611356 3300046472 Bacteria 720
429 Ga0495649_0554328 3300046694 Bacteria 569
430 Ga0496104_0007967 3300048907 Bacteria 9396
431 Ga0496106_0937952 3300048909 Bacteria 682
432 Ga0496107_0540836 3300048910 Bacteria 863
433 Ga0496108_0000307 3300048911 Bacteria 42018
434 Ga0496108_0569572 3300048911 Bacteria 987
435 Ga0496109_0017303 3300048912 Bacteria 6315
436 Ga0496110_1085415 3300048913 Bacteria 708
437 Ga0496111_0265653 3300048914 Bacteria 1273
438 Ga0496111_0271111 3300048914 Bacteria 1259
439 Ga0496111_0858945 3300048914 Bacteria 655
440 Ga0496112_0024825 3300048915 Bacteria 5749
441 Ga0496113_0130099 3300048916 Bacteria 1974
442 Ga0496114_0011260 3300048917 Bacteria 7141
443 Ga0496115_0264195 3300048918 Bacteria 1415
444 Ga0501309_063358 3300049129 Bacteria 598
445 Ga0501036_0193083 3300049572 Bacteria 1713
446 Ga0501036_0225554 3300049572 Bacteria 1573
447 Ga0501040_0560392 3300049576 Bacteria 825
448 Ga0501040_0832684 3300049576 Bacteria 668
449 Ga0501041_0352160 3300049577 Bacteria 931
450 Ga0501042_1227390 3300049578 Bacteria 547
451 Ga0501071_0041174 3300049587 Bacteria 3308
452 Ga0501072_0080268 3300049588 Bacteria 2584
453 Ga0501073_0896627 3300049589 Bacteria 611
454 Ga0501075_0287652 3300049591 Bacteria 1252
455 Ga0501076_0250997 3300049592 Bacteria 1448
456 Ga0501209_157040 3300049656 Bacteria 687
457 Ga0501080_0460165 3300049742 Bacteria 1140
458 Ga0501081_0656807 3300049743 Bacteria 786
459 Ga0501035_0540843 3300049822 Bacteria 955
460 Ga0501035_0822550 3300049822 Bacteria 741
461 Ga0501044_0894343 3300049823 Bacteria 763
462 Ga0501044_1585519 3300049823 Bacteria 520
463 Ga0501045_0945190 3300049824 Bacteria 633
464 nmdc:mga03n38_449389_c1 3300050490 Archaea 717
465 nmdc:mga05p37_787673_c1 3300050507 Bacteria 1042
466 nmdc:mga09592_1236543_c1 3300050508 Bacteria 616
467 nmdc:mga06r32_503766_c1 3300050510 Bacteria 1187
468 nmdc:mga08y16_210547_c1 3300050511 Bacteria 2013
469 nmdc:mga0n895_147358_c1 3300050512 Bacteria 2384
470 nmdc:mga0n895_1500983_c1 3300050512 Viruses 640
471 nmdc:mga0n895_517700_c1 3300050512 Bacteria 1201
472 nmdc:mga0n895_703263_c1 3300050512 Bacteria 1006
473 nmdc:mga0rr50_264598_c1 3300050513 Bacteria 1431
474 nmdc:mga0rr50_966407_c1 3300050513 Bacteria 726
475 nmdc:mga0a205_1030124_c1 3300050515 Bacteria 670
476 nmdc:mga0a205_165881_c1 3300050515 Bacteria 2104
477 nmdc:mga0a205_393205_c1 3300050515 Bacteria 1250
478 nmdc:mga0a205_565554_c1 3300050515 Bacteria 991
479 nmdc:mga0a205_63334_c1 3300050515 Bacteria 3573
480 nmdc:mga0a205_9011_c1 3300050515 Bacteria 9093
481 Ga0495601_0002921 3300053077 Bacteria 9729
482 Ga0495612_0207582 3300053078 Bacteria 865
483 Ga0495619_1171429 3300053085 Bacteria 510
484 Ga0500644_0015502 3300053088 Bacteria 2175
485 Ga0500583_0541436 3300053092 Bacteria 542
486 Ga0500607_174237 3300053121 Bacteria 964
487 Ga0500628_000077 3300053129 Bacteria 24691
488 Ga0500616_0000008 3300053153 Bacteria 785239
489 Ga0500616_0000077 3300053153 Bacteria 208506
490 Ga0501084_0858776 3300054114 Bacteria 764
491 Ga0501084_0911902 3300054114 Bacteria 739
492 Ga0587084_016004 3300059477 Bacteria 1066
493 Ga0587077_037502 3300059493 Bacteria 957
494 Ga0587117_064866 3300059627 Bacteria 635
495 Ga0466962_0009653 3300061719 Bacteria 4629
496 JGI26128J50194_1001660
