F454692

General Info

Members Datasets Scaffolds Average Seq Length
495 245 495 212

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10118067|Ga0070681_101180672
Length 221
Sequence MEFGRPAALQPASFFAFMRIDRAGLPFIAGALVPAALLASTRRYGWAAACAAVGGFMTYFFRDPDRDVPQAPGLVVSPADGRVMWTPPGDWQQITIFLSPLDVHINRTPVDGRVTRIEYRPGAFLPAYKHDAAANELNEIWIDHGGETVVVRQIVGALARRIVCRVQEGQTLARGERIGLMKFGSRMDVFLPPRAELMVQVGQSVVAGVTVLARLQAPPHG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 3.84
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10265935 3300005289 Unclassified 954
2 Ga0065712_10171297 3300005290 Bacteria 1242
3 Ga0065707_10001636 3300005295 Bacteria 5935
4 Ga0070676_10069368 3300005328 Bacteria 2113
5 Ga0070683_100000817 3300005329 Bacteria 23098
6 Ga0070683_100028392 3300005329 Bacteria 5056
7 Ga0070683_100588023 3300005329 Bacteria 1065
8 Ga0070690_100017099 3300005330 Bacteria 4354
9 Ga0070670_100003221 3300005331 Bacteria 13474
10 Ga0070670_100004636 3300005331 Bacteria 11531
11 Ga0070670_100010107 3300005331 Bacteria 8050
12 Ga0070670_100028331 3300005331 Bacteria 4820
13 Ga0070670_100036316 3300005331 Bacteria 4240
14 Ga0070670_100283004 3300005331 Bacteria 1448
15 Ga0068869_100029706 3300005334 Bacteria 3833
16 Ga0068869_100084082 3300005334 Bacteria 2381
17 Ga0070680_100223332 3300005336 Bacteria 1590
18 Ga0070680_100237545 3300005336 Bacteria 1540
19 Ga0070660_100230450 3300005339 Bacteria 1507
20 Ga0070661_100019679 3300005344 Bacteria 4811
21 Ga0070661_100285177 3300005344 Bacteria 1282
22 Ga0070669_100018097 3300005353 Bacteria 5032
23 Ga0070669_100636540 3300005353 Bacteria 896
24 Ga0070675_100181715 3300005354 Bacteria 1819
25 Ga0070675_100308236 3300005354 Bacteria 1396
26 Ga0070675_100626747 3300005354 Unclassified 976
27 Ga0070671_100080234 3300005355 Bacteria 2728
28 Ga0070671_100111755 3300005355 Bacteria 2295
29 Ga0070671_100194137 3300005355 Bacteria 1721
30 Ga0070671_100773478 3300005355 Bacteria 835
31 Ga0070674_100000654 3300005356 Bacteria 17477
32 Ga0070674_100019975 3300005356 Bacteria 4269
33 Ga0070674_100029284 3300005356 Bacteria 3624
34 Ga0070674_100062012 3300005356 Bacteria 2611
35 Ga0070674_100115364 3300005356 Unclassified 1980
36 Ga0070673_100009321 3300005364 Bacteria 6587
37 Ga0070673_100174748 3300005364 Bacteria 1835
38 Ga0070688_100160743 3300005365 Bacteria 1543
39 Ga0070688_100295021 3300005365 Unclassified 1170
40 Ga0070659_100560089 3300005366 Bacteria 979
41 Ga0070667_100065911 3300005367 Bacteria 3076
42 Ga0070711_100051768 3300005439 Bacteria 2822
43 Ga0070705_100071526 3300005440 Bacteria 2098
44 Ga0070700_100062091 3300005441 Bacteria 2359
45 Ga0070700_100339272 3300005441 Bacteria 1110
46 Ga0070694_100397553 3300005444 Unclassified 1078
47 Ga0070694_100526667 3300005444 Bacteria 944
48 Ga0070663_100223878 3300005455 Bacteria 1478
49 Ga0070678_100797685 3300005456 Bacteria 857
50 Ga0070662_100134699 3300005457 Bacteria 1909
51 Ga0070662_100172076 3300005457 Bacteria 1701
52 Ga0070662_100313251 3300005457 Bacteria 1278
53 Ga0070681_10118067 3300005458 Bacteria 2589
54 Ga0070681_10598231 3300005458 Bacteria 1017
55 Ga0070681_10636585 3300005458 Unclassified 981
56 Ga0070685_10193628 3300005466 Bacteria 1317
57 Ga0070706_100144425 3300005467 Unclassified 2222
58 Ga0070698_100036799 3300005471 Bacteria 5051
59 Ga0070699_100011273 3300005518 Bacteria 7723
60 Ga0070699_100143928 3300005518 Bacteria 2106
61 Ga0070699_100267611 3300005518 Bacteria 1529
62 Ga0070684_100000538 3300005535 Bacteria 26032
63 Ga0070684_100045383 3300005535 Bacteria 3806
64 Ga0070684_100570715 3300005535 Unclassified 1051
65 Ga0070672_100011885 3300005543 Bacteria 6085
66 Ga0070672_100345176 3300005543 Bacteria 1268
67 Ga0070672_100519913 3300005543 Bacteria 1031
68 Ga0070686_100019324 3300005544 Bacteria 4012
69 Ga0070695_100038534 3300005545 Bacteria 3017
70 Ga0070693_100050888 3300005547 Bacteria 2370
71 Ga0070665_100264764 3300005548 Bacteria 1720
72 Ga0070704_100191452 3300005549 Bacteria 1644
73 Ga0068855_100832248 3300005563 Bacteria 979
74 Ga0070664_100000055 3300005564 Bacteria 69107
75 Ga0070664_100306314 3300005564 Unclassified 1436
76 Ga0068857_100005431 3300005577 Bacteria 10868
77 Ga0068857_100189683 3300005577 Bacteria 1872
78 Ga0068854_100037114 3300005578 Bacteria 3418
79 Ga0068859_100010271 3300005617 Bacteria 9424
80 Ga0068859_100169806 3300005617 Bacteria 2262
81 Ga0068859_100766823 3300005617 Unclassified 1053
82 Ga0068864_100589966 3300005618 Unclassified 1077
83 Ga0068866_10021185 3300005718 Bacteria 2991
84 Ga0068870_10122520 3300005840 Bacteria 1500
85 Ga0068863_100171661 3300005841 Unclassified 2080
86 Ga0068863_100207203 3300005841 Bacteria 1887
87 Ga0068863_100316654 3300005841 Bacteria 1515
88 Ga0068858_100072157 3300005842 Bacteria 3203
89 Ga0068858_100342874 3300005842 Bacteria 1430
90 Ga0068860_100065743 3300005843 Bacteria 3444
91 Ga0068860_100342529 3300005843 Bacteria 1470
92 Ga0068862_100092309 3300005844 Bacteria 2639
93 Ga0068862_100235980 3300005844 Unclassified 1661
94 Ga0081539_10073335 3300005985 Bacteria 1826
95 Ga0075365_10002810 3300006038 Bacteria 8719
96 Ga0075365_10023125 3300006038 Bacteria 3905
97 Ga0075368_10012444 3300006042 Bacteria 3110
98 Ga0075368_10020563 3300006042 Bacteria 2501
99 Ga0075368_10031624 3300006042 Bacteria 2053
100 Ga0075364_10013958 3300006051 Bacteria 4951
101 Ga0075362_10000061 3300006177 Bacteria 33316
102 Ga0075367_10006307 3300006178 Bacteria 5980
103 Ga0075367_10006925 3300006178 Bacteria 5771
104 Ga0075367_10008419 3300006178 Bacteria 5343
105 Ga0075367_10248645 3300006178 Unclassified 1115
106 Ga0075366_10003271 3300006195 Bacteria 8519
107 Ga0075366_10006145 3300006195 Bacteria 6551
108 Ga0075366_10030616 3300006195 Bacteria 3164
109 Ga0097621_100273900 3300006237 Bacteria 1484
110 Ga0097621_100323220 3300006237 Bacteria 1367
111 Ga0097621_100876477 3300006237 Unclassified 835
112 Ga0075370_10003291 3300006353 Bacteria 7664
113 Ga0068871_100196680 3300006358 Bacteria 1739
114 Ga0075428_100002058 3300006844 Bacteria 21689
115 Ga0075428_100002186 3300006844 Bacteria 21167
116 Ga0075428_100003760 3300006844 Bacteria 16637
117 Ga0075428_100005718 3300006844 Bacteria 13821
118 Ga0075428_100013792 3300006844 Bacteria 9001
119 Ga0075430_100002788 3300006846 Bacteria 14603
120 Ga0075430_100015560 3300006846 Bacteria 6475
121 Ga0075430_100031398 3300006846 Bacteria 4508
122 Ga0075430_100087191 3300006846 Bacteria 2612
123 Ga0075430_100188828 3300006846 Bacteria 1713
124 Ga0075431_100027376 3300006847 Bacteria 5848
125 Ga0075431_100104551 3300006847 Unclassified 2922
126 Ga0075431_100167114 3300006847 Bacteria 2261
127 Ga0075433_10009601 3300006852 Bacteria 7742
128 Ga0075433_10060651 3300006852 Bacteria 3313
129 Ga0075433_10080426 3300006852 Bacteria 2873
130 Ga0075433_10109577 3300006852 Bacteria 2450
131 Ga0075433_10259057 3300006852 Bacteria 1542
132 Ga0075433_10575648 3300006852 Bacteria 989
133 Ga0075434_100007606 3300006871 Bacteria 10031
134 Ga0075434_100028542 3300006871 Bacteria 5484
135 Ga0075429_100004693 3300006880 Bacteria 11764
136 Ga0075429_100014262 3300006880 Bacteria 6891
