F454692
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 495 | 245 | 495 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10118067|Ga0070681_101180672 |
| Length | 221 |
| Sequence | MEFGRPAALQPASFFAFMRIDRAGLPFIAGALVPAALLASTRRYGWAAACAAVGGFMTYFFRDPDRDVPQAPGLVVSPADGRVMWTPPGDWQQITIFLSPLDVHINRTPVDGRVTRIEYRPGAFLPAYKHDAAANELNEIWIDHGGETVVVRQIVGALARRIVCRVQEGQTLARGERIGLMKFGSRMDVFLPPRAELMVQVGQSVVAGVTVLARLQAPPHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 137 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 138 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 157 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 158 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 159 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 160 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 161 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 162 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 163 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 164 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 165 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 166 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 167 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 168 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 169 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 221 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 225 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 226 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 227 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 242 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 243 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 244 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.45 |
| Nodule | 0 |
| Rhizoplane | 3.84 |
| Rhizosphere | 90.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10265935 | 3300005289 | Unclassified | 954 |
| 2 | Ga0065712_10171297 | 3300005290 | Bacteria | 1242 |
| 3 | Ga0065707_10001636 | 3300005295 | Bacteria | 5935 |
| 4 | Ga0070676_10069368 | 3300005328 | Bacteria | 2113 |
| 5 | Ga0070683_100000817 | 3300005329 | Bacteria | 23098 |
| 6 | Ga0070683_100028392 | 3300005329 | Bacteria | 5056 |
| 7 | Ga0070683_100588023 | 3300005329 | Bacteria | 1065 |
| 8 | Ga0070690_100017099 | 3300005330 | Bacteria | 4354 |
| 9 | Ga0070670_100003221 | 3300005331 | Bacteria | 13474 |
| 10 | Ga0070670_100004636 | 3300005331 | Bacteria | 11531 |
| 11 | Ga0070670_100010107 | 3300005331 | Bacteria | 8050 |
| 12 | Ga0070670_100028331 | 3300005331 | Bacteria | 4820 |
| 13 | Ga0070670_100036316 | 3300005331 | Bacteria | 4240 |
| 14 | Ga0070670_100283004 | 3300005331 | Bacteria | 1448 |
| 15 | Ga0068869_100029706 | 3300005334 | Bacteria | 3833 |
| 16 | Ga0068869_100084082 | 3300005334 | Bacteria | 2381 |
| 17 | Ga0070680_100223332 | 3300005336 | Bacteria | 1590 |
| 18 | Ga0070680_100237545 | 3300005336 | Bacteria | 1540 |
| 19 | Ga0070660_100230450 | 3300005339 | Bacteria | 1507 |
| 20 | Ga0070661_100019679 | 3300005344 | Bacteria | 4811 |
| 21 | Ga0070661_100285177 | 3300005344 | Bacteria | 1282 |
| 22 | Ga0070669_100018097 | 3300005353 | Bacteria | 5032 |
| 23 | Ga0070669_100636540 | 3300005353 | Bacteria | 896 |
| 24 | Ga0070675_100181715 | 3300005354 | Bacteria | 1819 |
| 25 | Ga0070675_100308236 | 3300005354 | Bacteria | 1396 |
| 26 | Ga0070675_100626747 | 3300005354 | Unclassified | 976 |
| 27 | Ga0070671_100080234 | 3300005355 | Bacteria | 2728 |
| 28 | Ga0070671_100111755 | 3300005355 | Bacteria | 2295 |
| 29 | Ga0070671_100194137 | 3300005355 | Bacteria | 1721 |
| 30 | Ga0070671_100773478 | 3300005355 | Bacteria | 835 |
| 31 | Ga0070674_100000654 | 3300005356 | Bacteria | 17477 |
| 32 | Ga0070674_100019975 | 3300005356 | Bacteria | 4269 |
| 33 | Ga0070674_100029284 | 3300005356 | Bacteria | 3624 |
| 34 | Ga0070674_100062012 | 3300005356 | Bacteria | 2611 |
| 35 | Ga0070674_100115364 | 3300005356 | Unclassified | 1980 |
| 36 | Ga0070673_100009321 | 3300005364 | Bacteria | 6587 |
| 37 | Ga0070673_100174748 | 3300005364 | Bacteria | 1835 |
| 38 | Ga0070688_100160743 | 3300005365 | Bacteria | 1543 |
| 39 | Ga0070688_100295021 | 3300005365 | Unclassified | 1170 |
| 40 | Ga0070659_100560089 | 3300005366 | Bacteria | 979 |
| 41 | Ga0070667_100065911 | 3300005367 | Bacteria | 3076 |
| 42 | Ga0070711_100051768 | 3300005439 | Bacteria | 2822 |
| 43 | Ga0070705_100071526 | 3300005440 | Bacteria | 2098 |
| 44 | Ga0070700_100062091 | 3300005441 | Bacteria | 2359 |
| 45 | Ga0070700_100339272 | 3300005441 | Bacteria | 1110 |
| 46 | Ga0070694_100397553 | 3300005444 | Unclassified | 1078 |
| 47 | Ga0070694_100526667 | 3300005444 | Bacteria | 944 |
| 48 | Ga0070663_100223878 | 3300005455 | Bacteria | 1478 |
| 49 | Ga0070678_100797685 | 3300005456 | Bacteria | 857 |
| 50 | Ga0070662_100134699 | 3300005457 | Bacteria | 1909 |
| 51 | Ga0070662_100172076 | 3300005457 | Bacteria | 1701 |
| 52 | Ga0070662_100313251 | 3300005457 | Bacteria | 1278 |
| 53 | Ga0070681_10118067 | 3300005458 | Bacteria | 2589 |
| 54 | Ga0070681_10598231 | 3300005458 | Bacteria | 1017 |
| 55 | Ga0070681_10636585 | 3300005458 | Unclassified | 981 |
| 56 | Ga0070685_10193628 | 3300005466 | Bacteria | 1317 |
| 57 | Ga0070706_100144425 | 3300005467 | Unclassified | 2222 |
| 58 | Ga0070698_100036799 | 3300005471 | Bacteria | 5051 |
| 59 | Ga0070699_100011273 | 3300005518 | Bacteria | 7723 |
| 60 | Ga0070699_100143928 | 3300005518 | Bacteria | 2106 |
| 61 | Ga0070699_100267611 | 3300005518 | Bacteria | 1529 |
| 62 | Ga0070684_100000538 | 3300005535 | Bacteria | 26032 |
| 63 | Ga0070684_100045383 | 3300005535 | Bacteria | 3806 |
| 64 | Ga0070684_100570715 | 3300005535 | Unclassified | 1051 |
| 65 | Ga0070672_100011885 | 3300005543 | Bacteria | 6085 |
| 66 | Ga0070672_100345176 | 3300005543 | Bacteria | 1268 |
| 67 | Ga0070672_100519913 | 3300005543 | Bacteria | 1031 |
| 68 | Ga0070686_100019324 | 3300005544 | Bacteria | 4012 |
| 69 | Ga0070695_100038534 | 3300005545 | Bacteria | 3017 |
| 70 | Ga0070693_100050888 | 3300005547 | Bacteria | 2370 |
| 71 | Ga0070665_100264764 | 3300005548 | Bacteria | 1720 |
| 72 | Ga0070704_100191452 | 3300005549 | Bacteria | 1644 |
| 73 | Ga0068855_100832248 | 3300005563 | Bacteria | 979 |
| 74 | Ga0070664_100000055 | 3300005564 | Bacteria | 69107 |
| 75 | Ga0070664_100306314 | 3300005564 | Unclassified | 1436 |
| 76 | Ga0068857_100005431 | 3300005577 | Bacteria | 10868 |
| 77 | Ga0068857_100189683 | 3300005577 | Bacteria | 1872 |
| 78 | Ga0068854_100037114 | 3300005578 | Bacteria | 3418 |
| 79 | Ga0068859_100010271 | 3300005617 | Bacteria | 9424 |
| 80 | Ga0068859_100169806 | 3300005617 | Bacteria | 2262 |
| 81 | Ga0068859_100766823 | 3300005617 | Unclassified | 1053 |
| 82 | Ga0068864_100589966 | 3300005618 | Unclassified | 1077 |
| 83 | Ga0068866_10021185 | 3300005718 | Bacteria | 2991 |
| 84 | Ga0068870_10122520 | 3300005840 | Bacteria | 1500 |
| 85 | Ga0068863_100171661 | 3300005841 | Unclassified | 2080 |
| 86 | Ga0068863_100207203 | 3300005841 | Bacteria | 1887 |
| 87 | Ga0068863_100316654 | 3300005841 | Bacteria | 1515 |
| 88 | Ga0068858_100072157 | 3300005842 | Bacteria | 3203 |
| 89 | Ga0068858_100342874 | 3300005842 | Bacteria | 1430 |
| 90 | Ga0068860_100065743 | 3300005843 | Bacteria | 3444 |
| 91 | Ga0068860_100342529 | 3300005843 | Bacteria | 1470 |
| 92 | Ga0068862_100092309 | 3300005844 | Bacteria | 2639 |
| 93 | Ga0068862_100235980 | 3300005844 | Unclassified | 1661 |