497 Ga0006770J48903_1047381
498 Ga0058859_10004809
499 Ga0058861_12045449
500 Ga0058860_11529881
501 Ga0058862_10205658
502 Ga0058862_12054985
503 Ga0070658_10291680
504 Ga0070683_100024593
505 Ga0070690_100151257
506 Ga0070670_100021920
507 Ga0068869_101132162
508 Ga0068869_101152083
509 Ga0070666_10019820
510 Ga0070666_10103096
511 Ga0070680_100099052
512 Ga0068868_100005429
513 Ga0068868_100142507
514 Ga0070691_10001800
515 Ga0070691_10074126
516 Ga0070687_100068192
517 Ga0070661_100299926
518 Ga0070692_10264392
519 Ga0070692_10264461
520 Ga0070668_100444488
521 Ga0070675_100082619
522 Ga0070675_100339193
523 Ga0070671_100008454
524 Ga0070674_101338659
525 Ga0070673_101812905
526 Ga0070688_100424508
527 Ga0070667_100015540
528 Ga0070709_10108236
529 Ga0070714_100296499
530 Ga0070714_100312366
531 Ga0070714_100497353
532 Ga0070713_101217351
533 Ga0070701_10023289
534 Ga0070701_10548882
535 Ga0070701_11281097
536 Ga0070705_100957829
537 Ga0070705_101009420
538 Ga0070700_100015000
539 Ga0070694_100229937
540 Ga0070694_100313390
541 Ga0070694_101392436
542 Ga0070708_100000874
543 Ga0070708_100113402
544 Ga0070663_100275041
545 Ga0070663_101007105
546 Ga0070678_100081927
547 Ga0070678_100198172
548 Ga0070681_11229030
549 Ga0068867_100244009
550 Ga0070685_10027522
551 Ga0070706_100001548
552 Ga0070706_100258240
553 Ga0070706_100396146
554 Ga0070706_100461309
555 Ga0070707_100012600
556 Ga0070707_100121056
557 Ga0070707_101006676
558 Ga0070707_101472456
559 Ga0070707_101584610
560 Ga0070698_100013686
561 Ga0070698_100044815
562 Ga0070698_100843917
563 Ga0070698_101469274
564 Ga0070699_100007392
565 Ga0070699_100077781
566 Ga0070679_100035338
567 Ga0070679_100127909
568 Ga0070684_100064251
569 Ga0070684_100284339
570 Ga0070684_100751919
571 Ga0070697_100008107
572 Ga0070697_100039169
573 Ga0070672_100610095
574 Ga0070686_100078786
575 Ga0070686_100310412
576 Ga0070686_101292617
577 Ga0070695_100024583
578 Ga0070695_100504712
579 Ga0070696_101475304
580 Ga0070665_100153752
581 Ga0070704_100030326
582 Ga0070704_100173962
583 Ga0070704_100213881
584 Ga0070704_100228861
585 Ga0070704_100753314
586 Ga0068855_100517328
587 Ga0068855_100640954
588 Ga0068855_101148221
589 Ga0070664_100350131
590 Ga0068857_100006631
591 Ga0068857_101911730
592 Ga0068856_101122021
593 Ga0068852_100744856
594 Ga0068859_100012907
595 Ga0068859_100115965
596 Ga0068864_100022600
597 Ga0068861_100041069
598 Ga0068861_101088139
599 Ga0068870_10276391
600 Ga0068863_100026833
601 Ga0068863_100065194
602 Ga0068863_100158067
603 Ga0068858_100006142
604 Ga0068858_100047449
605 Ga0068858_100133258
606 Ga0068860_100030150
607 Ga0068860_100248305
608 Ga0068862_100019095
609 Ga0070717_10007950
610 Ga0070717_10008401
611 Ga0070717_10124937
612 Ga0070717_11037456
613 Ga0075363_100988228
614 Ga0075432_10071696
615 Ga0070715_10095950
616 Ga0070716_100341871
617 Ga0070716_101235599
618 Ga0097621_100213717
619 Ga0097621_100751959
620 Ga0068871_100945107
621 Ga0075428_100417470
622 Ga0075428_102674639
623 Ga0075431_101303920
624 Ga0075433_10003136
625 Ga0075433_10038728
626 Ga0075433_10412685
627 Ga0075434_100001824
628 Ga0075434_100251409
629 Ga0075434_102348951
630 Ga0075436_100063163
631 Ga0097620_100012907
632 Ga0097620_100115963
633 Ga0075435_100511865