137 Ga0075429_100036803 3300006880 Bacteria 4259
138 Ga0075429_100176707 3300006880 Unclassified 1871
139 Ga0075429_100415402 3300006880 Bacteria 1178
140 Ga0068865_100177460 3300006881 Bacteria 1638
141 Ga0068865_100288436 3300006881 Bacteria 1309
142 Ga0068865_100347287 3300006881 Bacteria 1201
143 Ga0097620_100010271 3300006931 Bacteria 9424
144 Ga0097620_100169809 3300006931 Bacteria 2262
145 Ga0097620_100767044 3300006931 Unclassified 1053
146 Ga0075435_100407293 3300007076 Unclassified 1170
147 Ga0105240_10082364 3300009093 Bacteria 3952
148 Ga0105240_10208640 3300009093 Bacteria 2284
149 Ga0111539_10001246 3300009094 Bacteria 33877
150 Ga0111539_10009925 3300009094 Bacteria 12011
151 Ga0111539_10301441 3300009094 Bacteria 1865
152 Ga0111539_10321004 3300009094 Bacteria 1802
153 Ga0111539_10364501 3300009094 Bacteria 1682
154 Ga0111539_11051451 3300009094 Bacteria 946
155 Ga0111539_11070092 3300009094 Unclassified 937
156 Ga0114129_10000802 3300009147 Bacteria 40299
157 Ga0114129_10004303 3300009147 Bacteria 20120
158 Ga0114129_10009647 3300009147 Bacteria 13775
159 Ga0114129_10010905 3300009147 Bacteria 12946
160 Ga0114129_10032450 3300009147 Bacteria 7381
161 Ga0114129_10034994 3300009147 Bacteria 7095
162 Ga0114129_10087394 3300009147 Bacteria 4323
163 Ga0114129_10220396 3300009147 Bacteria 2559
164 Ga0114129_11144541 3300009147 Bacteria 972
165 Ga0105241_10185120 3300009174 Bacteria 1730
166 Ga0105242_10163011 3300009176 Bacteria 1953
167 Ga0105248_10051900 3300009177 Bacteria 4602
168 Ga0105248_10082953 3300009177 Bacteria 3606
169 Ga0105238_11006943 3300009551 Bacteria 854
170 Ga0105249_10231762 3300009553 Bacteria 1822
171 Ga0105249_10236922 3300009553 Bacteria 1802
172 Ga0105246_10451851 3300011119 Unclassified 1080
173 Ga0157374_10260324 3300013296 Bacteria 1708
174 Ga0157378_10105395 3300013297 Bacteria 2578
175 Ga0163162_10239196 3300013306 Bacteria 1946
176 Ga0157375_11360521 3300013308 Bacteria 836
177 Ga0163163_10003686 3300014325 Bacteria 13039
178 Ga0157380_10096183 3300014326 Unclassified 2455
179 Ga0157380_10219072 3300014326 Bacteria 1701
180 Ga0157380_10261111 3300014326 Bacteria 1573
181 Ga0157380_10491317 3300014326 Bacteria 1190
182 Ga0157377_10387671 3300014745 Bacteria 948
183 Ga0157379_10101301 3300014968 Bacteria 2585
184 Ga0157379_10214635 3300014968 Bacteria 1743
185 Ga0157376_10080953 3300014969 Bacteria 2787
186 Ga0157376_10381974 3300014969 Bacteria 1357
187 Ga0206356_10495523 3300020070 Bacteria 1436
188 Ga0206353_11656120 3300020082 Unclassified 1482
189 Ga0207697_10004399 3300025315 Bacteria 6735
190 Ga0207697_10041592 3300025315 Bacteria 1887
191 Ga0207682_10077066 3300025893 Bacteria 1422
192 Ga0207642_10054361 3300025899 Bacteria 1826
193 Ga0207688_10007207 3300025901 Bacteria 6050
194 Ga0207680_10230733 3300025903 Bacteria 1272
195 Ga0207699_10285534 3300025906 Bacteria 1148
196 Ga0207645_10001201 3300025907 Bacteria 21361
197 Ga0207654_10069998 3300025911 Bacteria 2081
198 Ga0207695_10362987 3300025913 Bacteria 1335
199 Ga0207695_10382961 3300025913 Bacteria 1292
200 Ga0207662_10001608 3300025918 Bacteria 11059
201 Ga0207657_10141061 3300025919 Bacteria 1969
202 Ga0207649_10011364 3300025920 Bacteria 4909
203 Ga0207649_10286088 3300025920 Bacteria 1200
204 Ga0207681_10213860 3300025923 Unclassified 1488
205 Ga0207681_10362414 3300025923 Bacteria 1163
206 Ga0207681_10909578 3300025923 Bacteria 737
207 Ga0207650_10006970 3300025925 Bacteria 7704
208 Ga0207650_10025136 3300025925 Bacteria 4241
209 Ga0207650_10043796 3300025925 Bacteria 3287
210 Ga0207650_10090005 3300025925 Bacteria 2343
211 Ga0207644_10017174 3300025931 Bacteria 4880
212 Ga0207644_10384381 3300025931 Bacteria 1145
213 Ga0207690_10172193 3300025932 Unclassified 1623
214 Ga0207706_10263711 3300025933 Unclassified 1504
215 Ga0207706_10393647 3300025933 Bacteria 1202
216 Ga0207709_10087347 3300025935 Bacteria 2027
217 Ga0207670_10092046 3300025936 Bacteria 2146
218 Ga0207669_10086195 3300025937 Unclassified 2030
219 Ga0207669_10116313 3300025937 Bacteria 1804
220 Ga0207704_10085028 3300025938 Bacteria 2058
221 Ga0207691_10005745 3300025940 Bacteria 12003
222 Ga0207691_10169722 3300025940 Bacteria 1911
223 Ga0207711_10010775 3300025941 Bacteria 7601
224 Ga0207689_10029601 3300025942 Bacteria 4570
225 Ga0207689_10139855 3300025942 Bacteria 1994
226 Ga0207689_10187772 3300025942 Unclassified 1705
227 Ga0207661_10001501 3300025944 Bacteria 15811
228 Ga0207661_10010761 3300025944 Bacteria 6596
229 Ga0207679_10001458 3300025945 Bacteria 14838
230 Ga0207679_10110036 3300025945 Bacteria 2172
231 Ga0207679_10289957 3300025945 Bacteria 1407
232 Ga0207667_10720545 3300025949 Bacteria 999
233 Ga0207651_10017838 3300025960 Bacteria 4205
234 Ga0207651_10271792 3300025960 Bacteria 1396
235 Ga0207712_10281742 3300025961 Bacteria 1357
236 Ga0207668_10111723 3300025972 Bacteria 2052
237 Ga0207658_10264826 3300025986 Bacteria 1466
238 Ga0207677_10019893 3300026023 Bacteria 4063
239 Ga0207639_10555840 3300026041 Unclassified 1054
240 Ga0207678_10164837 3300026067 Bacteria 1892
241 Ga0207708_10007592 3300026075 Bacteria 8024
242 Ga0207648_10002017 3300026089 Bacteria 22166
243 Ga0207648_10640036 3300026089 Bacteria 982
244 Ga0207676_10533177 3300026095 Unclassified 1119
245 Ga0207674_10012913 3300026116 Bacteria 9315
246 Ga0207675_100182794 3300026118 Unclassified 2008
247 Ga0207683_10166356 3300026121 Unclassified 1995
248 Ga0207683_10961281 3300026121 Unclassified 793
249 Ga0209813_10022672 3300027866 Unclassified 1778
250 Ga0207428_10001731 3300027907 Bacteria 22364
251 Ga0207428_10017737 3300027907 Bacteria 6105
252 Ga0268266_10247784 3300028379 Bacteria 1647
253 Ga0268264_10645178 3300028381 Bacteria 1047
254 Ga0307408_100006200 3300031548 Bacteria 7940
255 Ga0307405_10011660 3300031731 Bacteria 4621
256 Ga0307405_10012845 3300031731 Bacteria 4449
257 Ga0307405_10051855 3300031731 Bacteria 2548
258 Ga0307413_10011842 3300031824 Bacteria 4310
259 Ga0307413_10222171 3300031824 Bacteria 1381
260 Ga0307413_10410230 3300031824 Bacteria 1064
261 Ga0307410_10043397 3300031852 Bacteria 2980
262 Ga0307410_10044118 3300031852 Bacteria 2959
263 Ga0307407_10095160 3300031903 Bacteria 1835
264 Ga0307407_10107933 3300031903 Bacteria 1742
265 Ga0307407_10108326 3300031903 Unclassified 1739
266 Ga0307407_10265800 3300031903 Bacteria 1182
267 Ga0307407_10390630 3300031903 Bacteria 996
268 Ga0307412_10019332 3300031911 Bacteria 4123
269 Ga0307412_10051756 3300031911 Bacteria 2716
270 Ga0307412_10206255 3300031911 Unclassified 1496
271 Ga0307412_10768807 3300031911 Bacteria 833
272 Ga0307409_100017600 3300031995 Bacteria 4771
273 Ga0307409_100023507 3300031995 Bacteria 4273
274 Ga0307409_100070998 3300031995 Bacteria 2767
275 Ga0307409_100414196 3300031995 Bacteria 1291
276 Ga0307416_100003678 3300032002 Bacteria 9082
277 Ga0307416_100012528 3300032002 Bacteria 5717
278 Ga0307416_100091310 3300032002 Bacteria 2615
279 Ga0307416_100219838 3300032002 Unclassified 1821
280 Ga0307416_100302030 3300032002 Bacteria 1592
281 Ga0307416_100339985 3300032002 Unclassified 1513
282 Ga0307416_100515253 3300032002 Bacteria 1263