| 94 | Ga0081539_10073335 | 3300005985 | Bacteria | 1826 |
| 95 | Ga0075365_10002810 | 3300006038 | Bacteria | 8719 |
| 96 | Ga0075365_10023125 | 3300006038 | Bacteria | 3905 |
| 97 | Ga0075368_10012444 | 3300006042 | Bacteria | 3110 |
| 98 | Ga0075368_10020563 | 3300006042 | Bacteria | 2501 |
| 99 | Ga0075368_10031624 | 3300006042 | Bacteria | 2053 |
| 100 | Ga0075364_10013958 | 3300006051 | Bacteria | 4951 |
| 101 | Ga0075362_10000061 | 3300006177 | Bacteria | 33316 |
| 102 | Ga0075367_10006307 | 3300006178 | Bacteria | 5980 |
| 103 | Ga0075367_10006925 | 3300006178 | Bacteria | 5771 |
| 104 | Ga0075367_10008419 | 3300006178 | Bacteria | 5343 |
| 105 | Ga0075367_10248645 | 3300006178 | Unclassified | 1115 |
| 106 | Ga0075366_10003271 | 3300006195 | Bacteria | 8519 |
| 107 | Ga0075366_10006145 | 3300006195 | Bacteria | 6551 |
| 108 | Ga0075366_10030616 | 3300006195 | Bacteria | 3164 |
| 109 | Ga0097621_100273900 | 3300006237 | Bacteria | 1484 |
| 110 | Ga0097621_100323220 | 3300006237 | Bacteria | 1367 |
| 111 | Ga0097621_100876477 | 3300006237 | Unclassified | 835 |
| 112 | Ga0075370_10003291 | 3300006353 | Bacteria | 7664 |
| 113 | Ga0068871_100196680 | 3300006358 | Bacteria | 1739 |
| 114 | Ga0075428_100002058 | 3300006844 | Bacteria | 21689 |
| 115 | Ga0075428_100002186 | 3300006844 | Bacteria | 21167 |
| 116 | Ga0075428_100003760 | 3300006844 | Bacteria | 16637 |
| 117 | Ga0075428_100005718 | 3300006844 | Bacteria | 13821 |
| 118 | Ga0075428_100013792 | 3300006844 | Bacteria | 9001 |
| 119 | Ga0075430_100002788 | 3300006846 | Bacteria | 14603 |
| 120 | Ga0075430_100015560 | 3300006846 | Bacteria | 6475 |
| 121 | Ga0075430_100031398 | 3300006846 | Bacteria | 4508 |
| 122 | Ga0075430_100087191 | 3300006846 | Bacteria | 2612 |
| 123 | Ga0075430_100188828 | 3300006846 | Bacteria | 1713 |
| 124 | Ga0075431_100027376 | 3300006847 | Bacteria | 5848 |
| 125 | Ga0075431_100104551 | 3300006847 | Unclassified | 2922 |
| 126 | Ga0075431_100167114 | 3300006847 | Bacteria | 2261 |
| 127 | Ga0075433_10009601 | 3300006852 | Bacteria | 7742 |
| 128 | Ga0075433_10060651 | 3300006852 | Bacteria | 3313 |
| 129 | Ga0075433_10080426 | 3300006852 | Bacteria | 2873 |
| 130 | Ga0075433_10109577 | 3300006852 | Bacteria | 2450 |
| 131 | Ga0075433_10259057 | 3300006852 | Bacteria | 1542 |
| 132 | Ga0075433_10575648 | 3300006852 | Bacteria | 989 |
| 133 | Ga0075434_100007606 | 3300006871 | Bacteria | 10031 |
| 134 | Ga0075434_100028542 | 3300006871 | Bacteria | 5484 |
| 135 | Ga0075429_100004693 | 3300006880 | Bacteria | 11764 |
| 136 | Ga0075429_100014262 | 3300006880 | Bacteria | 6891 |
| 137 | Ga0075429_100036803 | 3300006880 | Bacteria | 4259 |
| 138 | Ga0075429_100176707 | 3300006880 | Unclassified | 1871 |
| 139 | Ga0075429_100415402 | 3300006880 | Bacteria | 1178 |
| 140 | Ga0068865_100177460 | 3300006881 | Bacteria | 1638 |
| 141 | Ga0068865_100288436 | 3300006881 | Bacteria | 1309 |
| 142 | Ga0068865_100347287 | 3300006881 | Bacteria | 1201 |
| 143 | Ga0097620_100010271 | 3300006931 | Bacteria | 9424 |
| 144 | Ga0097620_100169809 | 3300006931 | Bacteria | 2262 |
| 145 | Ga0097620_100767044 | 3300006931 | Unclassified | 1053 |
| 146 | Ga0075435_100407293 | 3300007076 | Unclassified | 1170 |
| 147 | Ga0105240_10082364 | 3300009093 | Bacteria | 3952 |
| 148 | Ga0105240_10208640 | 3300009093 | Bacteria | 2284 |
| 149 | Ga0111539_10001246 | 3300009094 | Bacteria | 33877 |
| 150 | Ga0111539_10009925 | 3300009094 | Bacteria | 12011 |
| 151 | Ga0111539_10301441 | 3300009094 | Bacteria | 1865 |
| 152 | Ga0111539_10321004 | 3300009094 | Bacteria | 1802 |
| 153 | Ga0111539_10364501 | 3300009094 | Bacteria | 1682 |
| 154 | Ga0111539_11051451 | 3300009094 | Bacteria | 946 |
| 155 | Ga0111539_11070092 | 3300009094 | Unclassified | 937 |
| 156 | Ga0114129_10000802 | 3300009147 | Bacteria | 40299 |
| 157 | Ga0114129_10004303 | 3300009147 | Bacteria | 20120 |
| 158 | Ga0114129_10009647 | 3300009147 | Bacteria | 13775 |
| 159 | Ga0114129_10010905 | 3300009147 | Bacteria | 12946 |
| 160 | Ga0114129_10032450 | 3300009147 | Bacteria | 7381 |
| 161 | Ga0114129_10034994 | 3300009147 | Bacteria | 7095 |
| 162 | Ga0114129_10087394 | 3300009147 | Bacteria | 4323 |
| 163 | Ga0114129_10220396 | 3300009147 | Bacteria | 2559 |
| 164 | Ga0114129_11144541 | 3300009147 | Bacteria | 972 |
| 165 | Ga0105241_10185120 | 3300009174 | Bacteria | 1730 |
| 166 | Ga0105242_10163011 | 3300009176 | Bacteria | 1953 |
| 167 | Ga0105248_10051900 | 3300009177 | Bacteria | 4602 |
| 168 | Ga0105248_10082953 | 3300009177 | Bacteria | 3606 |
| 169 | Ga0105238_11006943 | 3300009551 | Bacteria | 854 |
| 170 | Ga0105249_10231762 | 3300009553 | Bacteria | 1822 |
| 171 | Ga0105249_10236922 | 3300009553 | Bacteria | 1802 |
| 172 | Ga0105246_10451851 | 3300011119 | Unclassified | 1080 |
| 173 | Ga0157374_10260324 | 3300013296 | Bacteria | 1708 |
| 174 | Ga0157378_10105395 | 3300013297 | Bacteria | 2578 |
| 175 | Ga0163162_10239196 | 3300013306 | Bacteria | 1946 |
| 176 | Ga0157375_11360521 | 3300013308 | Bacteria | 836 |
| 177 | Ga0163163_10003686 | 3300014325 | Bacteria | 13039 |
| 178 | Ga0157380_10096183 | 3300014326 | Unclassified | 2455 |
| 179 | Ga0157380_10219072 | 3300014326 | Bacteria | 1701 |
| 180 | Ga0157380_10261111 | 3300014326 | Bacteria | 1573 |
| 181 | Ga0157380_10491317 | 3300014326 | Bacteria | 1190 |
| 182 | Ga0157377_10387671 | 3300014745 | Bacteria | 948 |
| 183 | Ga0157379_10101301 | 3300014968 | Bacteria | 2585 |
| 184 | Ga0157379_10214635 | 3300014968 | Bacteria | 1743 |
| 185 | Ga0157376_10080953 | 3300014969 | Bacteria | 2787 |
| 186 | Ga0157376_10381974 | 3300014969 | Bacteria | 1357 |
| 187 | Ga0206356_10495523 | 3300020070 | Bacteria | 1436 |
| 188 | Ga0206353_11656120 | 3300020082 | Unclassified | 1482 |
| 189 | Ga0207697_10004399 | 3300025315 | Bacteria | 6735 |
| 190 | Ga0207697_10041592 | 3300025315 | Bacteria | 1887 |
| 191 | Ga0207682_10077066 | 3300025893 | Bacteria | 1422 |
| 192 | Ga0207642_10054361 | 3300025899 | Bacteria | 1826 |
| 193 | Ga0207688_10007207 | 3300025901 | Bacteria | 6050 |
| 194 | Ga0207680_10230733 | 3300025903 | Bacteria | 1272 |
| 195 | Ga0207699_10285534 | 3300025906 | Bacteria | 1148 |
| 196 | Ga0207645_10001201 | 3300025907 | Bacteria | 21361 |
| 197 | Ga0207654_10069998 | 3300025911 | Bacteria | 2081 |
| 198 | Ga0207695_10362987 | 3300025913 | Bacteria | 1335 |
| 199 | Ga0207695_10382961 | 3300025913 | Bacteria | 1292 |
| 200 | Ga0207662_10001608 | 3300025918 | Bacteria | 11059 |
| 201 | Ga0207657_10141061 | 3300025919 | Bacteria | 1969 |
| 202 | Ga0207649_10011364 | 3300025920 | Bacteria | 4909 |
| 203 | Ga0207649_10286088 | 3300025920 | Bacteria | 1200 |
| 204 | Ga0207681_10213860 | 3300025923 | Unclassified | 1488 |
| 205 | Ga0207681_10362414 | 3300025923 | Bacteria | 1163 |
| 206 | Ga0207681_10909578 | 3300025923 | Bacteria | 737 |
| 207 | Ga0207650_10006970 | 3300025925 | Bacteria | 7704 |
| 208 | Ga0207650_10025136 | 3300025925 | Bacteria | 4241 |
| 209 | Ga0207650_10043796 | 3300025925 | Bacteria | 3287 |
| 210 | Ga0207650_10090005 | 3300025925 | Bacteria | 2343 |
| 211 | Ga0207644_10017174 | 3300025931 | Bacteria | 4880 |
| 212 | Ga0207644_10384381 | 3300025931 | Bacteria | 1145 |
| 213 | Ga0207690_10172193 | 3300025932 | Unclassified | 1623 |
| 214 | Ga0207706_10263711 | 3300025933 | Unclassified | 1504 |
| 215 | Ga0207706_10393647 | 3300025933 | Bacteria | 1202 |