634 Ga0075435_100955123
635 Ga0099794_10128342
636 Ga0105251_10180668
637 Ga0111539_10170443
638 Ga0111539_10885486
639 Ga0105245_10002979
640 Ga0105245_10196612
641 Ga0105247_10008115
642 Ga0114129_10281686
643 Ga0114129_10349037
644 Ga0114129_10737293
645 Ga0114129_10958639
646 Ga0105243_10110372
647 Ga0105243_10155490
648 Ga0105243_10539183
649 Ga0105243_11825785
650 Ga0105242_10408060
651 Ga0105248_10011163
652 Ga0105238_10162346
653 Ga0105238_11213324
654 Ga0130087_1081296
655 Ga0130086_1092952
656 Ga0130084_1046490
657 Ga0130085_1007653
658 Ga0105239_10348824
659 Ga0105246_10002426
660 Ga0105246_10211624
661 Ga0157369_10324820
662 Ga0157369_11556510
663 Ga0157374_10064541
664 Ga0157374_10273310
665 Ga0157378_10536401
666 Ga0163162_10013077
667 Ga0157372_10432521
668 Ga0157372_10702327
669 Ga0157372_12988836
670 Ga0157375_10002567
671 Ga0157375_10330035
672 Ga0157375_11023668
673 Ga0163163_10007782
674 Ga0157380_10016532
675 Ga0157379_10011980
676 Ga0157376_10035934
677 Ga0163161_10128102
678 Ga0197907_10745673
679 Ga0197907_10877974
680 Ga0206356_10428095
681 Ga0206356_10714059
682 Ga0206356_11304877
683 Ga0206356_11819515
684 Ga0206356_11883346
685 Ga0206349_1115449
686 Ga0206349_1801976
687 Ga0206355_1170795
688 Ga0206355_1280405
689 Ga0206351_10190749
690 Ga0206351_10317479
691 Ga0206351_10639866
692 Ga0206352_10193538
693 Ga0206352_10481195
694 Ga0206352_11228573
695 Ga0206352_11251130
696 Ga0206350_10234328
697 Ga0206350_10242664
698 Ga0206350_10325577
699 Ga0206350_10691352
700 Ga0206350_10928407
701 Ga0206350_11530023
702 Ga0206354_10421436
703 Ga0206353_11499008
704 Ga0213874_10002780
705 Ga0213876_10098333
706 Ga0213875_10303365
707 Ga0224712_10000319
708 Ga0224712_10000482
709 Ga0224712_10000817
710 Ga0224712_10159097
711 Ga0224712_10461405
712 Ga0207653_10006632
713 Ga0207642_10311815
714 Ga0207688_10110081
715 Ga0207680_10156401
716 Ga0207680_10191041
717 Ga0207647_10039593
718 Ga0207685_10092131
719 Ga0207699_10620682
720 Ga0207645_10238744
721 Ga0207643_10374428
722 Ga0207684_10001602
723 Ga0207684_10009986
724 Ga0207684_10015824
725 Ga0207684_10681369
726 Ga0207707_10927208
727 Ga0207693_10250796
728 Ga0207663_11001187
729 Ga0207660_10236434
730 Ga0207649_10109527
731 Ga0207652_10032320
732 Ga0207652_10248801
733 Ga0207652_10416516
734 Ga0207646_10000708
735 Ga0207646_10005612
736 Ga0207646_11443225
737 Ga0207694_10430980
738 Ga0207650_10020266
739 Ga0207650_10565044
740 Ga0207659_10066584
741 Ga0207687_10057696
742 Ga0207687_10065150
743 Ga0207687_11801996
744 Ga0207700_10913592
745 Ga0207664_10234452
746 Ga0207664_11423070
747 Ga0207644_10114383
748 Ga0207644_10998205
749 Ga0207686_10298110
750 Ga0207709_10119923
751 Ga0207709_10708593
752 Ga0207709_10797618
753 Ga0207670_10154813
754 Ga0207670_10275281
755 Ga0207670_10716662
756 Ga0207669_10506201
757 Ga0207704_10735083
758 Ga0207665_10164414
759 Ga0207691_10120453
760 Ga0207691_10315142
761 Ga0207711_10004853
762 Ga0207661_10095905
763 Ga0207679_10253337
764 Ga0207679_10326957
765 Ga0207667_10552933
766 Ga0207667_10885607
767 Ga0207712_10133642
768 Ga0207712_10744596
769 Ga0207668_10090451
770 Ga0207640_11561211
771 Ga0207658_10040394
772 Ga0207677_10407797
773 Ga0207703_10021325
774 Ga0207703_10026000
775 Ga0207639_10963133