283 Ga0307414_10030904 3300032004 Bacteria 3505
284 Ga0307414_10031132 3300032004 Bacteria 3495
285 Ga0307414_10196717 3300032004 Unclassified 1636
286 Ga0307414_10314510 3300032004 Bacteria 1330
287 Ga0307414_10795628 3300032004 Unclassified 862
288 Ga0307411_10030399 3300032005 Bacteria 3310
289 Ga0307411_10087010 3300032005 Bacteria 2169
290 Ga0307411_10094111 3300032005 Bacteria 2100
291 Ga0307415_100039239 3300032126 Bacteria 3128
292 Ga0307415_100055135 3300032126 Bacteria 2718
293 Ga0307415_100532947 3300032126 Bacteria 1033
294 Ga0307415_100813694 3300032126 Bacteria 854
295 Ga0307415_101042865 3300032126 Bacteria 762
296 Ga0373939_0125374 3300035114 Bacteria 911
297 Ga0373945_0164934 3300035116 Unclassified 905
298 Ga0373955_0168595 3300035172 Bacteria 1295
299 Ga0373961_0045771 3300035241 Bacteria 1280
300 Ga0373962_0093870 3300035242 Bacteria 928
301 Ga0373931_0011920 3300035691 Bacteria 4207
302 Ga0373931_0170531 3300035691 Unclassified 1282
303 Ga0373933_0053752 3300035724 Bacteria 2412
304 Ga0373947_0055933 3300035725 Unclassified 2384
305 Ga0373937_0001439 3300036401 Bacteria 19902
306 Ga0451798_0999571 3300041458 Unclassified 730
307 Ga0451802_0240854 3300041460 Bacteria 820
308 Ga0439431_0107863 3300041997 Bacteria 769
309 Ga0439442_073445 3300042002 Bacteria 729
310 Ga0439449_0228716 3300042007 Unclassified 698
311 Ga0439450_072176 3300042008 Bacteria 848
312 Ga0450923_047343 3300042125 Bacteria 917
313 Ga0439446_0019793 3300042156 Bacteria 1893
314 Ga0439434_0038870 3300042435 Bacteria 1459
315 Ga0439435_0071420 3300042436 Bacteria 1028
316 Ga0439464_0007639 3300042439 Bacteria 2828
317 Ga0451577_0050378 3300042876 Bacteria 3717
318 Ga0453683_0000748 3300044673 Bacteria 32799
319 Ga0453684_0985229 3300044712 Bacteria 897
320 Ga0466957_0495201 3300044842 Bacteria 847
321 Ga0451576_0028911 3300045051 Bacteria 5937
322 Ga0466967_0429942 3300045976 Unclassified 1288
323 Ga0495603_0117720 3300046455 Unclassified 1549
324 Ga0495603_0184248 3300046455 Unclassified 1208
325 Ga0495603_0326789 3300046455 Bacteria 880
326 Ga0495594_0251175 3300046499 Bacteria 1007
327 Ga0495594_0477034 3300046499 Bacteria 709
328 Ga0495667_0088435 3300046559 Bacteria 2008
329 Ga0495634_0108725 3300046642 Bacteria 1785
330 Ga0495646_0109925 3300046680 Bacteria 1571
331 Ga0495647_0133392 3300046681 Unclassified 1054
332 Ga0495658_0078674 3300046683 Bacteria 1931
333 Ga0495613_0380810 3300046689 Bacteria 965
334 Ga0495674_0136016 3300047319 Bacteria 2068
335 Ga0496102_0372185 3300048905 Bacteria 1344
336 Ga0496104_0001736 3300048907 Bacteria 18816
337 Ga0496105_0043932 3300048908 Bacteria 3685
338 Ga0496106_0019819 3300048909 Bacteria 4987
339 Ga0496106_0142503 3300048909 Bacteria 1886
340 Ga0496107_0083476 3300048910 Bacteria 2330
341 Ga0496108_0001282 3300048911 Bacteria 19690
342 Ga0496108_0334884 3300048911 Bacteria 1320
343 Ga0496109_0000572 3300048912 Bacteria 30775
344 Ga0496110_0004885 3300048913 Bacteria 10459
345 Ga0496110_0167916 3300048913 Bacteria 1990
346 Ga0496110_0186962 3300048913 Bacteria 1881
347 Ga0496111_0052625 3300048914 Bacteria 2940
348 Ga0496111_0272339 3300048914 Bacteria 1256
349 Ga0496112_0000217 3300048915 Bacteria 37074
350 Ga0496112_0022045 3300048915 Bacteria 6065
351 Ga0496113_0456634 3300048916 Bacteria 1027
352 Ga0501032_0020876 3300049569 Bacteria 4556
353 Ga0501032_0060244 3300049569 Bacteria 2545
354 Ga0501033_0023071 3300049570 Bacteria 4691
355 Ga0501034_0012830 3300049571 Bacteria 8642
356 Ga0501034_0014208 3300049571 Bacteria 8206
357 Ga0501034_0068180 3300049571 Bacteria 3568
358 Ga0501036_0006621 3300049572 Bacteria 9415
359 Ga0501036_0078021 3300049572 Bacteria 2802
360 Ga0501036_0100964 3300049572 Bacteria 2440
361 Ga0501036_0416140 3300049572 Bacteria 1121
362 Ga0501037_0006076 3300049573 Bacteria 8822
363 Ga0501037_0047910 3300049573 Bacteria 3131
364 Ga0501038_0011851 3300049574 Bacteria 7957
365 Ga0501038_0050560 3300049574 Bacteria 3590
366 Ga0501038_0187283 3300049574 Bacteria 1667
367 Ga0501040_0037176 3300049576 Bacteria 3307
368 Ga0501041_0069297 3300049577 Bacteria 2163
369 Ga0501041_0122000 3300049577 Bacteria 1620
370 Ga0501041_0278041 3300049577 Bacteria 1053
371 Ga0501042_0004581 3300049578 Bacteria 8823
372 Ga0501042_0057610 3300049578 Bacteria 2773
373 Ga0501043_0076983 3300049579 Bacteria 2620
374 Ga0501046_0008949 3300049580 Bacteria 8695
375 Ga0501046_0157050 3300049580 Unclassified 1713
376 Ga0501047_0012478 3300049581 Bacteria 8047
377 Ga0501047_0238941 3300049581 Bacteria 1668
378 Ga0501047_0345094 3300049581 Bacteria 1326
379 Ga0501048_0030799 3300049582 Bacteria 3882
380 Ga0501048_0118832 3300049582 Bacteria 1867
381 Ga0501048_0294348 3300049582 Bacteria 1155
382 Ga0501067_0000871 3300049583 Bacteria 16213
383 Ga0501067_0015564 3300049583 Bacteria 4210
384 Ga0501067_0247202 3300049583 Bacteria 993
385 Ga0501068_0000356 3300049584 Bacteria 22962
386 Ga0501069_0003315 3300049585 Bacteria 8265
387 Ga0501069_0074145 3300049585 Bacteria 1909
388 Ga0501070_0031954 3300049586 Bacteria 4408
389 Ga0501070_0176205 3300049586 Bacteria 1760
390 Ga0501070_0644885 3300049586 Bacteria 841
391 Ga0501071_0030860 3300049587 Bacteria 3793
392 Ga0501071_0109082 3300049587 Bacteria 2045
393 Ga0501071_0189978 3300049587 Unclassified 1540
394 Ga0501071_0312007 3300049587 Bacteria 1193
395 Ga0501072_0049072 3300049588 Bacteria 3323
396 Ga0501072_0508123 3300049588 Bacteria 953
397 Ga0501073_0002726 3300049589 Bacteria 13240
398 Ga0501073_0093615 3300049589 Bacteria 2087
399 Ga0501074_0000854 3300049590 Bacteria 19385
400 Ga0501074_0140685 3300049590 Bacteria 1726
401 Ga0501074_0146853 3300049590 Bacteria 1686
402 Ga0501075_0036542 3300049591 Bacteria 3667
403 Ga0501075_0278376 3300049591 Bacteria 1275
404 Ga0501075_0287763 3300049591 Bacteria 1252
405 Ga0501076_0029848 3300049592 Bacteria 4243
406 Ga0501077_0173457 3300049593 Bacteria 1370
407 Ga0501221_075703 3300049704 Bacteria 802
408 Ga0501079_0001073 3300049741 Bacteria 19026
409 Ga0501079_0050995 3300049741 Bacteria 3194
410 Ga0501079_0358897 3300049741 Unclassified 1142
411 Ga0501080_0003960 3300049742 Bacteria 13112
412 Ga0501080_0013058 3300049742 Bacteria 7626
413 Ga0501080_0131590 3300049742 Bacteria 2316
414 Ga0501080_0225768 3300049742 Unclassified 1713
415 Ga0501080_0404336 3300049742 Bacteria 1228
416 Ga0501080_0591882 3300049742 Bacteria 985
417 Ga0501081_0006124 3300049743 Bacteria 7796
418 Ga0501081_0021246 3300049743 Bacteria 4332
419 Ga0501083_0008241 3300049744 Bacteria 7367
420 Ga0501273_031241 3300049770 Bacteria 759
421 Ga0501035_0043532 3300049822 Bacteria 4045
422 Ga0501044_0030954 3300049823 Bacteria 5634
423 Ga0501044_0323650 3300049823 Bacteria 1465
424 Ga0501045_0001810 3300049824 Bacteria 14452
425 Ga0501045_0276723 3300049824 Bacteria 1249
426 Ga0501045_0506550 3300049824 Unclassified 896
427 nmdc:mga00v17_11646_c1 3300050491 Bacteria 4836
428 nmdc:mga00v17_1208_c1 3300050491 Bacteria 13555
429 nmdc:mga0yw44_16283_c1 3300050492 Bacteria 4012
430 nmdc:mga0yw44_59920_c1 3300050492 Bacteria 2330
431 nmdc:mga0k408_3364_c1 3300050493 Bacteria 3346
432 nmdc:mga0k408_37077_c1 3300050493 Bacteria 2798