| 216 | Ga0207709_10087347 | 3300025935 | Bacteria | 2027 |
| 217 | Ga0207670_10092046 | 3300025936 | Bacteria | 2146 |
| 218 | Ga0207669_10086195 | 3300025937 | Unclassified | 2030 |
| 219 | Ga0207669_10116313 | 3300025937 | Bacteria | 1804 |
| 220 | Ga0207704_10085028 | 3300025938 | Bacteria | 2058 |
| 221 | Ga0207691_10005745 | 3300025940 | Bacteria | 12003 |
| 222 | Ga0207691_10169722 | 3300025940 | Bacteria | 1911 |
| 223 | Ga0207711_10010775 | 3300025941 | Bacteria | 7601 |
| 224 | Ga0207689_10029601 | 3300025942 | Bacteria | 4570 |
| 225 | Ga0207689_10139855 | 3300025942 | Bacteria | 1994 |
| 226 | Ga0207689_10187772 | 3300025942 | Unclassified | 1705 |
| 227 | Ga0207661_10001501 | 3300025944 | Bacteria | 15811 |
| 228 | Ga0207661_10010761 | 3300025944 | Bacteria | 6596 |
| 229 | Ga0207679_10001458 | 3300025945 | Bacteria | 14838 |
| 230 | Ga0207679_10110036 | 3300025945 | Bacteria | 2172 |
| 231 | Ga0207679_10289957 | 3300025945 | Bacteria | 1407 |
| 232 | Ga0207667_10720545 | 3300025949 | Bacteria | 999 |
| 233 | Ga0207651_10017838 | 3300025960 | Bacteria | 4205 |
| 234 | Ga0207651_10271792 | 3300025960 | Bacteria | 1396 |
| 235 | Ga0207712_10281742 | 3300025961 | Bacteria | 1357 |
| 236 | Ga0207668_10111723 | 3300025972 | Bacteria | 2052 |
| 237 | Ga0207658_10264826 | 3300025986 | Bacteria | 1466 |
| 238 | Ga0207677_10019893 | 3300026023 | Bacteria | 4063 |
| 239 | Ga0207639_10555840 | 3300026041 | Unclassified | 1054 |
| 240 | Ga0207678_10164837 | 3300026067 | Bacteria | 1892 |
| 241 | Ga0207708_10007592 | 3300026075 | Bacteria | 8024 |
| 242 | Ga0207648_10002017 | 3300026089 | Bacteria | 22166 |
| 243 | Ga0207648_10640036 | 3300026089 | Bacteria | 982 |
| 244 | Ga0207676_10533177 | 3300026095 | Unclassified | 1119 |
| 245 | Ga0207674_10012913 | 3300026116 | Bacteria | 9315 |
| 246 | Ga0207675_100182794 | 3300026118 | Unclassified | 2008 |
| 247 | Ga0207683_10166356 | 3300026121 | Unclassified | 1995 |
| 248 | Ga0207683_10961281 | 3300026121 | Unclassified | 793 |
| 249 | Ga0209813_10022672 | 3300027866 | Unclassified | 1778 |
| 250 | Ga0207428_10001731 | 3300027907 | Bacteria | 22364 |
| 251 | Ga0207428_10017737 | 3300027907 | Bacteria | 6105 |
| 252 | Ga0268266_10247784 | 3300028379 | Bacteria | 1647 |
| 253 | Ga0268264_10645178 | 3300028381 | Bacteria | 1047 |
| 254 | Ga0307408_100006200 | 3300031548 | Bacteria | 7940 |
| 255 | Ga0307405_10011660 | 3300031731 | Bacteria | 4621 |
| 256 | Ga0307405_10012845 | 3300031731 | Bacteria | 4449 |
| 257 | Ga0307405_10051855 | 3300031731 | Bacteria | 2548 |
| 258 | Ga0307413_10011842 | 3300031824 | Bacteria | 4310 |
| 259 | Ga0307413_10222171 | 3300031824 | Bacteria | 1381 |
| 260 | Ga0307413_10410230 | 3300031824 | Bacteria | 1064 |
| 261 | Ga0307410_10043397 | 3300031852 | Bacteria | 2980 |
| 262 | Ga0307410_10044118 | 3300031852 | Bacteria | 2959 |
| 263 | Ga0307407_10095160 | 3300031903 | Bacteria | 1835 |
| 264 | Ga0307407_10107933 | 3300031903 | Bacteria | 1742 |
| 265 | Ga0307407_10108326 | 3300031903 | Unclassified | 1739 |
| 266 | Ga0307407_10265800 | 3300031903 | Bacteria | 1182 |
| 267 | Ga0307407_10390630 | 3300031903 | Bacteria | 996 |
| 268 | Ga0307412_10019332 | 3300031911 | Bacteria | 4123 |
| 269 | Ga0307412_10051756 | 3300031911 | Bacteria | 2716 |
| 270 | Ga0307412_10206255 | 3300031911 | Unclassified | 1496 |
| 271 | Ga0307412_10768807 | 3300031911 | Bacteria | 833 |
| 272 | Ga0307409_100017600 | 3300031995 | Bacteria | 4771 |
| 273 | Ga0307409_100023507 | 3300031995 | Bacteria | 4273 |
| 274 | Ga0307409_100070998 | 3300031995 | Bacteria | 2767 |
| 275 | Ga0307409_100414196 | 3300031995 | Bacteria | 1291 |
| 276 | Ga0307416_100003678 | 3300032002 | Bacteria | 9082 |
| 277 | Ga0307416_100012528 | 3300032002 | Bacteria | 5717 |
| 278 | Ga0307416_100091310 | 3300032002 | Bacteria | 2615 |
| 279 | Ga0307416_100219838 | 3300032002 | Unclassified | 1821 |
| 280 | Ga0307416_100302030 | 3300032002 | Bacteria | 1592 |
| 281 | Ga0307416_100339985 | 3300032002 | Unclassified | 1513 |
| 282 | Ga0307416_100515253 | 3300032002 | Bacteria | 1263 |
| 283 | Ga0307414_10030904 | 3300032004 | Bacteria | 3505 |
| 284 | Ga0307414_10031132 | 3300032004 | Bacteria | 3495 |
| 285 | Ga0307414_10196717 | 3300032004 | Unclassified | 1636 |
| 286 | Ga0307414_10314510 | 3300032004 | Bacteria | 1330 |
| 287 | Ga0307414_10795628 | 3300032004 | Unclassified | 862 |
| 288 | Ga0307411_10030399 | 3300032005 | Bacteria | 3310 |
| 289 | Ga0307411_10087010 | 3300032005 | Bacteria | 2169 |
| 290 | Ga0307411_10094111 | 3300032005 | Bacteria | 2100 |
| 291 | Ga0307415_100039239 | 3300032126 | Bacteria | 3128 |
| 292 | Ga0307415_100055135 | 3300032126 | Bacteria | 2718 |
| 293 | Ga0307415_100532947 | 3300032126 | Bacteria | 1033 |
| 294 | Ga0307415_100813694 | 3300032126 | Bacteria | 854 |
| 295 | Ga0307415_101042865 | 3300032126 | Bacteria | 762 |
| 296 | Ga0373939_0125374 | 3300035114 | Bacteria | 911 |
| 297 | Ga0373945_0164934 | 3300035116 | Unclassified | 905 |
| 298 | Ga0373955_0168595 | 3300035172 | Bacteria | 1295 |
| 299 | Ga0373961_0045771 | 3300035241 | Bacteria | 1280 |
| 300 | Ga0373962_0093870 | 3300035242 | Bacteria | 928 |
| 301 | Ga0373931_0011920 | 3300035691 | Bacteria | 4207 |
| 302 | Ga0373931_0170531 | 3300035691 | Unclassified | 1282 |
| 303 | Ga0373933_0053752 | 3300035724 | Bacteria | 2412 |
| 304 | Ga0373947_0055933 | 3300035725 | Unclassified | 2384 |
| 305 | Ga0373937_0001439 | 3300036401 | Bacteria | 19902 |
| 306 | Ga0451798_0999571 | 3300041458 | Unclassified | 730 |
| 307 | Ga0451802_0240854 | 3300041460 | Bacteria | 820 |
| 308 | Ga0439431_0107863 | 3300041997 | Bacteria | 769 |
| 309 | Ga0439442_073445 | 3300042002 | Bacteria | 729 |
| 310 | Ga0439449_0228716 | 3300042007 | Unclassified | 698 |
| 311 | Ga0439450_072176 | 3300042008 | Bacteria | 848 |
| 312 | Ga0450923_047343 | 3300042125 | Bacteria | 917 |
| 313 | Ga0439446_0019793 | 3300042156 | Bacteria | 1893 |
| 314 | Ga0439434_0038870 | 3300042435 | Bacteria | 1459 |
| 315 | Ga0439435_0071420 | 3300042436 | Bacteria | 1028 |
| 316 | Ga0439464_0007639 | 3300042439 | Bacteria | 2828 |
| 317 | Ga0451577_0050378 | 3300042876 | Bacteria | 3717 |
| 318 | Ga0453683_0000748 | 3300044673 | Bacteria | 32799 |
| 319 | Ga0453684_0985229 | 3300044712 | Bacteria | 897 |
| 320 | Ga0466957_0495201 | 3300044842 | Bacteria | 847 |
| 321 | Ga0451576_0028911 | 3300045051 | Bacteria | 5937 |
| 322 | Ga0466967_0429942 | 3300045976 | Unclassified | 1288 |
| 323 | Ga0495603_0117720 | 3300046455 | Unclassified | 1549 |
| 324 | Ga0495603_0184248 | 3300046455 | Unclassified | 1208 |
| 325 | Ga0495603_0326789 | 3300046455 | Bacteria | 880 |
| 326 | Ga0495594_0251175 | 3300046499 | Bacteria | 1007 |
| 327 | Ga0495594_0477034 | 3300046499 | Bacteria | 709 |
| 328 | Ga0495667_0088435 | 3300046559 | Bacteria | 2008 |
| 329 | Ga0495634_0108725 | 3300046642 | Bacteria | 1785 |
| 330 | Ga0495646_0109925 | 3300046680 | Bacteria | 1571 |
| 331 | Ga0495647_0133392 | 3300046681 | Unclassified | 1054 |
| 332 | Ga0495658_0078674 | 3300046683 | Bacteria | 1931 |
| 333 | Ga0495613_0380810 | 3300046689 | Bacteria | 965 |
| 334 | Ga0495674_0136016 | 3300047319 | Bacteria | 2068 |
| 335 | Ga0496102_0372185 | 3300048905 | Bacteria | 1344 |
| 336 | Ga0496104_0001736 | 3300048907 | Bacteria | 18816 |
| 337 | Ga0496105_0043932 | 3300048908 | Bacteria | 3685 |
| 338 | Ga0496106_0019819 | 3300048909 | Bacteria | 4987 |