776 Ga0207678_10399019
777 Ga0207678_10694368
778 Ga0207708_10015186
779 Ga0207708_10364317
780 Ga0207702_11625909
781 Ga0207641_10005619
782 Ga0207641_10734376
783 Ga0207648_10055268
784 Ga0207648_11427627
785 Ga0207676_10003106
786 Ga0207674_10011465
787 Ga0207674_11283247
788 Ga0207675_100012427
789 Ga0207675_100495212
790 Ga0207683_10222016
791 Ga0207698_10026842
792 Ga0209966_1000144
793 Ga0209966_1060914
794 Ga0209998_10017366
795 Ga0209974_10134498
796 Ga0207428_10417557
797 Ga0268266_10128636
798 Ga0268265_10068794
799 Ga0268264_10047743
800 Ga0268264_10223378
801 Ga0268264_12628548
802 Ga0265323_10001746
803 Ga0265322_10006215
804 Ga0265338_10000066
805 Ga0265338_10006640
806 Ga0265338_10105522
807 Ga0265338_10280682
808 Ga0265324_10005363
809 Ga0265324_10157622
810 Ga0265330_10001813
811 Ga0265330_10109961
812 Ga0265332_10003909
813 Ga0265320_10014760
814 Ga0265325_10014664
815 Ga0265325_10221813
816 Ga0265340_10028017
817 Ga0265339_10069350
818 Ga0265316_10060043
819 Ga0265316_10232543
820 Ga0316575_10051113
821 Ga0316579_10025655
822 Ga0316576_10034427
823 Ga0316576_10585840
824 Ga0307405_10303640
825 Ga0316577_10002971
826 Ga0316577_10011751
827 Ga0316577_10022947
828 Ga0316577_10027167
829 Ga0307406_10125971
830 Ga0307416_100120431
831 Ga0307416_101492843
832 Ga0307416_101925559
833 Ga0307415_100057134
834 Ga0316593_10001038
835 Ga0316593_10040395
836 Ga0316593_10120304
837 Ga0316593_10179544
838 Ga0316592_1000011
839 Ga0316587_1000243
840 Ga0316596_1000864
841 Ga0316596_1039156
842 Ga0373949_0032430
843 Ga0373954_0003959
844 Ga0373956_0000071
845 Ga0373943_0773748
846 Ga0373946_0092226
847 Ga0373955_0478557
848 Ga0373927_0000098
849 Ga0373933_0202020
850 Ga0373937_1792279
851 Ga0316582_0001185
852 Ga0316582_0014880
853 Ga0316582_0158653
854 Ga0316582_0237856
855 Ga0316582_1265406
856 Ga0316584_0018626
857 Ga0316584_0158681
858 Ga0316584_0187273
859 Ga0316584_0213764
860 Ga0316584_0336501
861 Ga0316584_0345105
862 Ga0436364_0593199
863 Ga0436364_1010524
864 Ga0436364_1340585
865 Ga0395901_0840682
866 Ga0400490_36008
867 Ga0400489_86969
868 Ga0436365_0043253
869 Ga0436365_0312958
870 Ga0436365_0728443
871 Ga0436363_0098679
872 Ga0436363_0788412
873 Ga0436362_0967168
874 Ga0451797_0793319
875 Ga0450894_021901
876 Ga0439464_0267854
877 Ga0451577_0004031
878 Ga0466972_0002629
879 Ga0466972_0017726
880 Ga0466972_0102824
881 Ga0453683_0302995
882 Ga0453683_0549292
883 Ga0466965_0013757
884 Ga0466965_0015475
885 Ga0466965_0225385
886 Ga0466966_0006034
887 Ga0466966_0310717
888 Ga0466966_0376785
889 Ga0466961_0011434
890 Ga0466961_0011530
891 Ga0466961_0094335
892 Ga0466961_0497879
893 Ga0466963_0082364
894 Ga0466963_0255557
895 Ga0466964_0000286
896 Ga0453684_0035849
897 Ga0453684_0523205
898 Ga0453684_0600770
899 Ga0453684_0738589
900 Ga0453684_1077645
901 Ga0453684_1197166
902 Ga0466971_0229855
903 Ga0466968_0000631
904 Ga0466968_0002163
905 Ga0466970_0000735
906 Ga0466970_0102314
907 Ga0466970_0641775
908 Ga0466957_0011212
909 Ga0466960_0002207
910 Ga0466959_0001979
911 Ga0466959_0064314
912 Ga0466959_0232191
913 Ga0466959_0479620
914 Ga0451576_0000048
915 Ga0451576_0000789
916 Ga0451576_0003567
917 Ga0451576_0034776
918 Ga0451576_0233331
919 Ga0451576_0701418
920 Ga0466958_0022910