433 nmdc:mga0k408_4353_c1 3300050493 Bacteria 7517
434 nmdc:mga06z11_223886_c1 3300050494 Bacteria 1100
435 nmdc:mga06z11_2962_c1 3300050494 Bacteria 6541
436 nmdc:mga06z11_3795_c1 3300050494 Bacteria 3460
437 nmdc:mga04h51_141089_c1 3300050495 Bacteria 914
438 nmdc:mga05p37_10279_c1 3300050507 Bacteria 11112
439 nmdc:mga05p37_26364_c1 3300050507 Bacteria 7069
440 nmdc:mga05p37_30741_c1 3300050507 Bacteria 6554
441 nmdc:mga05p37_314958_c1 3300050507 Bacteria 1854
442 nmdc:mga05p37_316449_c1 3300050507 Bacteria 1849
443 nmdc:mga05p37_32697_c1 3300050507 Bacteria 6364
444 nmdc:mga05p37_3405_c1 3300050507 Bacteria 18556
445 nmdc:mga05p37_441148_c1 3300050507 Bacteria 1510
446 nmdc:mga05p37_692514_c1 3300050507 Bacteria 1134
447 nmdc:mga05p37_7719_c1 3300050507 Bacteria 12698
448 nmdc:mga05p37_8024_c1 3300050507 Bacteria 12465
449 nmdc:mga09592_13838_c1 3300050508 Bacteria 6592
450 nmdc:mga09592_167262_c1 3300050508 Unclassified 1901
451 nmdc:mga09592_2893_c1 3300050508 Bacteria 13912
452 nmdc:mga09592_957563_c1 3300050508 Unclassified 717
453 nmdc:mga0qj67_107929_c1 3300050509 Unclassified 2246
454 nmdc:mga0qj67_324770_c1 3300050509 Unclassified 1246
455 nmdc:mga0qj67_5114_c1 3300050509 Bacteria 9551
456 nmdc:mga0qj67_52953_c2 3300050509 Bacteria 2014
457 nmdc:mga0qj67_794_c1 3300050509 Bacteria 21497
458 nmdc:mga06r32_34767_c1 3300050510 Bacteria 4754
459 nmdc:mga06r32_5480_c1 3300050510 Bacteria 11425
460 nmdc:mga06r32_68021_c1 3300050510 Bacteria 3440
461 nmdc:mga06r32_723832_c1 3300050510 Bacteria 960
462 nmdc:mga06r32_78570_c1 3300050510 Unclassified 3208
463 nmdc:mga08y16_130156_c1 3300050511 Bacteria 2618
464 nmdc:mga08y16_2029_c1 3300050511 Bacteria 20740
465 nmdc:mga08y16_957265_c1 3300050511 Unclassified 839
466 nmdc:mga0n895_118543_c1 3300050512 Bacteria 2667
467 nmdc:mga0n895_357246_c1 3300050512 Unclassified 1480
468 nmdc:mga0n895_6302_c1 3300050512 Bacteria 10060
469 nmdc:mga0rr50_215427_c1 3300050513 Unclassified 1584
470 nmdc:mga0rr50_35899_c1 3300050513 Bacteria 3565
471 nmdc:mga0a205_18953_c1 3300050515 Bacteria 6483
472 nmdc:mga0a205_195795_c1 3300050515 Bacteria 1528
473 nmdc:mga0a205_260101_c1 3300050515 Bacteria 1613
474 nmdc:mga0a205_378019_c1 3300050515 Unclassified 1282
475 nmdc:mga0a205_67532_c1 3300050515 Bacteria 3454
476 nmdc:mga0a205_94173_c1 3300050515 Bacteria 2893
477 Ga0495601_0035439 3300053077 Bacteria 3115
478 Ga0495595_0097526 3300053084 Bacteria 1416
479 Ga0495595_0149778 3300053084 Bacteria 1148
480 Ga0495619_0154173 3300053085 Bacteria 1585
481 Ga0501084_0123084 3300054114 Unclassified 2182
482 Ga0501084_0123532 3300054114 Bacteria 2177
483 Ga0501084_0124323 3300054114 Bacteria 2170
484 Ga0501084_0129921 3300054114 Bacteria 2121
485 Ga0501084_0874269 3300054114 Bacteria 756
486 Ga0590071_001485 3300059421 Bacteria 6182
487 Ga0590075_001106 3300059424 Bacteria 6953
488 Ga0590075_012764 3300059424 Bacteria 2042
489 Ga0590077_002251 3300059426 Bacteria 4177
490 Ga0590077_011003 3300059426 Bacteria 1865
491 Ga0590077_012934 3300059426 Bacteria 1732
492 Ga0501082_0006455 3300060353 Bacteria 10170
493 Ga0501082_0015245 3300060353 Bacteria 6620
494 Ga0501082_0603908 3300060353 Bacteria 960
495 Ga0530510_0367289 3300061734 Bacteria 1082

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0985229 Ga0453684_0985229_359_880 168
2 3300046455 Ga0495603_0326789 Ga0495603_0326789_304_849 174
3 3300014326 Ga0157380_10261111 Ga0157380_102611112 178
4 3300050515 nmdc:mga0a205_378019_c1 nmdc:mga0a205_378019_c1_322_873 183
5 3300059424 Ga0590075_012764 Ga0590075_012764_1044_1673 184
6 3300059426 Ga0590077_011003 Ga0590077_011003_129_758 184
7 3300005518 Ga0070699_100011273 Ga0070699_1000112733 186
8 3300042435 Ga0439434_0038870 Ga0439434_0038870_487_1113 188
9 3300032002 Ga0307416_100339985 Ga0307416_1003399853 192
10 3300005353 Ga0070669_100636540 Ga0070669_1006365402 195
11 3300025906 Ga0207699_10285534 Ga0207699_102855342 195
12 3300005331 Ga0070670_100036316 Ga0070670_1000363163 196
13 3300005564 Ga0070664_100306314 Ga0070664_1003063142 196
14 3300005617 Ga0068859_100766823 Ga0068859_1007668232 196
15 3300006931 Ga0097620_100767044 Ga0097620_1007670442 196
16 3300025925 Ga0207650_10025136 Ga0207650_100251363 196
17 3300049569 Ga0501032_0020876 Ga0501032_0020876_3293_3931 196
18 3300049571 Ga0501034_0014208 Ga0501034_0014208_539_1177 196
19 3300049571 Ga0501034_0068180 Ga0501034_0068180_1717_2355 196
20 3300049572 Ga0501036_0078021 Ga0501036_0078021_328_966 196
21 3300049572 Ga0501036_0100964 Ga0501036_0100964_471_1109 196
22 3300049573 Ga0501037_0047910 Ga0501037_0047910_1645_2283 196
23 3300049574 Ga0501038_0050560 Ga0501038_0050560_1944_2582 196
24 3300049582 Ga0501048_0030799 Ga0501048_0030799_1911_2549 196
25 3300049583 Ga0501067_0015564 Ga0501067_0015564_1424_2062 196
26 3300049586 Ga0501070_0176205 Ga0501070_0176205_15_653 196
27 3300049589 Ga0501073_0093615 Ga0501073_0093615_1214_1852 196
28 3300049590 Ga0501074_0140685 Ga0501074_0140685_980_1618 196
29 3300049742 Ga0501080_0131590 Ga0501080_0131590_1129_1767 196
30 3300049744 Ga0501083_0008241 Ga0501083_0008241_1436_2074 196
31 3300049823 Ga0501044_0323650 Ga0501044_0323650_356_994 196
32 3300060353 Ga0501082_0015245 Ga0501082_0015245_5158_5796 196
33 3300006844 Ga0075428_100003760 Ga0075428_1000037608 197
34 3300006846 Ga0075430_100031398 Ga0075430_1000313982 197
35 3300006847 Ga0075431_100167114 Ga0075431_1001671141 197
36 3300006880 Ga0075429_100176707 Ga0075429_1001767071 197
37 3300049574 Ga0501038_0187283 Ga0501038_0187283_24_626 197
38 3300049742 Ga0501080_0591882 Ga0501080_0591882_18_620 197
39 3300050508 nmdc:mga09592_167262_c1 nmdc:mga09592_167262_c1_1175_1840 197
40 3300050510 nmdc:mga06r32_5480_c1 nmdc:mga06r32_5480_c1_8557_9222 197
41 3300006237 Ga0097621_100876477 Ga0097621_1008764772 198
42 3300014968 Ga0157379_10214635 Ga0157379_102146353 198
43 3300026121 Ga0207683_10166356 Ga0207683_101663562 198
44 3300046455 Ga0495603_0117720 Ga0495603_0117720_826_1464 198
45 3300046681 Ga0495647_0133392 Ga0495647_0133392_205_843 198
46 3300048909 Ga0496106_0019819 Ga0496106_0019819_1307_1945 198
47 3300049569 Ga0501032_0060244 Ga0501032_0060244_1038_1688 198
48 3300049570 Ga0501033_0023071 Ga0501033_0023071_2876_3526 198
49 3300049572 Ga0501036_0006621 Ga0501036_0006621_3906_4556 198
50 3300049573 Ga0501037_0006076 Ga0501037_0006076_3533_4183 198
51 3300049574 Ga0501038_0011851 Ga0501038_0011851_5877_6527 198
52 3300049576 Ga0501040_0037176 Ga0501040_0037176_2389_3027 198
53 3300049577 Ga0501041_0069297 Ga0501041_0069297_1355_1993 198
54 3300049578 Ga0501042_0004581 Ga0501042_0004581_4639_5289 198
55 3300049578 Ga0501042_0057610 Ga0501042_0057610_287_925 198
56 3300049579 Ga0501043_0076983 Ga0501043_0076983_1067_1717 198
57 3300049580 Ga0501046_0008949 Ga0501046_0008949_4860_5510 198
58 3300049580 Ga0501046_0157050 Ga0501046_0157050_721_1359 198
59 3300049581 Ga0501047_0012478 Ga0501047_0012478_2538_3188 198
60 3300049582 Ga0501048_0118832 Ga0501048_0118832_21_671 198
61 3300049582 Ga0501048_0294348 Ga0501048_0294348_28_666 198
62 3300049583 Ga0501067_0000871 Ga0501067_0000871_3533_4183 198