| 339 | Ga0496106_0142503 | 3300048909 | Bacteria | 1886 |
| 340 | Ga0496107_0083476 | 3300048910 | Bacteria | 2330 |
| 341 | Ga0496108_0001282 | 3300048911 | Bacteria | 19690 |
| 342 | Ga0496108_0334884 | 3300048911 | Bacteria | 1320 |
| 343 | Ga0496109_0000572 | 3300048912 | Bacteria | 30775 |
| 344 | Ga0496110_0004885 | 3300048913 | Bacteria | 10459 |
| 345 | Ga0496110_0167916 | 3300048913 | Bacteria | 1990 |
| 346 | Ga0496110_0186962 | 3300048913 | Bacteria | 1881 |
| 347 | Ga0496111_0052625 | 3300048914 | Bacteria | 2940 |
| 348 | Ga0496111_0272339 | 3300048914 | Bacteria | 1256 |
| 349 | Ga0496112_0000217 | 3300048915 | Bacteria | 37074 |
| 350 | Ga0496112_0022045 | 3300048915 | Bacteria | 6065 |
| 351 | Ga0496113_0456634 | 3300048916 | Bacteria | 1027 |
| 352 | Ga0501032_0020876 | 3300049569 | Bacteria | 4556 |
| 353 | Ga0501032_0060244 | 3300049569 | Bacteria | 2545 |
| 354 | Ga0501033_0023071 | 3300049570 | Bacteria | 4691 |
| 355 | Ga0501034_0012830 | 3300049571 | Bacteria | 8642 |
| 356 | Ga0501034_0014208 | 3300049571 | Bacteria | 8206 |
| 357 | Ga0501034_0068180 | 3300049571 | Bacteria | 3568 |
| 358 | Ga0501036_0006621 | 3300049572 | Bacteria | 9415 |
| 359 | Ga0501036_0078021 | 3300049572 | Bacteria | 2802 |
| 360 | Ga0501036_0100964 | 3300049572 | Bacteria | 2440 |
| 361 | Ga0501036_0416140 | 3300049572 | Bacteria | 1121 |
| 362 | Ga0501037_0006076 | 3300049573 | Bacteria | 8822 |
| 363 | Ga0501037_0047910 | 3300049573 | Bacteria | 3131 |
| 364 | Ga0501038_0011851 | 3300049574 | Bacteria | 7957 |
| 365 | Ga0501038_0050560 | 3300049574 | Bacteria | 3590 |
| 366 | Ga0501038_0187283 | 3300049574 | Bacteria | 1667 |
| 367 | Ga0501040_0037176 | 3300049576 | Bacteria | 3307 |
| 368 | Ga0501041_0069297 | 3300049577 | Bacteria | 2163 |
| 369 | Ga0501041_0122000 | 3300049577 | Bacteria | 1620 |
| 370 | Ga0501041_0278041 | 3300049577 | Bacteria | 1053 |
| 371 | Ga0501042_0004581 | 3300049578 | Bacteria | 8823 |
| 372 | Ga0501042_0057610 | 3300049578 | Bacteria | 2773 |
| 373 | Ga0501043_0076983 | 3300049579 | Bacteria | 2620 |
| 374 | Ga0501046_0008949 | 3300049580 | Bacteria | 8695 |
| 375 | Ga0501046_0157050 | 3300049580 | Unclassified | 1713 |
| 376 | Ga0501047_0012478 | 3300049581 | Bacteria | 8047 |
| 377 | Ga0501047_0238941 | 3300049581 | Bacteria | 1668 |
| 378 | Ga0501047_0345094 | 3300049581 | Bacteria | 1326 |
| 379 | Ga0501048_0030799 | 3300049582 | Bacteria | 3882 |
| 380 | Ga0501048_0118832 | 3300049582 | Bacteria | 1867 |
| 381 | Ga0501048_0294348 | 3300049582 | Bacteria | 1155 |
| 382 | Ga0501067_0000871 | 3300049583 | Bacteria | 16213 |
| 383 | Ga0501067_0015564 | 3300049583 | Bacteria | 4210 |
| 384 | Ga0501067_0247202 | 3300049583 | Bacteria | 993 |
| 385 | Ga0501068_0000356 | 3300049584 | Bacteria | 22962 |
| 386 | Ga0501069_0003315 | 3300049585 | Bacteria | 8265 |
| 387 | Ga0501069_0074145 | 3300049585 | Bacteria | 1909 |
| 388 | Ga0501070_0031954 | 3300049586 | Bacteria | 4408 |
| 389 | Ga0501070_0176205 | 3300049586 | Bacteria | 1760 |
| 390 | Ga0501070_0644885 | 3300049586 | Bacteria | 841 |
| 391 | Ga0501071_0030860 | 3300049587 | Bacteria | 3793 |
| 392 | Ga0501071_0109082 | 3300049587 | Bacteria | 2045 |
| 393 | Ga0501071_0189978 | 3300049587 | Unclassified | 1540 |
| 394 | Ga0501071_0312007 | 3300049587 | Bacteria | 1193 |
| 395 | Ga0501072_0049072 | 3300049588 | Bacteria | 3323 |
| 396 | Ga0501072_0508123 | 3300049588 | Bacteria | 953 |
| 397 | Ga0501073_0002726 | 3300049589 | Bacteria | 13240 |
| 398 | Ga0501073_0093615 | 3300049589 | Bacteria | 2087 |
| 399 | Ga0501074_0000854 | 3300049590 | Bacteria | 19385 |
| 400 | Ga0501074_0140685 | 3300049590 | Bacteria | 1726 |
| 401 | Ga0501074_0146853 | 3300049590 | Bacteria | 1686 |
| 402 | Ga0501075_0036542 | 3300049591 | Bacteria | 3667 |
| 403 | Ga0501075_0278376 | 3300049591 | Bacteria | 1275 |
| 404 | Ga0501075_0287763 | 3300049591 | Bacteria | 1252 |
| 405 | Ga0501076_0029848 | 3300049592 | Bacteria | 4243 |
| 406 | Ga0501077_0173457 | 3300049593 | Bacteria | 1370 |
| 407 | Ga0501221_075703 | 3300049704 | Bacteria | 802 |
| 408 | Ga0501079_0001073 | 3300049741 | Bacteria | 19026 |
| 409 | Ga0501079_0050995 | 3300049741 | Bacteria | 3194 |
| 410 | Ga0501079_0358897 | 3300049741 | Unclassified | 1142 |
| 411 | Ga0501080_0003960 | 3300049742 | Bacteria | 13112 |
| 412 | Ga0501080_0013058 | 3300049742 | Bacteria | 7626 |
| 413 | Ga0501080_0131590 | 3300049742 | Bacteria | 2316 |
| 414 | Ga0501080_0225768 | 3300049742 | Unclassified | 1713 |
| 415 | Ga0501080_0404336 | 3300049742 | Bacteria | 1228 |
| 416 | Ga0501080_0591882 | 3300049742 | Bacteria | 985 |
| 417 | Ga0501081_0006124 | 3300049743 | Bacteria | 7796 |
| 418 | Ga0501081_0021246 | 3300049743 | Bacteria | 4332 |
| 419 | Ga0501083_0008241 | 3300049744 | Bacteria | 7367 |
| 420 | Ga0501273_031241 | 3300049770 | Bacteria | 759 |
| 421 | Ga0501035_0043532 | 3300049822 | Bacteria | 4045 |
| 422 | Ga0501044_0030954 | 3300049823 | Bacteria | 5634 |
| 423 | Ga0501044_0323650 | 3300049823 | Bacteria | 1465 |
| 424 | Ga0501045_0001810 | 3300049824 | Bacteria | 14452 |
| 425 | Ga0501045_0276723 | 3300049824 | Bacteria | 1249 |
| 426 | Ga0501045_0506550 | 3300049824 | Unclassified | 896 |
| 427 | nmdc:mga00v17_11646_c1 | 3300050491 | Bacteria | 4836 |
| 428 | nmdc:mga00v17_1208_c1 | 3300050491 | Bacteria | 13555 |
| 429 | nmdc:mga0yw44_16283_c1 | 3300050492 | Bacteria | 4012 |
| 430 | nmdc:mga0yw44_59920_c1 | 3300050492 | Bacteria | 2330 |
| 431 | nmdc:mga0k408_3364_c1 | 3300050493 | Bacteria | 3346 |
| 432 | nmdc:mga0k408_37077_c1 | 3300050493 | Bacteria | 2798 |
| 433 | nmdc:mga0k408_4353_c1 | 3300050493 | Bacteria | 7517 |
| 434 | nmdc:mga06z11_223886_c1 | 3300050494 | Bacteria | 1100 |
| 435 | nmdc:mga06z11_2962_c1 | 3300050494 | Bacteria | 6541 |
| 436 | nmdc:mga06z11_3795_c1 | 3300050494 | Bacteria | 3460 |
| 437 | nmdc:mga04h51_141089_c1 | 3300050495 | Bacteria | 914 |
| 438 | nmdc:mga05p37_10279_c1 | 3300050507 | Bacteria | 11112 |
| 439 | nmdc:mga05p37_26364_c1 | 3300050507 | Bacteria | 7069 |
| 440 | nmdc:mga05p37_30741_c1 | 3300050507 | Bacteria | 6554 |
| 441 | nmdc:mga05p37_314958_c1 | 3300050507 | Bacteria | 1854 |
| 442 | nmdc:mga05p37_316449_c1 | 3300050507 | Bacteria | 1849 |
| 443 | nmdc:mga05p37_32697_c1 | 3300050507 | Bacteria | 6364 |
| 444 | nmdc:mga05p37_3405_c1 | 3300050507 | Bacteria | 18556 |
| 445 | nmdc:mga05p37_441148_c1 | 3300050507 | Bacteria | 1510 |
| 446 | nmdc:mga05p37_692514_c1 | 3300050507 | Bacteria | 1134 |
| 447 | nmdc:mga05p37_7719_c1 | 3300050507 | Bacteria | 12698 |
| 448 | nmdc:mga05p37_8024_c1 | 3300050507 | Bacteria | 12465 |
| 449 | nmdc:mga09592_13838_c1 | 3300050508 | Bacteria | 6592 |
| 450 | nmdc:mga09592_167262_c1 | 3300050508 | Unclassified | 1901 |
| 451 | nmdc:mga09592_2893_c1 | 3300050508 | Bacteria | 13912 |
| 452 | nmdc:mga09592_957563_c1 | 3300050508 | Unclassified | 717 |
| 453 | nmdc:mga0qj67_107929_c1 | 3300050509 | Unclassified | 2246 |
| 454 | nmdc:mga0qj67_324770_c1 | 3300050509 | Unclassified | 1246 |
| 455 | nmdc:mga0qj67_5114_c1 | 3300050509 | Bacteria | 9551 |
| 456 | nmdc:mga0qj67_52953_c2 | 3300050509 | Bacteria | 2014 |
| 457 | nmdc:mga0qj67_794_c1 | 3300050509 | Bacteria | 21497 |
| 458 | nmdc:mga06r32_34767_c1 | 3300050510 | Bacteria | 4754 |
| 459 | nmdc:mga06r32_5480_c1 | 3300050510 | Bacteria | 11425 |
| 460 | nmdc:mga06r32_68021_c1 | 3300050510 | Bacteria | 3440 |