921 Ga0466967_0835807
922 Ga0466967_2094396
923 Ga0495580_0611356
924 Ga0495649_0554328
925 Ga0496104_0007967
926 Ga0496106_0937952
927 Ga0496107_0540836
928 Ga0496108_0000307
929 Ga0496108_0569572
930 Ga0496109_0017303
931 Ga0496110_1085415
932 Ga0496111_0265653
933 Ga0496111_0271111
934 Ga0496111_0858945
935 Ga0496112_0024825
936 Ga0496113_0130099
937 Ga0496114_0011260
938 Ga0496115_0264195
939 Ga0501309_063358
940 Ga0501036_0193083
941 Ga0501036_0225554
942 Ga0501040_0560392
943 Ga0501040_0832684
944 Ga0501041_0352160
945 Ga0501042_1227390
946 Ga0501071_0041174
947 Ga0501072_0080268
948 Ga0501073_0896627
949 Ga0501075_0287652
950 Ga0501076_0250997
951 Ga0501209_157040
952 Ga0501080_0460165
953 Ga0501081_0656807
954 Ga0501035_0540843
955 Ga0501035_0822550
956 Ga0501044_0894343
957 Ga0501044_1585519
958 Ga0501045_0945190
959 nmdc:mga03n38_449389_c1
960 nmdc:mga05p37_787673_c1
961 nmdc:mga09592_1236543_c1
962 nmdc:mga06r32_503766_c1
963 nmdc:mga08y16_210547_c1
964 nmdc:mga0n895_147358_c1
965 nmdc:mga0n895_1500983_c1
966 nmdc:mga0n895_517700_c1
967 nmdc:mga0n895_703263_c1
968 nmdc:mga0rr50_264598_c1
969 nmdc:mga0rr50_966407_c1
970 nmdc:mga0a205_1030124_c1
971 nmdc:mga0a205_165881_c1
972 nmdc:mga0a205_393205_c1
973 nmdc:mga0a205_565554_c1
974 nmdc:mga0a205_63334_c1
975 nmdc:mga0a205_9011_c1
976 Ga0495601_0002921
977 Ga0495612_0207582
978 Ga0495619_1171429
979 Ga0500644_0015502
980 Ga0500583_0541436
981 Ga0500607_174237
982 Ga0500628_000077
983 Ga0500616_0000008
984 Ga0500616_0000077
985 Ga0501084_0858776
986 Ga0501084_0911902
987 Ga0587084_016004
988 Ga0587077_037502
989 Ga0587117_064866
990 Ga0466962_0009653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00252

Ribosomal_L16

Ribosomal protein L16p/L10e

4

134

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qws-assembly1.cif.gz_I structure of ribosome translating beta-tubulin in complex with ttc5 and nac 0.866 32 134
8apo-assembly1.cif.gz_Ak structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.8632 27 134
6gbz-assembly1.cif.gz_M 50s ribosomal subunit assembly intermediate state 5 0.862 3 136
7oya-assembly1.cif.gz_I1 cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome 0.8601 33 134
7xny-assembly1.cif.gz_LI high resolution cry-em structure of the human 80s ribosome from snord127+/- kasumi-1 cells 0.8594 33 133
ID Description Score Start End Superfamily
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.9664 25 136 3.90.1170.10
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.9302 25 136 3.90.1170.10
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.9059 24 136 3.90.1170.10
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.876 24 136 3.90.1170.10
4kbuQ01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8614 24 139 3.90.1170.10
ID Description Score Start End GO Terms
AF-A0A7C2SEZ3-F1-model_v4 50S ribosomal protein L16 0.9099 29 139 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3D1PX62-F1-model_v4 deleted 0.9085 29 139
AF-A0A1G2PI09-F1-model_v4 50S ribosomal protein L16 0.9076 28 136 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A448QXD0-F1-model_v4 deleted 0.9068 28 136
AF-A0A5B9RSE0-F1-model_v4 50S ribosomal protein L16, chloroplastic 0.9067 28 134 GO:0003735
GO:0005762
GO:0009507
GO:0019843
GO:0032543

Map