63 3300049584 Ga0501068_0000356 Ga0501068_0000356_17637_18287 198
64 3300049585 Ga0501069_0003315 Ga0501069_0003315_4711_5361 198
65 3300049586 Ga0501070_0031954 Ga0501070_0031954_3407_4057 198
66 3300049587 Ga0501071_0030860 Ga0501071_0030860_1078_1728 198
67 3300049587 Ga0501071_0189978 Ga0501071_0189978_44_682 198
68 3300049588 Ga0501072_0049072 Ga0501072_0049072_903_1553 198
69 3300049589 Ga0501073_0002726 Ga0501073_0002726_858_1508 198
70 3300049590 Ga0501074_0000854 Ga0501074_0000854_7003_7653 198
71 3300049741 Ga0501079_0001073 Ga0501079_0001073_13517_14167 198
72 3300049742 Ga0501080_0003960 Ga0501080_0003960_11733_12383 198
73 3300049822 Ga0501035_0043532 Ga0501035_0043532_858_1508 198
74 3300049823 Ga0501044_0030954 Ga0501044_0030954_939_1589 198
75 3300049824 Ga0501045_0001810 Ga0501045_0001810_12640_13290 198
76 3300054114 Ga0501084_0123084 Ga0501084_0123084_931_1569 198
77 3300054114 Ga0501084_0123532 Ga0501084_0123532_194_844 198
78 3300059426 Ga0590077_012934 Ga0590077_012934_607_1275 198
79 3300060353 Ga0501082_0006455 Ga0501082_0006455_4366_5016 198
80 3300005458 Ga0070681_10118067 Ga0070681_101180672 199
81 3300005563 Ga0068855_100832248 Ga0068855_1008322481 199
82 3300009093 Ga0105240_10082364 Ga0105240_100823645 199
83 3300013297 Ga0157378_10105395 Ga0157378_101053953 199
84 3300025913 Ga0207695_10362987 Ga0207695_103629872 199
85 3300025949 Ga0207667_10720545 Ga0207667_107205452 199
86 3300049824 Ga0501045_0276723 Ga0501045_0276723_233_871 199
87 3300050508 nmdc:mga09592_957563_c1 nmdc:mga09592_957563_c1_22_663 199
88 3300054114 Ga0501084_0874269 Ga0501084_0874269_69_707 199
89 3300005441 Ga0070700_100339272 Ga0070700_1003392722 200
90 3300006237 Ga0097621_100273900 Ga0097621_1002739003 200
91 3300005985 Ga0081539_10073335 Ga0081539_100733352 201
92 3300032002 Ga0307416_100219838 Ga0307416_1002198382 201
93 3300006852 Ga0075433_10575648 Ga0075433_105756482 203
94 3300050515 nmdc:mga0a205_260101_c1 nmdc:mga0a205_260101_c1_873_1559 203
95 3300049742 Ga0501080_0404336 Ga0501080_0404336_13_639 206
96 3300005290 Ga0065712_10171297 Ga0065712_101712971 207
97 3300005328 Ga0070676_10069368 Ga0070676_100693683 207
98 3300005329 Ga0070683_100000817 Ga0070683_1000008176 207
99 3300005329 Ga0070683_100028392 Ga0070683_1000283924 207
100 3300005330 Ga0070690_100017099 Ga0070690_1000170993 207
101 3300005331 Ga0070670_100003221 Ga0070670_1000032218 207
102 3300005331 Ga0070670_100004636 Ga0070670_1000046363 207
103 3300005331 Ga0070670_100010107 Ga0070670_1000101073 207
104 3300005331 Ga0070670_100028331 Ga0070670_1000283313 207
105 3300005334 Ga0068869_100029706 Ga0068869_1000297062 207
106 3300005334 Ga0068869_100084082 Ga0068869_1000840822 207
107 3300005336 Ga0070680_100223332 Ga0070680_1002233323 207
108 3300005336 Ga0070680_100237545 Ga0070680_1002375453 207
109 3300005339 Ga0070660_100230450 Ga0070660_1002304503 207
110 3300005344 Ga0070661_100019679 Ga0070661_1000196795 207
111 3300005353 Ga0070669_100018097 Ga0070669_1000180974 207
112 3300005354 Ga0070675_100308236 Ga0070675_1003082362 207
113 3300005354 Ga0070675_100626747 Ga0070675_1006267472 207
114 3300005355 Ga0070671_100080234 Ga0070671_1000802342 207
115 3300005355 Ga0070671_100111755 Ga0070671_1001117552 207
116 3300005355 Ga0070671_100773478 Ga0070671_1007734781 207
117 3300005356 Ga0070674_100000654 Ga0070674_10000065411 207
118 3300005356 Ga0070674_100019975 Ga0070674_1000199753 207
119 3300005356 Ga0070674_100029284 Ga0070674_1000292843 207
120 3300005356 Ga0070674_100062012 Ga0070674_1000620124 207
121 3300005356 Ga0070674_100115364 Ga0070674_1001153642 207
122 3300005364 Ga0070673_100009321 Ga0070673_1000093213 207
123 3300005364 Ga0070673_100174748 Ga0070673_1001747482 207
124 3300005365 Ga0070688_100160743 Ga0070688_1001607433 207
125 3300005365 Ga0070688_100295021 Ga0070688_1002950212 207
126 3300005366 Ga0070659_100560089 Ga0070659_1005600892 207
127 3300005367 Ga0070667_100065911 Ga0070667_1000659114 207
128 3300005439 Ga0070711_100051768 Ga0070711_1000517682 207
129 3300005440 Ga0070705_100071526 Ga0070705_1000715262 207
130 3300005441 Ga0070700_100062091 Ga0070700_1000620912 207
131 3300005444 Ga0070694_100397553 Ga0070694_1003975532 207
132 3300005444 Ga0070694_100526667 Ga0070694_1005266671 207
133 3300005455 Ga0070663_100223878 Ga0070663_1002238782 207
134 3300005457 Ga0070662_100134699 Ga0070662_1001346992 207
135 3300005457 Ga0070662_100172076 Ga0070662_1001720762 207
136 3300005457 Ga0070662_100313251 Ga0070662_1003132512 207
137 3300005458 Ga0070681_10598231 Ga0070681_105982311 207
138 3300005458 Ga0070681_10636585 Ga0070681_106365851 207
139 3300005466 Ga0070685_10193628 Ga0070685_101936282 207
140 3300005467 Ga0070706_100144425 Ga0070706_1001444252 207
141 3300005518 Ga0070699_100143928 Ga0070699_1001439283 207
142 3300005518 Ga0070699_100267611 Ga0070699_1002676112 207
143 3300005535 Ga0070684_100000538 Ga0070684_1000005389 207
144 3300005535 Ga0070684_100045383 Ga0070684_1000453835 207
145 3300005543 Ga0070672_100345176 Ga0070672_1003451763 207
146 3300005543 Ga0070672_100519913 Ga0070672_1005199132 207
147 3300005544 Ga0070686_100019324 Ga0070686_1000193243 207
148 3300005547 Ga0070693_100050888 Ga0070693_1000508882 207
149 3300005548 Ga0070665_100264764 Ga0070665_1002647642 207
150 3300005549 Ga0070704_100191452 Ga0070704_1001914522 207
151 3300005564 Ga0070664_100000055 Ga0070664_10000005558 207
152 3300005577 Ga0068857_100005431 Ga0068857_1000054316 207
153 3300005578 Ga0068854_100037114 Ga0068854_1000371143 207
154 3300005617 Ga0068859_100010271 Ga0068859_1000102716 207
155 3300005617 Ga0068859_100169806 Ga0068859_1001698062 207
156 3300005618 Ga0068864_100589966 Ga0068864_1005899662 207
157 3300005718 Ga0068866_10021185 Ga0068866_100211853 207
158 3300005840 Ga0068870_10122520 Ga0068870_101225203 207
159 3300005841 Ga0068863_100171661 Ga0068863_1001716613 207
160 3300005841 Ga0068863_100207203 Ga0068863_1002072032 207
161 3300005841 Ga0068863_100316654 Ga0068863_1003166541 207
162 3300005842 Ga0068858_100072157 Ga0068858_1000721574 207
163 3300005842 Ga0068858_100342874 Ga0068858_1003428742 207
164 3300005843 Ga0068860_100065743 Ga0068860_1000657434 207
165 3300005843 Ga0068860_100342529 Ga0068860_1003425293 207
166 3300005844 Ga0068862_100092309 Ga0068862_1000923095 207
167 3300005844 Ga0068862_100235980 Ga0068862_1002359803 207
168 3300006038 Ga0075365_10002810 Ga0075365_100028102 207
169 3300006038 Ga0075365_10023125 Ga0075365_100231252 207
170 3300006042 Ga0075368_10012444 Ga0075368_100124443 207
171 3300006042 Ga0075368_10020563 Ga0075368_100205632 207
172 3300006042 Ga0075368_10031624 Ga0075368_100316242 207
173 3300006051 Ga0075364_10013958 Ga0075364_100139585 207
174 3300006177 Ga0075362_10000061 Ga0075362_1000006120 207
175 3300006178 Ga0075367_10006307 Ga0075367_100063073 207
176 3300006178 Ga0075367_10006925 Ga0075367_100069253 207
177 3300006178 Ga0075367_10008419 Ga0075367_100084195 207
178 3300006178 Ga0075367_10248645 Ga0075367_102486453 207
179 3300006195 Ga0075366_10003271 Ga0075366_100032713 207
180 3300006195 Ga0075366_10006145 Ga0075366_100061453 207