| 461 | nmdc:mga06r32_723832_c1 | 3300050510 | Bacteria | 960 |
| 462 | nmdc:mga06r32_78570_c1 | 3300050510 | Unclassified | 3208 |
| 463 | nmdc:mga08y16_130156_c1 | 3300050511 | Bacteria | 2618 |
| 464 | nmdc:mga08y16_2029_c1 | 3300050511 | Bacteria | 20740 |
| 465 | nmdc:mga08y16_957265_c1 | 3300050511 | Unclassified | 839 |
| 466 | nmdc:mga0n895_118543_c1 | 3300050512 | Bacteria | 2667 |
| 467 | nmdc:mga0n895_357246_c1 | 3300050512 | Unclassified | 1480 |
| 468 | nmdc:mga0n895_6302_c1 | 3300050512 | Bacteria | 10060 |
| 469 | nmdc:mga0rr50_215427_c1 | 3300050513 | Unclassified | 1584 |
| 470 | nmdc:mga0rr50_35899_c1 | 3300050513 | Bacteria | 3565 |
| 471 | nmdc:mga0a205_18953_c1 | 3300050515 | Bacteria | 6483 |
| 472 | nmdc:mga0a205_195795_c1 | 3300050515 | Bacteria | 1528 |
| 473 | nmdc:mga0a205_260101_c1 | 3300050515 | Bacteria | 1613 |
| 474 | nmdc:mga0a205_378019_c1 | 3300050515 | Unclassified | 1282 |
| 475 | nmdc:mga0a205_67532_c1 | 3300050515 | Bacteria | 3454 |
| 476 | nmdc:mga0a205_94173_c1 | 3300050515 | Bacteria | 2893 |
| 477 | Ga0495601_0035439 | 3300053077 | Bacteria | 3115 |
| 478 | Ga0495595_0097526 | 3300053084 | Bacteria | 1416 |
| 479 | Ga0495595_0149778 | 3300053084 | Bacteria | 1148 |
| 480 | Ga0495619_0154173 | 3300053085 | Bacteria | 1585 |
| 481 | Ga0501084_0123084 | 3300054114 | Unclassified | 2182 |
| 482 | Ga0501084_0123532 | 3300054114 | Bacteria | 2177 |
| 483 | Ga0501084_0124323 | 3300054114 | Bacteria | 2170 |
| 484 | Ga0501084_0129921 | 3300054114 | Bacteria | 2121 |
| 485 | Ga0501084_0874269 | 3300054114 | Bacteria | 756 |
| 486 | Ga0590071_001485 | 3300059421 | Bacteria | 6182 |
| 487 | Ga0590075_001106 | 3300059424 | Bacteria | 6953 |
| 488 | Ga0590075_012764 | 3300059424 | Bacteria | 2042 |
| 489 | Ga0590077_002251 | 3300059426 | Bacteria | 4177 |
| 490 | Ga0590077_011003 | 3300059426 | Bacteria | 1865 |
| 491 | Ga0590077_012934 | 3300059426 | Bacteria | 1732 |
| 492 | Ga0501082_0006455 | 3300060353 | Bacteria | 10170 |
| 493 | Ga0501082_0015245 | 3300060353 | Bacteria | 6620 |
| 494 | Ga0501082_0603908 | 3300060353 | Bacteria | 960 |
| 495 | Ga0530510_0367289 | 3300061734 | Bacteria | 1082 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0985229 | Ga0453684_0985229_359_880 | 168 |
| 2 | 3300046455 | Ga0495603_0326789 | Ga0495603_0326789_304_849 | 174 |
| 3 | 3300014326 | Ga0157380_10261111 | Ga0157380_102611112 | 178 |
| 4 | 3300050515 | nmdc:mga0a205_378019_c1 | nmdc:mga0a205_378019_c1_322_873 | 183 |
| 5 | 3300059424 | Ga0590075_012764 | Ga0590075_012764_1044_1673 | 184 |
| 6 | 3300059426 | Ga0590077_011003 | Ga0590077_011003_129_758 | 184 |
| 7 | 3300005518 | Ga0070699_100011273 | Ga0070699_1000112733 | 186 |
| 8 | 3300042435 | Ga0439434_0038870 | Ga0439434_0038870_487_1113 | 188 |
| 9 | 3300032002 | Ga0307416_100339985 | Ga0307416_1003399853 | 192 |
| 10 | 3300005353 | Ga0070669_100636540 | Ga0070669_1006365402 | 195 |
| 11 | 3300025906 | Ga0207699_10285534 | Ga0207699_102855342 | 195 |
| 12 | 3300005331 | Ga0070670_100036316 | Ga0070670_1000363163 | 196 |
| 13 | 3300005564 | Ga0070664_100306314 | Ga0070664_1003063142 | 196 |
| 14 | 3300005617 | Ga0068859_100766823 | Ga0068859_1007668232 | 196 |
| 15 | 3300006931 | Ga0097620_100767044 | Ga0097620_1007670442 | 196 |
| 16 | 3300025925 | Ga0207650_10025136 | Ga0207650_100251363 | 196 |
| 17 | 3300049569 | Ga0501032_0020876 | Ga0501032_0020876_3293_3931 | 196 |
| 18 | 3300049571 | Ga0501034_0014208 | Ga0501034_0014208_539_1177 | 196 |
| 19 | 3300049571 | Ga0501034_0068180 | Ga0501034_0068180_1717_2355 | 196 |
| 20 | 3300049572 | Ga0501036_0078021 | Ga0501036_0078021_328_966 | 196 |
| 21 | 3300049572 | Ga0501036_0100964 | Ga0501036_0100964_471_1109 | 196 |
| 22 | 3300049573 | Ga0501037_0047910 | Ga0501037_0047910_1645_2283 | 196 |
| 23 | 3300049574 | Ga0501038_0050560 | Ga0501038_0050560_1944_2582 | 196 |
| 24 | 3300049582 | Ga0501048_0030799 | Ga0501048_0030799_1911_2549 | 196 |
| 25 | 3300049583 | Ga0501067_0015564 | Ga0501067_0015564_1424_2062 | 196 |
| 26 | 3300049586 | Ga0501070_0176205 | Ga0501070_0176205_15_653 | 196 |
| 27 | 3300049589 | Ga0501073_0093615 | Ga0501073_0093615_1214_1852 | 196 |
| 28 | 3300049590 | Ga0501074_0140685 | Ga0501074_0140685_980_1618 | 196 |
| 29 | 3300049742 | Ga0501080_0131590 | Ga0501080_0131590_1129_1767 | 196 |
| 30 | 3300049744 | Ga0501083_0008241 | Ga0501083_0008241_1436_2074 | 196 |
| 31 | 3300049823 | Ga0501044_0323650 | Ga0501044_0323650_356_994 | 196 |
| 32 | 3300060353 | Ga0501082_0015245 | Ga0501082_0015245_5158_5796 | 196 |
| 33 | 3300006844 | Ga0075428_100003760 | Ga0075428_1000037608 | 197 |
| 34 | 3300006846 | Ga0075430_100031398 | Ga0075430_1000313982 | 197 |
| 35 | 3300006847 | Ga0075431_100167114 | Ga0075431_1001671141 | 197 |
| 36 | 3300006880 | Ga0075429_100176707 | Ga0075429_1001767071 | 197 |
| 37 | 3300049574 | Ga0501038_0187283 | Ga0501038_0187283_24_626 | 197 |
| 38 | 3300049742 | Ga0501080_0591882 | Ga0501080_0591882_18_620 | 197 |
| 39 | 3300050508 | nmdc:mga09592_167262_c1 | nmdc:mga09592_167262_c1_1175_1840 | 197 |
| 40 | 3300050510 | nmdc:mga06r32_5480_c1 | nmdc:mga06r32_5480_c1_8557_9222 | 197 |
| 41 | 3300006237 | Ga0097621_100876477 | Ga0097621_1008764772 | 198 |
| 42 | 3300014968 | Ga0157379_10214635 | Ga0157379_102146353 | 198 |
| 43 | 3300026121 | Ga0207683_10166356 | Ga0207683_101663562 | 198 |
| 44 | 3300046455 | Ga0495603_0117720 | Ga0495603_0117720_826_1464 | 198 |
| 45 | 3300046681 | Ga0495647_0133392 | Ga0495647_0133392_205_843 | 198 |
| 46 | 3300048909 | Ga0496106_0019819 | Ga0496106_0019819_1307_1945 | 198 |
| 47 | 3300049569 | Ga0501032_0060244 | Ga0501032_0060244_1038_1688 | 198 |
| 48 | 3300049570 | Ga0501033_0023071 | Ga0501033_0023071_2876_3526 | 198 |
| 49 | 3300049572 | Ga0501036_0006621 | Ga0501036_0006621_3906_4556 | 198 |
| 50 | 3300049573 | Ga0501037_0006076 | Ga0501037_0006076_3533_4183 | 198 |
| 51 | 3300049574 | Ga0501038_0011851 | Ga0501038_0011851_5877_6527 | 198 |
| 52 | 3300049576 | Ga0501040_0037176 | Ga0501040_0037176_2389_3027 | 198 |
| 53 | 3300049577 | Ga0501041_0069297 | Ga0501041_0069297_1355_1993 | 198 |
| 54 | 3300049578 | Ga0501042_0004581 | Ga0501042_0004581_4639_5289 | 198 |
| 55 | 3300049578 | Ga0501042_0057610 | Ga0501042_0057610_287_925 | 198 |
| 56 | 3300049579 | Ga0501043_0076983 | Ga0501043_0076983_1067_1717 | 198 |
| 57 | 3300049580 | Ga0501046_0008949 | Ga0501046_0008949_4860_5510 | 198 |
| 58 | 3300049580 | Ga0501046_0157050 | Ga0501046_0157050_721_1359 | 198 |
| 59 | 3300049581 | Ga0501047_0012478 | Ga0501047_0012478_2538_3188 | 198 |
| 60 | 3300049582 | Ga0501048_0118832 | Ga0501048_0118832_21_671 | 198 |
| 61 | 3300049582 | Ga0501048_0294348 | Ga0501048_0294348_28_666 | 198 |
| 62 | 3300049583 | Ga0501067_0000871 | Ga0501067_0000871_3533_4183 | 198 |
| 63 | 3300049584 | Ga0501068_0000356 | Ga0501068_0000356_17637_18287 | 198 |
| 64 | 3300049585 | Ga0501069_0003315 | Ga0501069_0003315_4711_5361 | 198 |
| 65 | 3300049586 | Ga0501070_0031954 | Ga0501070_0031954_3407_4057 | 198 |
| 66 | 3300049587 | Ga0501071_0030860 | Ga0501071_0030860_1078_1728 | 198 |
| 67 | 3300049587 | Ga0501071_0189978 | Ga0501071_0189978_44_682 | 198 |
| 68 | 3300049588 | Ga0501072_0049072 | Ga0501072_0049072_903_1553 | 198 |
| 69 | 3300049589 | Ga0501073_0002726 | Ga0501073_0002726_858_1508 | 198 |
| 70 | 3300049590 | Ga0501074_0000854 | Ga0501074_0000854_7003_7653 | 198 |
| 71 | 3300049741 | Ga0501079_0001073 | Ga0501079_0001073_13517_14167 | 198 |