181 3300006195 Ga0075366_10030616 Ga0075366_100306163 207
182 3300006353 Ga0075370_10003291 Ga0075370_100032916 207
183 3300006358 Ga0068871_100196680 Ga0068871_1001966802 207
184 3300006844 Ga0075428_100002058 Ga0075428_10000205813 207
185 3300006844 Ga0075428_100005718 Ga0075428_1000057183 207
186 3300006844 Ga0075428_100013792 Ga0075428_1000137923 207
187 3300006846 Ga0075430_100002788 Ga0075430_1000027887 207
188 3300006846 Ga0075430_100015560 Ga0075430_1000155603 207
189 3300006846 Ga0075430_100087191 Ga0075430_1000871913 207
190 3300006847 Ga0075431_100027376 Ga0075431_1000273763 207
191 3300006847 Ga0075431_100104551 Ga0075431_1001045514 207
192 3300006852 Ga0075433_10009601 Ga0075433_100096017 207
193 3300006852 Ga0075433_10060651 Ga0075433_100606514 207
194 3300006852 Ga0075433_10080426 Ga0075433_100804262 207
195 3300006852 Ga0075433_10109577 Ga0075433_101095772 207
196 3300006871 Ga0075434_100007606 Ga0075434_1000076064 207
197 3300006871 Ga0075434_100028542 Ga0075434_1000285423 207
198 3300006880 Ga0075429_100004693 Ga0075429_1000046935 207
199 3300006880 Ga0075429_100014262 Ga0075429_1000142623 207
200 3300006880 Ga0075429_100415402 Ga0075429_1004154022 207
201 3300006881 Ga0068865_100177460 Ga0068865_1001774603 207
202 3300006881 Ga0068865_100288436 Ga0068865_1002884362 207
203 3300006881 Ga0068865_100347287 Ga0068865_1003472872 207
204 3300006931 Ga0097620_100010271 Ga0097620_1000102716 207
205 3300006931 Ga0097620_100169809 Ga0097620_1001698092 207
206 3300007076 Ga0075435_100407293 Ga0075435_1004072932 207
207 3300009093 Ga0105240_10208640 Ga0105240_102086403 207
208 3300009094 Ga0111539_10001246 Ga0111539_1000124615 207
209 3300009094 Ga0111539_10301441 Ga0111539_103014412 207
210 3300009094 Ga0111539_10321004 Ga0111539_103210041 207
211 3300009094 Ga0111539_10364501 Ga0111539_103645012 207
212 3300009094 Ga0111539_11051451 Ga0111539_110514511 207
213 3300009094 Ga0111539_11070092 Ga0111539_110700921 207
214 3300009147 Ga0114129_10000802 Ga0114129_1000080213 207
215 3300009147 Ga0114129_10004303 Ga0114129_100043037 207
216 3300009147 Ga0114129_10009647 Ga0114129_100096477 207
217 3300009147 Ga0114129_10010905 Ga0114129_100109055 207
218 3300009147 Ga0114129_10034994 Ga0114129_100349944 207
219 3300009174 Ga0105241_10185120 Ga0105241_101851202 207
220 3300009176 Ga0105242_10163011 Ga0105242_101630111 207
221 3300009177 Ga0105248_10051900 Ga0105248_100519002 207
222 3300009177 Ga0105248_10082953 Ga0105248_100829532 207
223 3300009551 Ga0105238_11006943 Ga0105238_110069432 207
224 3300009553 Ga0105249_10231762 Ga0105249_102317623 207
225 3300009553 Ga0105249_10236922 Ga0105249_102369223 207
226 3300011119 Ga0105246_10451851 Ga0105246_104518512 207
227 3300013306 Ga0163162_10239196 Ga0163162_102391963 207
228 3300014325 Ga0163163_10003686 Ga0163163_100036868 207
229 3300014326 Ga0157380_10096183 Ga0157380_100961835 207
230 3300014326 Ga0157380_10219072 Ga0157380_102190723 207
231 3300014326 Ga0157380_10491317 Ga0157380_104913172 207
232 3300014745 Ga0157377_10387671 Ga0157377_103876712 207
233 3300014968 Ga0157379_10101301 Ga0157379_101013014 207
234 3300020070 Ga0206356_10495523 Ga0206356_104955232 207
235 3300020082 Ga0206353_11656120 Ga0206353_116561202 207
236 3300025315 Ga0207697_10004399 Ga0207697_100043995 207
237 3300025315 Ga0207697_10041592 Ga0207697_100415923 207
238 3300025893 Ga0207682_10077066 Ga0207682_100770663 207
239 3300025899 Ga0207642_10054361 Ga0207642_100543613 207
240 3300025901 Ga0207688_10007207 Ga0207688_100072075 207
241 3300025903 Ga0207680_10230733 Ga0207680_102307332 207
242 3300025907 Ga0207645_10001201 Ga0207645_1000120119 207
243 3300025911 Ga0207654_10069998 Ga0207654_100699982 207
244 3300025913 Ga0207695_10382961 Ga0207695_103829613 207
245 3300025918 Ga0207662_10001608 Ga0207662_100016087 207
246 3300025919 Ga0207657_10141061 Ga0207657_101410614 207
247 3300025920 Ga0207649_10011364 Ga0207649_100113644 207
248 3300025923 Ga0207681_10362414 Ga0207681_103624142 207
249 3300025923 Ga0207681_10909578 Ga0207681_109095781 207
250 3300025925 Ga0207650_10006970 Ga0207650_100069705 207
251 3300025925 Ga0207650_10043796 Ga0207650_100437964 207
252 3300025925 Ga0207650_10090005 Ga0207650_100900053 207
253 3300025931 Ga0207644_10017174 Ga0207644_100171743 207
254 3300025932 Ga0207690_10172193 Ga0207690_101721933 207
255 3300025933 Ga0207706_10263711 Ga0207706_102637112 207
256 3300025933 Ga0207706_10393647 Ga0207706_103936472 207
257 3300025935 Ga0207709_10087347 Ga0207709_100873472 207
258 3300025936 Ga0207670_10092046 Ga0207670_100920462 207
259 3300025937 Ga0207669_10086195 Ga0207669_100861952 207
260 3300025937 Ga0207669_10116313 Ga0207669_101163132 207
261 3300025938 Ga0207704_10085028 Ga0207704_100850282 207
262 3300025940 Ga0207691_10005745 Ga0207691_100057457 207
263 3300025941 Ga0207711_10010775 Ga0207711_100107753 207
264 3300025942 Ga0207689_10029601 Ga0207689_100296013 207
265 3300025942 Ga0207689_10139855 Ga0207689_101398552 207
266 3300025942 Ga0207689_10187772 Ga0207689_101877723 207
267 3300025944 Ga0207661_10001501 Ga0207661_100015017 207
268 3300025944 Ga0207661_10010761 Ga0207661_100107613 207
269 3300025945 Ga0207679_10001458 Ga0207679_100014588 207
270 3300025945 Ga0207679_10110036 Ga0207679_101100363 207
271 3300025945 Ga0207679_10289957 Ga0207679_102899573 207
272 3300025960 Ga0207651_10017838 Ga0207651_100178385 207
273 3300025960 Ga0207651_10271792 Ga0207651_102717922 207
274 3300025961 Ga0207712_10281742 Ga0207712_102817422 207
275 3300025972 Ga0207668_10111723 Ga0207668_101117232 207
276 3300025986 Ga0207658_10264826 Ga0207658_102648263 207
277 3300026023 Ga0207677_10019893 Ga0207677_100198933 207
278 3300026041 Ga0207639_10555840 Ga0207639_105558401 207
279 3300026067 Ga0207678_10164837 Ga0207678_101648372 207
280 3300026075 Ga0207708_10007592 Ga0207708_100075923 207
281 3300026089 Ga0207648_10002017 Ga0207648_1000201720 207
282 3300026089 Ga0207648_10640036 Ga0207648_106400362 207
283 3300026095 Ga0207676_10533177 Ga0207676_105331772 207
284 3300026116 Ga0207674_10012913 Ga0207674_100129133 207
285 3300026118 Ga0207675_100182794 Ga0207675_1001827942 207
286 3300027866 Ga0209813_10022672 Ga0209813_100226721 207
287 3300027907 Ga0207428_10001731 Ga0207428_100017318 207
288 3300027907 Ga0207428_10017737 Ga0207428_100177372 207
289 3300028379 Ga0268266_10247784 Ga0268266_102477842 207
290 3300031548 Ga0307408_100006200 Ga0307408_1000062006 207
291 3300031731 Ga0307405_10011660 Ga0307405_100116603 207
292 3300031731 Ga0307405_10051855 Ga0307405_100518552 207
293 3300031824 Ga0307413_10011842 Ga0307413_100118426 207
294 3300031824 Ga0307413_10410230 Ga0307413_104102302 207
295 3300031852 Ga0307410_10043397 Ga0307410_100433973 207
296 3300031903 Ga0307407_10107933 Ga0307407_101079332 207
297 3300031903 Ga0307407_10108326 Ga0307407_101083263 207
298 3300031903 Ga0307407_10265800 Ga0307407_102658002 207
299 3300031911 Ga0307412_10051756 Ga0307412_100517562 207
300 3300031911 Ga0307412_10206255 Ga0307412_102062551 207
301 3300031911 Ga0307412_10768807 Ga0307412_107688072 207
302 3300031995 Ga0307409_100070998 Ga0307409_1000709983 207