| 72 | 3300049742 | Ga0501080_0003960 | Ga0501080_0003960_11733_12383 | 198 |
| 73 | 3300049822 | Ga0501035_0043532 | Ga0501035_0043532_858_1508 | 198 |
| 74 | 3300049823 | Ga0501044_0030954 | Ga0501044_0030954_939_1589 | 198 |
| 75 | 3300049824 | Ga0501045_0001810 | Ga0501045_0001810_12640_13290 | 198 |
| 76 | 3300054114 | Ga0501084_0123084 | Ga0501084_0123084_931_1569 | 198 |
| 77 | 3300054114 | Ga0501084_0123532 | Ga0501084_0123532_194_844 | 198 |
| 78 | 3300059426 | Ga0590077_012934 | Ga0590077_012934_607_1275 | 198 |
| 79 | 3300060353 | Ga0501082_0006455 | Ga0501082_0006455_4366_5016 | 198 |
| 80 | 3300005458 | Ga0070681_10118067 | Ga0070681_101180672 | 199 |
| 81 | 3300005563 | Ga0068855_100832248 | Ga0068855_1008322481 | 199 |
| 82 | 3300009093 | Ga0105240_10082364 | Ga0105240_100823645 | 199 |
| 83 | 3300013297 | Ga0157378_10105395 | Ga0157378_101053953 | 199 |
| 84 | 3300025913 | Ga0207695_10362987 | Ga0207695_103629872 | 199 |
| 85 | 3300025949 | Ga0207667_10720545 | Ga0207667_107205452 | 199 |
| 86 | 3300049824 | Ga0501045_0276723 | Ga0501045_0276723_233_871 | 199 |
| 87 | 3300050508 | nmdc:mga09592_957563_c1 | nmdc:mga09592_957563_c1_22_663 | 199 |
| 88 | 3300054114 | Ga0501084_0874269 | Ga0501084_0874269_69_707 | 199 |
| 89 | 3300005441 | Ga0070700_100339272 | Ga0070700_1003392722 | 200 |
| 90 | 3300006237 | Ga0097621_100273900 | Ga0097621_1002739003 | 200 |
| 91 | 3300005985 | Ga0081539_10073335 | Ga0081539_100733352 | 201 |
| 92 | 3300032002 | Ga0307416_100219838 | Ga0307416_1002198382 | 201 |
| 93 | 3300006852 | Ga0075433_10575648 | Ga0075433_105756482 | 203 |
| 94 | 3300050515 | nmdc:mga0a205_260101_c1 | nmdc:mga0a205_260101_c1_873_1559 | 203 |
| 95 | 3300049742 | Ga0501080_0404336 | Ga0501080_0404336_13_639 | 206 |
| 96 | 3300005290 | Ga0065712_10171297 | Ga0065712_101712971 | 207 |
| 97 | 3300005328 | Ga0070676_10069368 | Ga0070676_100693683 | 207 |
| 98 | 3300005329 | Ga0070683_100000817 | Ga0070683_1000008176 | 207 |
| 99 | 3300005329 | Ga0070683_100028392 | Ga0070683_1000283924 | 207 |
| 100 | 3300005330 | Ga0070690_100017099 | Ga0070690_1000170993 | 207 |
| 101 | 3300005331 | Ga0070670_100003221 | Ga0070670_1000032218 | 207 |
| 102 | 3300005331 | Ga0070670_100004636 | Ga0070670_1000046363 | 207 |
| 103 | 3300005331 | Ga0070670_100010107 | Ga0070670_1000101073 | 207 |
| 104 | 3300005331 | Ga0070670_100028331 | Ga0070670_1000283313 | 207 |
| 105 | 3300005334 | Ga0068869_100029706 | Ga0068869_1000297062 | 207 |
| 106 | 3300005334 | Ga0068869_100084082 | Ga0068869_1000840822 | 207 |
| 107 | 3300005336 | Ga0070680_100223332 | Ga0070680_1002233323 | 207 |
| 108 | 3300005336 | Ga0070680_100237545 | Ga0070680_1002375453 | 207 |
| 109 | 3300005339 | Ga0070660_100230450 | Ga0070660_1002304503 | 207 |
| 110 | 3300005344 | Ga0070661_100019679 | Ga0070661_1000196795 | 207 |
| 111 | 3300005353 | Ga0070669_100018097 | Ga0070669_1000180974 | 207 |
| 112 | 3300005354 | Ga0070675_100308236 | Ga0070675_1003082362 | 207 |
| 113 | 3300005354 | Ga0070675_100626747 | Ga0070675_1006267472 | 207 |
| 114 | 3300005355 | Ga0070671_100080234 | Ga0070671_1000802342 | 207 |
| 115 | 3300005355 | Ga0070671_100111755 | Ga0070671_1001117552 | 207 |
| 116 | 3300005355 | Ga0070671_100773478 | Ga0070671_1007734781 | 207 |
| 117 | 3300005356 | Ga0070674_100000654 | Ga0070674_10000065411 | 207 |
| 118 | 3300005356 | Ga0070674_100019975 | Ga0070674_1000199753 | 207 |
| 119 | 3300005356 | Ga0070674_100029284 | Ga0070674_1000292843 | 207 |
| 120 | 3300005356 | Ga0070674_100062012 | Ga0070674_1000620124 | 207 |
| 121 | 3300005356 | Ga0070674_100115364 | Ga0070674_1001153642 | 207 |
| 122 | 3300005364 | Ga0070673_100009321 | Ga0070673_1000093213 | 207 |
| 123 | 3300005364 | Ga0070673_100174748 | Ga0070673_1001747482 | 207 |
| 124 | 3300005365 | Ga0070688_100160743 | Ga0070688_1001607433 | 207 |
| 125 | 3300005365 | Ga0070688_100295021 | Ga0070688_1002950212 | 207 |
| 126 | 3300005366 | Ga0070659_100560089 | Ga0070659_1005600892 | 207 |
| 127 | 3300005367 | Ga0070667_100065911 | Ga0070667_1000659114 | 207 |
| 128 | 3300005439 | Ga0070711_100051768 | Ga0070711_1000517682 | 207 |
| 129 | 3300005440 | Ga0070705_100071526 | Ga0070705_1000715262 | 207 |
| 130 | 3300005441 | Ga0070700_100062091 | Ga0070700_1000620912 | 207 |
| 131 | 3300005444 | Ga0070694_100397553 | Ga0070694_1003975532 | 207 |
| 132 | 3300005444 | Ga0070694_100526667 | Ga0070694_1005266671 | 207 |
| 133 | 3300005455 | Ga0070663_100223878 | Ga0070663_1002238782 | 207 |
| 134 | 3300005457 | Ga0070662_100134699 | Ga0070662_1001346992 | 207 |
| 135 | 3300005457 | Ga0070662_100172076 | Ga0070662_1001720762 | 207 |
| 136 | 3300005457 | Ga0070662_100313251 | Ga0070662_1003132512 | 207 |
| 137 | 3300005458 | Ga0070681_10598231 | Ga0070681_105982311 | 207 |
| 138 | 3300005458 | Ga0070681_10636585 | Ga0070681_106365851 | 207 |
| 139 | 3300005466 | Ga0070685_10193628 | Ga0070685_101936282 | 207 |
| 140 | 3300005467 | Ga0070706_100144425 | Ga0070706_1001444252 | 207 |
| 141 | 3300005518 | Ga0070699_100143928 | Ga0070699_1001439283 | 207 |
| 142 | 3300005518 | Ga0070699_100267611 | Ga0070699_1002676112 | 207 |
| 143 | 3300005535 | Ga0070684_100000538 | Ga0070684_1000005389 | 207 |
| 144 | 3300005535 | Ga0070684_100045383 | Ga0070684_1000453835 | 207 |
| 145 | 3300005543 | Ga0070672_100345176 | Ga0070672_1003451763 | 207 |
| 146 | 3300005543 | Ga0070672_100519913 | Ga0070672_1005199132 | 207 |
| 147 | 3300005544 | Ga0070686_100019324 | Ga0070686_1000193243 | 207 |
| 148 | 3300005547 | Ga0070693_100050888 | Ga0070693_1000508882 | 207 |
| 149 | 3300005548 | Ga0070665_100264764 | Ga0070665_1002647642 | 207 |
| 150 | 3300005549 | Ga0070704_100191452 | Ga0070704_1001914522 | 207 |
| 151 | 3300005564 | Ga0070664_100000055 | Ga0070664_10000005558 | 207 |
| 152 | 3300005577 | Ga0068857_100005431 | Ga0068857_1000054316 | 207 |
| 153 | 3300005578 | Ga0068854_100037114 | Ga0068854_1000371143 | 207 |
| 154 | 3300005617 | Ga0068859_100010271 | Ga0068859_1000102716 | 207 |
| 155 | 3300005617 | Ga0068859_100169806 | Ga0068859_1001698062 | 207 |
| 156 | 3300005618 | Ga0068864_100589966 | Ga0068864_1005899662 | 207 |
| 157 | 3300005718 | Ga0068866_10021185 | Ga0068866_100211853 | 207 |
| 158 | 3300005840 | Ga0068870_10122520 | Ga0068870_101225203 | 207 |
| 159 | 3300005841 | Ga0068863_100171661 | Ga0068863_1001716613 | 207 |
| 160 | 3300005841 | Ga0068863_100207203 | Ga0068863_1002072032 | 207 |
| 161 | 3300005841 | Ga0068863_100316654 | Ga0068863_1003166541 | 207 |
| 162 | 3300005842 | Ga0068858_100072157 | Ga0068858_1000721574 | 207 |
| 163 | 3300005842 | Ga0068858_100342874 | Ga0068858_1003428742 | 207 |
| 164 | 3300005843 | Ga0068860_100065743 | Ga0068860_1000657434 | 207 |
| 165 | 3300005843 | Ga0068860_100342529 | Ga0068860_1003425293 | 207 |
| 166 | 3300005844 | Ga0068862_100092309 | Ga0068862_1000923095 | 207 |
| 167 | 3300005844 | Ga0068862_100235980 | Ga0068862_1002359803 | 207 |
| 168 | 3300006038 | Ga0075365_10002810 | Ga0075365_100028102 | 207 |
| 169 | 3300006038 | Ga0075365_10023125 | Ga0075365_100231252 | 207 |
| 170 | 3300006042 | Ga0075368_10012444 | Ga0075368_100124443 | 207 |
| 171 | 3300006042 | Ga0075368_10020563 | Ga0075368_100205632 | 207 |
| 172 | 3300006042 | Ga0075368_10031624 | Ga0075368_100316242 | 207 |
| 173 | 3300006051 | Ga0075364_10013958 | Ga0075364_100139585 | 207 |
| 174 | 3300006177 | Ga0075362_10000061 | Ga0075362_1000006120 | 207 |
| 175 | 3300006178 | Ga0075367_10006307 | Ga0075367_100063073 | 207 |
| 176 | 3300006178 | Ga0075367_10006925 | Ga0075367_100069253 | 207 |
| 177 | 3300006178 | Ga0075367_10008419 | Ga0075367_100084195 | 207 |
| 178 | 3300006178 | Ga0075367_10248645 | Ga0075367_102486453 | 207 |
| 179 | 3300006195 | Ga0075366_10003271 | Ga0075366_100032713 | 207 |
| 180 | 3300006195 | Ga0075366_10006145 | Ga0075366_100061453 | 207 |
| 181 | 3300006195 | Ga0075366_10030616 | Ga0075366_100306163 | 207 |
| 182 | 3300006353 | Ga0075370_10003291 | Ga0075370_100032916 | 207 |
| 183 | 3300006358 | Ga0068871_100196680 | Ga0068871_1001966802 | 207 |
| 184 | 3300006844 | Ga0075428_100002058 | Ga0075428_10000205813 | 207 |
| 185 | 3300006844 | Ga0075428_100005718 | Ga0075428_1000057183 | 207 |
| 186 | 3300006844 | Ga0075428_100013792 | Ga0075428_1000137923 | 207 |
| 187 | 3300006846 | Ga0075430_100002788 | Ga0075430_1000027887 | 207 |
| 188 | 3300006846 | Ga0075430_100015560 | Ga0075430_1000155603 | 207 |
| 189 | 3300006846 | Ga0075430_100087191 | Ga0075430_1000871913 | 207 |
| 190 | 3300006847 | Ga0075431_100027376 | Ga0075431_1000273763 | 207 |
| 191 | 3300006847 | Ga0075431_100104551 | Ga0075431_1001045514 | 207 |
| 192 | 3300006852 | Ga0075433_10009601 | Ga0075433_100096017 | 207 |
| 193 | 3300006852 | Ga0075433_10060651 | Ga0075433_100606514 | 207 |
| 194 | 3300006852 | Ga0075433_10080426 | Ga0075433_100804262 | 207 |
| 195 | 3300006852 | Ga0075433_10109577 | Ga0075433_101095772 | 207 |
| 196 | 3300006871 | Ga0075434_100007606 | Ga0075434_1000076064 | 207 |
| 197 | 3300006871 | Ga0075434_100028542 | Ga0075434_1000285423 | 207 |
| 198 | 3300006880 | Ga0075429_100004693 | Ga0075429_1000046935 | 207 |
| 199 | 3300006880 | Ga0075429_100014262 | Ga0075429_1000142623 | 207 |
| 200 | 3300006880 | Ga0075429_100415402 | Ga0075429_1004154022 | 207 |
| 201 | 3300006881 | Ga0068865_100177460 | Ga0068865_1001774603 | 207 |
| 202 | 3300006881 | Ga0068865_100288436 | Ga0068865_1002884362 | 207 |
| 203 | 3300006881 | Ga0068865_100347287 | Ga0068865_1003472872 | 207 |
| 204 | 3300006931 | Ga0097620_100010271 | Ga0097620_1000102716 | 207 |
| 205 | 3300006931 | Ga0097620_100169809 | Ga0097620_1001698092 | 207 |
| 206 | 3300007076 | Ga0075435_100407293 | Ga0075435_1004072932 | 207 |
| 207 | 3300009093 | Ga0105240_10208640 | Ga0105240_102086403 | 207 |
| 208 | 3300009094 | Ga0111539_10001246 | Ga0111539_1000124615 | 207 |
| 209 | 3300009094 | Ga0111539_10301441 | Ga0111539_103014412 | 207 |
| 210 | 3300009094 | Ga0111539_10321004 | Ga0111539_103210041 | 207 |
| 211 | 3300009094 | Ga0111539_10364501 | Ga0111539_103645012 | 207 |
| 212 | 3300009094 | Ga0111539_11051451 | Ga0111539_110514511 | 207 |
| 213 | 3300009094 | Ga0111539_11070092 | Ga0111539_110700921 | 207 |
| 214 | 3300009147 | Ga0114129_10000802 | Ga0114129_1000080213 | 207 |
| 215 | 3300009147 | Ga0114129_10004303 | Ga0114129_100043037 | 207 |
| 216 | 3300009147 | Ga0114129_10009647 | Ga0114129_100096477 | 207 |
| 217 | 3300009147 | Ga0114129_10010905 | Ga0114129_100109055 | 207 |
| 218 | 3300009147 | Ga0114129_10034994 | Ga0114129_100349944 | 207 |
| 219 | 3300009174 | Ga0105241_10185120 | Ga0105241_101851202 | 207 |
| 220 | 3300009176 | Ga0105242_10163011 | Ga0105242_101630111 | 207 |
| 221 | 3300009177 | Ga0105248_10051900 | Ga0105248_100519002 | 207 |
| 222 | 3300009177 | Ga0105248_10082953 | Ga0105248_100829532 | 207 |
| 223 | 3300009551 | Ga0105238_11006943 | Ga0105238_110069432 | 207 |
| 224 | 3300009553 | Ga0105249_10231762 | Ga0105249_102317623 | 207 |
| 225 | 3300009553 | Ga0105249_10236922 | Ga0105249_102369223 | 207 |
| 226 | 3300011119 | Ga0105246_10451851 | Ga0105246_104518512 | 207 |
| 227 | 3300013306 | Ga0163162_10239196 | Ga0163162_102391963 | 207 |
| 228 | 3300014325 | Ga0163163_10003686 | Ga0163163_100036868 | 207 |
| 229 | 3300014326 | Ga0157380_10096183 | Ga0157380_100961835 | 207 |
| 230 | 3300014326 | Ga0157380_10219072 | Ga0157380_102190723 | 207 |
| 231 | 3300014326 | Ga0157380_10491317 | Ga0157380_104913172 | 207 |
| 232 | 3300014745 | Ga0157377_10387671 | Ga0157377_103876712 | 207 |
| 233 | 3300014968 | Ga0157379_10101301 | Ga0157379_101013014 | 207 |
| 234 | 3300020070 | Ga0206356_10495523 | Ga0206356_104955232 | 207 |
| 235 | 3300020082 | Ga0206353_11656120 | Ga0206353_116561202 | 207 |
| 236 | 3300025315 | Ga0207697_10004399 | Ga0207697_100043995 | 207 |
| 237 | 3300025315 | Ga0207697_10041592 | Ga0207697_100415923 | 207 |
| 238 | 3300025893 | Ga0207682_10077066 | Ga0207682_100770663 | 207 |
| 239 | 3300025899 | Ga0207642_10054361 | Ga0207642_100543613 | 207 |
| 240 | 3300025901 | Ga0207688_10007207 | Ga0207688_100072075 | 207 |
| 241 | 3300025903 | Ga0207680_10230733 | Ga0207680_102307332 | 207 |
| 242 | 3300025907 | Ga0207645_10001201 | Ga0207645_1000120119 | 207 |
| 243 | 3300025911 | Ga0207654_10069998 | Ga0207654_100699982 | 207 |
| 244 | 3300025913 | Ga0207695_10382961 | Ga0207695_103829613 | 207 |
| 245 | 3300025918 | Ga0207662_10001608 | Ga0207662_100016087 | 207 |
| 246 | 3300025919 | Ga0207657_10141061 | Ga0207657_101410614 | 207 |
| 247 | 3300025920 | Ga0207649_10011364 | Ga0207649_100113644 | 207 |
| 248 | 3300025923 | Ga0207681_10362414 | Ga0207681_103624142 | 207 |
| 249 | 3300025923 | Ga0207681_10909578 | Ga0207681_109095781 | 207 |
| 250 | 3300025925 | Ga0207650_10006970 | Ga0207650_100069705 | 207 |
| 251 | 3300025925 | Ga0207650_10043796 | Ga0207650_100437964 | 207 |
| 252 | 3300025925 | Ga0207650_10090005 | Ga0207650_100900053 | 207 |
| 253 | 3300025931 | Ga0207644_10017174 | Ga0207644_100171743 | 207 |
| 254 | 3300025932 | Ga0207690_10172193 | Ga0207690_101721933 | 207 |
| 255 | 3300025933 | Ga0207706_10263711 | Ga0207706_102637112 | 207 |
| 256 | 3300025933 | Ga0207706_10393647 | Ga0207706_103936472 | 207 |
| 257 | 3300025935 | Ga0207709_10087347 | Ga0207709_100873472 | 207 |
| 258 | 3300025936 | Ga0207670_10092046 | Ga0207670_100920462 | 207 |
| 259 | 3300025937 | Ga0207669_10086195 | Ga0207669_100861952 | 207 |
| 260 | 3300025937 | Ga0207669_10116313 | Ga0207669_101163132 | 207 |
| 261 | 3300025938 | Ga0207704_10085028 | Ga0207704_100850282 | 207 |
| 262 | 3300025940 | Ga0207691_10005745 | Ga0207691_100057457 | 207 |
| 263 | 3300025941 | Ga0207711_10010775 | Ga0207711_100107753 | 207 |
| 264 | 3300025942 | Ga0207689_10029601 | Ga0207689_100296013 | 207 |
| 265 | 3300025942 | Ga0207689_10139855 | Ga0207689_101398552 | 207 |
| 266 | 3300025942 | Ga0207689_10187772 | Ga0207689_101877723 | 207 |
| 267 | 3300025944 | Ga0207661_10001501 | Ga0207661_100015017 | 207 |
| 268 | 3300025944 | Ga0207661_10010761 | Ga0207661_100107613 | 207 |
| 269 | 3300025945 | Ga0207679_10001458 | Ga0207679_100014588 | 207 |
| 270 | 3300025945 | Ga0207679_10110036 | Ga0207679_101100363 | 207 |
| 271 | 3300025945 | Ga0207679_10289957 | Ga0207679_102899573 | 207 |
| 272 | 3300025960 | Ga0207651_10017838 | Ga0207651_100178385 | 207 |
| 273 | 3300025960 | Ga0207651_10271792 | Ga0207651_102717922 | 207 |
| 274 | 3300025961 | Ga0207712_10281742 | Ga0207712_102817422 | 207 |
| 275 | 3300025972 | Ga0207668_10111723 | Ga0207668_101117232 | 207 |
| 276 | 3300025986 | Ga0207658_10264826 | Ga0207658_102648263 | 207 |
| 277 | 3300026023 | Ga0207677_10019893 | Ga0207677_100198933 | 207 |
| 278 | 3300026041 | Ga0207639_10555840 | Ga0207639_105558401 | 207 |
| 279 | 3300026067 | Ga0207678_10164837 | Ga0207678_101648372 | 207 |