303 3300031995 Ga0307409_100414196 Ga0307409_1004141962 207
304 3300032002 Ga0307416_100091310 Ga0307416_1000913105 207
305 3300032002 Ga0307416_100302030 Ga0307416_1003020302 207
306 3300032002 Ga0307416_100515253 Ga0307416_1005152532 207
307 3300032004 Ga0307414_10030904 Ga0307414_100309045 207
308 3300032004 Ga0307414_10196717 Ga0307414_101967172 207
309 3300032004 Ga0307414_10795628 Ga0307414_107956281 207
310 3300032005 Ga0307411_10087010 Ga0307411_100870102 207
311 3300032005 Ga0307411_10094111 Ga0307411_100941113 207
312 3300032126 Ga0307415_100039239 Ga0307415_1000392393 207
313 3300032126 Ga0307415_100532947 Ga0307415_1005329472 207
314 3300032126 Ga0307415_100813694 Ga0307415_1008136942 207
315 3300035114 Ga0373939_0125374 Ga0373939_0125374_93_740 207
316 3300035116 Ga0373945_0164934 Ga0373945_0164934_204_842 207
317 3300035172 Ga0373955_0168595 Ga0373955_0168595_597_1247 207
318 3300035241 Ga0373961_0045771 Ga0373961_0045771_519_1166 207
319 3300035242 Ga0373962_0093870 Ga0373962_0093870_164_811 207
320 3300035691 Ga0373931_0011920 Ga0373931_0011920_3528_4175 207
321 3300035724 Ga0373933_0053752 Ga0373933_0053752_1255_1905 207
322 3300035725 Ga0373947_0055933 Ga0373947_0055933_905_1555 207
323 3300036401 Ga0373937_0001439 Ga0373937_0001439_5188_5838 207
324 3300041460 Ga0451802_0240854 Ga0451802_0240854_109_747 207
325 3300041997 Ga0439431_0107863 Ga0439431_0107863_40_681 207
326 3300042002 Ga0439442_073445 Ga0439442_073445_45_683 207
327 3300042007 Ga0439449_0228716 Ga0439449_0228716_13_651 207
328 3300042008 Ga0439450_072176 Ga0439450_072176_10_690 207
329 3300042125 Ga0450923_047343 Ga0450923_047343_21_659 207
330 3300042156 Ga0439446_0019793 Ga0439446_0019793_273_914 207
331 3300042436 Ga0439435_0071420 Ga0439435_0071420_281_946 207
332 3300042439 Ga0439464_0007639 Ga0439464_0007639_86_766 207
333 3300042876 Ga0451577_0050378 Ga0451577_0050378_848_1486 207
334 3300044842 Ga0466957_0495201 Ga0466957_0495201_194_832 207
335 3300045976 Ga0466967_0429942 Ga0466967_0429942_100_738 207
336 3300046455 Ga0495603_0184248 Ga0495603_0184248_463_1161 207
337 3300046499 Ga0495594_0477034 Ga0495594_0477034_17_655 207
338 3300046559 Ga0495667_0088435 Ga0495667_0088435_593_1240 207
339 3300046642 Ga0495634_0108725 Ga0495634_0108725_25_672 207
340 3300046680 Ga0495646_0109925 Ga0495646_0109925_59_709 207
341 3300046683 Ga0495658_0078674 Ga0495658_0078674_357_1001 207
342 3300046689 Ga0495613_0380810 Ga0495613_0380810_209_853 207
343 3300047319 Ga0495674_0136016 Ga0495674_0136016_936_1586 207
344 3300048905 Ga0496102_0372185 Ga0496102_0372185_43_681 207
345 3300048907 Ga0496104_0001736 Ga0496104_0001736_3568_4206 207
346 3300048908 Ga0496105_0043932 Ga0496105_0043932_1704_2342 207
347 3300048909 Ga0496106_0142503 Ga0496106_0142503_1187_1834 207
348 3300048910 Ga0496107_0083476 Ga0496107_0083476_1065_1703 207
349 3300048911 Ga0496108_0001282 Ga0496108_0001282_1026_1664 207
350 3300048911 Ga0496108_0334884 Ga0496108_0334884_661_1299 207
351 3300048912 Ga0496109_0000572 Ga0496109_0000572_13096_13734 207
352 3300048913 Ga0496110_0004885 Ga0496110_0004885_8835_9473 207
353 3300048913 Ga0496110_0167916 Ga0496110_0167916_420_1058 207
354 3300048913 Ga0496110_0186962 Ga0496110_0186962_726_1364 207
355 3300048914 Ga0496111_0052625 Ga0496111_0052625_367_1005 207
356 3300048914 Ga0496111_0272339 Ga0496111_0272339_559_1197 207
357 3300048915 Ga0496112_0000217 Ga0496112_0000217_14761_15399 207
358 3300048915 Ga0496112_0022045 Ga0496112_0022045_5211_5849 207
359 3300048916 Ga0496113_0456634 Ga0496113_0456634_215_862 207
360 3300049571 Ga0501034_0012830 Ga0501034_0012830_2119_2766 207
361 3300049572 Ga0501036_0416140 Ga0501036_0416140_433_1071 207
362 3300049577 Ga0501041_0122000 Ga0501041_0122000_215_853 207
363 3300049577 Ga0501041_0278041 Ga0501041_0278041_12_650 207
364 3300049581 Ga0501047_0238941 Ga0501047_0238941_571_1215 207
365 3300049581 Ga0501047_0345094 Ga0501047_0345094_380_1027 207
366 3300049583 Ga0501067_0247202 Ga0501067_0247202_297_935 207
367 3300049585 Ga0501069_0074145 Ga0501069_0074145_445_1083 207
368 3300049586 Ga0501070_0644885 Ga0501070_0644885_107_745 207
369 3300049587 Ga0501071_0109082 Ga0501071_0109082_170_808 207
370 3300049587 Ga0501071_0312007 Ga0501071_0312007_83_721 207
371 3300049588 Ga0501072_0508123 Ga0501072_0508123_136_774 207
372 3300049590 Ga0501074_0146853 Ga0501074_0146853_271_909 207
373 3300049591 Ga0501075_0036542 Ga0501075_0036542_949_1587 207
374 3300049591 Ga0501075_0278376 Ga0501075_0278376_618_1256 207
375 3300049591 Ga0501075_0287763 Ga0501075_0287763_84_722 207
376 3300049592 Ga0501076_0029848 Ga0501076_0029848_3096_3734 207
377 3300049593 Ga0501077_0173457 Ga0501077_0173457_333_971 207
378 3300049704 Ga0501221_075703 Ga0501221_075703_78_743 207
379 3300049741 Ga0501079_0050995 Ga0501079_0050995_303_935 207
380 3300049741 Ga0501079_0358897 Ga0501079_0358897_410_1048 207
381 3300049742 Ga0501080_0013058 Ga0501080_0013058_6258_6896 207
382 3300049742 Ga0501080_0225768 Ga0501080_0225768_615_1262 207
383 3300049743 Ga0501081_0006124 Ga0501081_0006124_6656_7288 207
384 3300049743 Ga0501081_0021246 Ga0501081_0021246_1059_1697 207
385 3300049824 Ga0501045_0506550 Ga0501045_0506550_121_759 207
386 3300050491 nmdc:mga00v17_11646_c1 nmdc:mga00v17_11646_c1_3404_4051 207
387 3300050491 nmdc:mga00v17_1208_c1 nmdc:mga00v17_1208_c1_5479_6126 207
388 3300050492 nmdc:mga0yw44_16283_c1 nmdc:mga0yw44_16283_c1_685_1323 207
389 3300050492 nmdc:mga0yw44_59920_c1 nmdc:mga0yw44_59920_c1_602_1249 207
390 3300050493 nmdc:mga0k408_3364_c1 nmdc:mga0k408_3364_c1_130_768 207
391 3300050493 nmdc:mga0k408_37077_c1 nmdc:mga0k408_37077_c1_939_1586 207
392 3300050493 nmdc:mga0k408_4353_c1 nmdc:mga0k408_4353_c1_2978_3625 207
393 3300050494 nmdc:mga06z11_223886_c1 nmdc:mga06z11_223886_c1_389_1036 207
394 3300050494 nmdc:mga06z11_2962_c1 nmdc:mga06z11_2962_c1_2833_3480 207
395 3300050494 nmdc:mga06z11_3795_c1 nmdc:mga06z11_3795_c1_470_1117 207
396 3300050495 nmdc:mga04h51_141089_c1 nmdc:mga04h51_141089_c1_40_687 207
397 3300050507 nmdc:mga05p37_10279_c1 nmdc:mga05p37_10279_c1_4559_5191 207
398 3300050507 nmdc:mga05p37_30741_c1 nmdc:mga05p37_30741_c1_92_730 207
399 3300050507 nmdc:mga05p37_314958_c1 nmdc:mga05p37_314958_c1_85_723 207
400 3300050507 nmdc:mga05p37_32697_c1 nmdc:mga05p37_32697_c1_4520_5158 207
401 3300050507 nmdc:mga05p37_7719_c1 nmdc:mga05p37_7719_c1_10213_10878 207
402 3300050507 nmdc:mga05p37_8024_c1 nmdc:mga05p37_8024_c1_10218_10880 207
403 3300050508 nmdc:mga09592_2893_c1 nmdc:mga09592_2893_c1_8868_9533 207
404 3300050509 nmdc:mga0qj67_107929_c1 nmdc:mga0qj67_107929_c1_222_860 207
405 3300050509 nmdc:mga0qj67_324770_c1 nmdc:mga0qj67_324770_c1_242_880 207
406 3300050509 nmdc:mga0qj67_5114_c1 nmdc:mga0qj67_5114_c1_7459_8097 207
407 3300050509 nmdc:mga0qj67_794_c1 nmdc:mga0qj67_794_c1_17012_17677 207
408 3300050510 nmdc:mga06r32_723832_c1 nmdc:mga06r32_723832_c1_252_890 207
409 3300050510 nmdc:mga06r32_78570_c1 nmdc:mga06r32_78570_c1_1827_2465 207
410 3300050511 nmdc:mga08y16_130156_c1 nmdc:mga08y16_130156_c1_838_1518 207
411 3300050511 nmdc:mga08y16_2029_c1 nmdc:mga08y16_2029_c1_9365_10030 207
412 3300050511 nmdc:mga08y16_957265_c1 nmdc:mga08y16_957265_c1_161_814 207
413 3300050512 nmdc:mga0n895_118543_c1 nmdc:mga0n895_118543_c1_650_1297 207
414 3300050512 nmdc:mga0n895_6302_c1 nmdc:mga0n895_6302_c1_3230_3868 207
415 3300050513 nmdc:mga0rr50_215427_c1 nmdc:mga0rr50_215427_c1_765_1403 207
416 3300050513 nmdc:mga0rr50_35899_c1 nmdc:mga0rr50_35899_c1_805_1452 207
417 3300050515 nmdc:mga0a205_18953_c1 nmdc:mga0a205_18953_c1_2801_3463 207
418 3300050515 nmdc:mga0a205_195795_c1 nmdc:mga0a205_195795_c1_684_1322 207
419 3300053077 Ga0495601_0035439 Ga0495601_0035439_1407_2057 207
420 3300053084 Ga0495595_0097526 Ga0495595_0097526_568_1218 207
421 3300053084 Ga0495595_0149778 Ga0495595_0149778_119_766 207
422 3300053085 Ga0495619_0154173 Ga0495619_0154173_94_741 207
423 3300054114 Ga0501084_0124323 Ga0501084_0124323_581_1219 207
424 3300054114 Ga0501084_0129921 Ga0501084_0129921_90_728 207
425 3300059421 Ga0590071_001485 Ga0590071_001485_3693_4331 207
426 3300059424 Ga0590075_001106 Ga0590075_001106_1867_2505 207
427 3300059426 Ga0590077_002251 Ga0590077_002251_2588_3226 207
428 3300060353 Ga0501082_0603908 Ga0501082_0603908_183_821 207
429 3300061734 Ga0530510_0367289 Ga0530510_0367289_424_1056 207
430 3300005329 Ga0070683_100588023 Ga0070683_1005880232 208
431 3300005331 Ga0070670_100283004 Ga0070670_1002830042 208
432 3300005344 Ga0070661_100285177 Ga0070661_1002851772 208
433 3300005354 Ga0070675_100181715 Ga0070675_1001817151 208
434 3300005355 Ga0070671_100194137 Ga0070671_1001941372 208
435 3300005456 Ga0070678_100797685 Ga0070678_1007976851 208
436 3300005471 Ga0070698_100036799 Ga0070698_1000367993 208
437 3300005535 Ga0070684_100570715 Ga0070684_1005707152 208
438 3300005543 Ga0070672_100011885 Ga0070672_1000118853 208
439 3300005545 Ga0070695_100038534 Ga0070695_1000385345 208
440 3300005577 Ga0068857_100189683 Ga0068857_1001896833 208
441 3300006237 Ga0097621_100323220 Ga0097621_1003232203 208
442 3300006844 Ga0075428_100002186 Ga0075428_1000021867 208
443 3300006846 Ga0075430_100188828 Ga0075430_1001888283 208
444 3300006852 Ga0075433_10259057 Ga0075433_102590572 208
445 3300006880 Ga0075429_100036803 Ga0075429_1000368033 208
446 3300009094 Ga0111539_10009925 Ga0111539_100099257 208
447 3300009147 Ga0114129_10032450 Ga0114129_100324503 208
448 3300013296 Ga0157374_10260324 Ga0157374_102603243 208
449 3300013308 Ga0157375_11360521 Ga0157375_113605212 208
450 3300014969 Ga0157376_10080953 Ga0157376_100809532 208
451 3300014969 Ga0157376_10381974 Ga0157376_103819742 208
452 3300025920 Ga0207649_10286088 Ga0207649_102860882 208
453 3300025923 Ga0207681_10213860 Ga0207681_102138603 208
454 3300025931 Ga0207644_10384381 Ga0207644_103843812 208
455 3300025940 Ga0207691_10169722 Ga0207691_101697221 208
456 3300026121 Ga0207683_10961281 Ga0207683_109612811 208
457 3300028381 Ga0268264_10645178 Ga0268264_106451782 208
458 3300031731 Ga0307405_10012845 Ga0307405_100128453 208
459 3300031852 Ga0307410_10044118 Ga0307410_100441183 208
460 3300031903 Ga0307407_10095160 Ga0307407_100951603 208
461 3300031911 Ga0307412_10019332 Ga0307412_100193322 208
462 3300031995 Ga0307409_100017600 Ga0307409_1000176005 208
463 3300031995 Ga0307409_100023507 Ga0307409_1000235073 208
464 3300032002 Ga0307416_100003678 Ga0307416_1000036784 208
465 3300032002 Ga0307416_100012528 Ga0307416_1000125283 208
466 3300032004 Ga0307414_10031132 Ga0307414_100311322 208
467 3300032004 Ga0307414_10314510 Ga0307414_103145102 208
468 3300032005 Ga0307411_10030399 Ga0307411_100303993 208
469 3300032126 Ga0307415_100055135 Ga0307415_1000551353 208
470 3300032126 Ga0307415_101042865 Ga0307415_1010428651 208
471 3300041458 Ga0451798_0999571 Ga0451798_0999571_54_680 208
472 3300046499 Ga0495594_0251175 Ga0495594_0251175_318_959 208
473 3300050507 nmdc:mga05p37_692514_c1 nmdc:mga05p37_692514_c1_11_637 208
474 3300050508 nmdc:mga09592_13838_c1 nmdc:mga09592_13838_c1_4241_4867 208
475 3300050509 nmdc:mga0qj67_52953_c2 nmdc:mga0qj67_52953_c2_969_1595 208
476 3300050510 nmdc:mga06r32_68021_c1 nmdc:mga06r32_68021_c1_1040_1666 208
477 3300050515 nmdc:mga0a205_94173_c1 nmdc:mga0a205_94173_c1_1838_2473 208
478 3300005289 Ga0065704_10265935 Ga0065704_102659352 209
479 3300005295 Ga0065707_10001636 Ga0065707_100016364 209
480 3300009147 Ga0114129_10087394 Ga0114129_100873943 209
481 3300009147 Ga0114129_10220396 Ga0114129_102203962 209
482 3300009147 Ga0114129_11144541 Ga0114129_111445412 209
483 3300031824 Ga0307413_10222171 Ga0307413_102221712 209
484 3300031903 Ga0307407_10390630 Ga0307407_103906302 209
485 3300035691 Ga0373931_0170531 Ga0373931_0170531_214_843 209
486 3300044673 Ga0453683_0000748 Ga0453683_0000748_27605_28234 209
487 3300045051 Ga0451576_0028911 Ga0451576_0028911_4522_5151 209
488 3300049770 Ga0501273_031241 Ga0501273_031241_62_691 209
489 3300050507 nmdc:mga05p37_26364_c1 nmdc:mga05p37_26364_c1_3236_3865 209
490 3300050507 nmdc:mga05p37_316449_c1 nmdc:mga05p37_316449_c1_188_817 209
491 3300050507 nmdc:mga05p37_3405_c1 nmdc:mga05p37_3405_c1_251_880 209
492 3300050507 nmdc:mga05p37_441148_c1 nmdc:mga05p37_441148_c1_135_764 209
493 3300050510 nmdc:mga06r32_34767_c1 nmdc:mga06r32_34767_c1_2021_2650 209
494 3300050512 nmdc:mga0n895_357246_c1 nmdc:mga0n895_357246_c1_710_1339 209
495 3300050515 nmdc:mga0a205_67532_c1 nmdc:mga0a205_67532_c1_2083_2712 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

53

213

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xmk-assembly1.cif.gz_I cryo-em structure of the atp-bound vps4 mutant-e233q complex with vta1 (masked) 0.9164 6 40
5xmk-assembly1.cif.gz_M cryo-em structure of the atp-bound vps4 mutant-e233q complex with vta1 (masked) 0.9004 6 40
2rkl-assembly2.cif.gz_D crystal structure of s.cerevisiae vta1 c-terminal domain 0.8986 6 40
7cnx-assembly2.cif.gz_E crystal structure of apo psd from e. coli (2.63 a) 0.8193 44 176
2rkl-assembly2.cif.gz_D crystal structure of s.cerevisiae vta1 c-terminal domain 0.7491 6 40
ID Description Score Start End Superfamily
af_A0A1P8BFL1_384_528_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9345 5 41 1.25.40.10
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9342 37 206 2.70.70.10
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9085 37 206 2.70.70.10
3ax2G00 Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain 0.9034 4 40 1.20.960.10
af_Q4D7C7_4_76_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9023 4 40 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A0Y1BSU0-F1-model_v4 deleted 0.9892 107 207
AF-A0A1V3WNV3-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9884 98 209 GO:0004609
GO:0005886
GO:0008654
AF-A0A359LQR7-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9854 84 209 GO:0004609
GO:0005886
GO:0008654
AF-A0A7Z9S463-F1-model_v4 Phosphatidylserine decarboxylase family protein (EC 4.1.1.65) 0.9835 84 206 GO:0004609
GO:0005886
GO:0008654
AF-A0A378VWY5-F1-model_v4 Phosphatidylserine decarboxylase 0.9811 94 209 GO:0004609
GO:0005886
GO:0008654

Feature Viewer

pLDDT pTM Quality
93.73 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map