| 280 | 3300026075 | Ga0207708_10007592 | Ga0207708_100075923 | 207 |
| 281 | 3300026089 | Ga0207648_10002017 | Ga0207648_1000201720 | 207 |
| 282 | 3300026089 | Ga0207648_10640036 | Ga0207648_106400362 | 207 |
| 283 | 3300026095 | Ga0207676_10533177 | Ga0207676_105331772 | 207 |
| 284 | 3300026116 | Ga0207674_10012913 | Ga0207674_100129133 | 207 |
| 285 | 3300026118 | Ga0207675_100182794 | Ga0207675_1001827942 | 207 |
| 286 | 3300027866 | Ga0209813_10022672 | Ga0209813_100226721 | 207 |
| 287 | 3300027907 | Ga0207428_10001731 | Ga0207428_100017318 | 207 |
| 288 | 3300027907 | Ga0207428_10017737 | Ga0207428_100177372 | 207 |
| 289 | 3300028379 | Ga0268266_10247784 | Ga0268266_102477842 | 207 |
| 290 | 3300031548 | Ga0307408_100006200 | Ga0307408_1000062006 | 207 |
| 291 | 3300031731 | Ga0307405_10011660 | Ga0307405_100116603 | 207 |
| 292 | 3300031731 | Ga0307405_10051855 | Ga0307405_100518552 | 207 |
| 293 | 3300031824 | Ga0307413_10011842 | Ga0307413_100118426 | 207 |
| 294 | 3300031824 | Ga0307413_10410230 | Ga0307413_104102302 | 207 |
| 295 | 3300031852 | Ga0307410_10043397 | Ga0307410_100433973 | 207 |
| 296 | 3300031903 | Ga0307407_10107933 | Ga0307407_101079332 | 207 |
| 297 | 3300031903 | Ga0307407_10108326 | Ga0307407_101083263 | 207 |
| 298 | 3300031903 | Ga0307407_10265800 | Ga0307407_102658002 | 207 |
| 299 | 3300031911 | Ga0307412_10051756 | Ga0307412_100517562 | 207 |
| 300 | 3300031911 | Ga0307412_10206255 | Ga0307412_102062551 | 207 |
| 301 | 3300031911 | Ga0307412_10768807 | Ga0307412_107688072 | 207 |
| 302 | 3300031995 | Ga0307409_100070998 | Ga0307409_1000709983 | 207 |
| 303 | 3300031995 | Ga0307409_100414196 | Ga0307409_1004141962 | 207 |
| 304 | 3300032002 | Ga0307416_100091310 | Ga0307416_1000913105 | 207 |
| 305 | 3300032002 | Ga0307416_100302030 | Ga0307416_1003020302 | 207 |
| 306 | 3300032002 | Ga0307416_100515253 | Ga0307416_1005152532 | 207 |
| 307 | 3300032004 | Ga0307414_10030904 | Ga0307414_100309045 | 207 |
| 308 | 3300032004 | Ga0307414_10196717 | Ga0307414_101967172 | 207 |
| 309 | 3300032004 | Ga0307414_10795628 | Ga0307414_107956281 | 207 |
| 310 | 3300032005 | Ga0307411_10087010 | Ga0307411_100870102 | 207 |
| 311 | 3300032005 | Ga0307411_10094111 | Ga0307411_100941113 | 207 |
| 312 | 3300032126 | Ga0307415_100039239 | Ga0307415_1000392393 | 207 |
| 313 | 3300032126 | Ga0307415_100532947 | Ga0307415_1005329472 | 207 |
| 314 | 3300032126 | Ga0307415_100813694 | Ga0307415_1008136942 | 207 |
| 315 | 3300035114 | Ga0373939_0125374 | Ga0373939_0125374_93_740 | 207 |
| 316 | 3300035116 | Ga0373945_0164934 | Ga0373945_0164934_204_842 | 207 |
| 317 | 3300035172 | Ga0373955_0168595 | Ga0373955_0168595_597_1247 | 207 |
| 318 | 3300035241 | Ga0373961_0045771 | Ga0373961_0045771_519_1166 | 207 |
| 319 | 3300035242 | Ga0373962_0093870 | Ga0373962_0093870_164_811 | 207 |
| 320 | 3300035691 | Ga0373931_0011920 | Ga0373931_0011920_3528_4175 | 207 |
| 321 | 3300035724 | Ga0373933_0053752 | Ga0373933_0053752_1255_1905 | 207 |
| 322 | 3300035725 | Ga0373947_0055933 | Ga0373947_0055933_905_1555 | 207 |
| 323 | 3300036401 | Ga0373937_0001439 | Ga0373937_0001439_5188_5838 | 207 |
| 324 | 3300041460 | Ga0451802_0240854 | Ga0451802_0240854_109_747 | 207 |
| 325 | 3300041997 | Ga0439431_0107863 | Ga0439431_0107863_40_681 | 207 |
| 326 | 3300042002 | Ga0439442_073445 | Ga0439442_073445_45_683 | 207 |
| 327 | 3300042007 | Ga0439449_0228716 | Ga0439449_0228716_13_651 | 207 |
| 328 | 3300042008 | Ga0439450_072176 | Ga0439450_072176_10_690 | 207 |
| 329 | 3300042125 | Ga0450923_047343 | Ga0450923_047343_21_659 | 207 |
| 330 | 3300042156 | Ga0439446_0019793 | Ga0439446_0019793_273_914 | 207 |
| 331 | 3300042436 | Ga0439435_0071420 | Ga0439435_0071420_281_946 | 207 |
| 332 | 3300042439 | Ga0439464_0007639 | Ga0439464_0007639_86_766 | 207 |
| 333 | 3300042876 | Ga0451577_0050378 | Ga0451577_0050378_848_1486 | 207 |
| 334 | 3300044842 | Ga0466957_0495201 | Ga0466957_0495201_194_832 | 207 |
| 335 | 3300045976 | Ga0466967_0429942 | Ga0466967_0429942_100_738 | 207 |
| 336 | 3300046455 | Ga0495603_0184248 | Ga0495603_0184248_463_1161 | 207 |
| 337 | 3300046499 | Ga0495594_0477034 | Ga0495594_0477034_17_655 | 207 |
| 338 | 3300046559 | Ga0495667_0088435 | Ga0495667_0088435_593_1240 | 207 |
| 339 | 3300046642 | Ga0495634_0108725 | Ga0495634_0108725_25_672 | 207 |
| 340 | 3300046680 | Ga0495646_0109925 | Ga0495646_0109925_59_709 | 207 |
| 341 | 3300046683 | Ga0495658_0078674 | Ga0495658_0078674_357_1001 | 207 |
| 342 | 3300046689 | Ga0495613_0380810 | Ga0495613_0380810_209_853 | 207 |
| 343 | 3300047319 | Ga0495674_0136016 | Ga0495674_0136016_936_1586 | 207 |
| 344 | 3300048905 | Ga0496102_0372185 | Ga0496102_0372185_43_681 | 207 |
| 345 | 3300048907 | Ga0496104_0001736 | Ga0496104_0001736_3568_4206 | 207 |
| 346 | 3300048908 | Ga0496105_0043932 | Ga0496105_0043932_1704_2342 | 207 |
| 347 | 3300048909 | Ga0496106_0142503 | Ga0496106_0142503_1187_1834 | 207 |
| 348 | 3300048910 | Ga0496107_0083476 | Ga0496107_0083476_1065_1703 | 207 |
| 349 | 3300048911 | Ga0496108_0001282 | Ga0496108_0001282_1026_1664 | 207 |
| 350 | 3300048911 | Ga0496108_0334884 | Ga0496108_0334884_661_1299 | 207 |
| 351 | 3300048912 | Ga0496109_0000572 | Ga0496109_0000572_13096_13734 | 207 |
| 352 | 3300048913 | Ga0496110_0004885 | Ga0496110_0004885_8835_9473 | 207 |
| 353 | 3300048913 | Ga0496110_0167916 | Ga0496110_0167916_420_1058 | 207 |
| 354 | 3300048913 | Ga0496110_0186962 | Ga0496110_0186962_726_1364 | 207 |
| 355 | 3300048914 | Ga0496111_0052625 | Ga0496111_0052625_367_1005 | 207 |
| 356 | 3300048914 | Ga0496111_0272339 | Ga0496111_0272339_559_1197 | 207 |
| 357 | 3300048915 | Ga0496112_0000217 | Ga0496112_0000217_14761_15399 | 207 |
| 358 | 3300048915 | Ga0496112_0022045 | Ga0496112_0022045_5211_5849 | 207 |
| 359 | 3300048916 | Ga0496113_0456634 | Ga0496113_0456634_215_862 | 207 |
| 360 | 3300049571 | Ga0501034_0012830 | Ga0501034_0012830_2119_2766 | 207 |
| 361 | 3300049572 | Ga0501036_0416140 | Ga0501036_0416140_433_1071 | 207 |
| 362 | 3300049577 | Ga0501041_0122000 | Ga0501041_0122000_215_853 | 207 |
| 363 | 3300049577 | Ga0501041_0278041 | Ga0501041_0278041_12_650 | 207 |
| 364 | 3300049581 | Ga0501047_0238941 | Ga0501047_0238941_571_1215 | 207 |
| 365 | 3300049581 | Ga0501047_0345094 | Ga0501047_0345094_380_1027 | 207 |
| 366 | 3300049583 | Ga0501067_0247202 | Ga0501067_0247202_297_935 | 207 |
| 367 | 3300049585 | Ga0501069_0074145 | Ga0501069_0074145_445_1083 | 207 |
| 368 | 3300049586 | Ga0501070_0644885 | Ga0501070_0644885_107_745 | 207 |
| 369 | 3300049587 | Ga0501071_0109082 | Ga0501071_0109082_170_808 | 207 |
| 370 | 3300049587 | Ga0501071_0312007 | Ga0501071_0312007_83_721 | 207 |
| 371 | 3300049588 | Ga0501072_0508123 | Ga0501072_0508123_136_774 | 207 |
| 372 | 3300049590 | Ga0501074_0146853 | Ga0501074_0146853_271_909 | 207 |
| 373 | 3300049591 | Ga0501075_0036542 | Ga0501075_0036542_949_1587 | 207 |
| 374 | 3300049591 | Ga0501075_0278376 | Ga0501075_0278376_618_1256 | 207 |
| 375 | 3300049591 | Ga0501075_0287763 | Ga0501075_0287763_84_722 | 207 |
| 376 | 3300049592 | Ga0501076_0029848 | Ga0501076_0029848_3096_3734 | 207 |
| 377 | 3300049593 | Ga0501077_0173457 | Ga0501077_0173457_333_971 | 207 |
| 378 | 3300049704 | Ga0501221_075703 | Ga0501221_075703_78_743 | 207 |
| 379 | 3300049741 | Ga0501079_0050995 | Ga0501079_0050995_303_935 | 207 |
| 380 | 3300049741 | Ga0501079_0358897 | Ga0501079_0358897_410_1048 | 207 |
| 381 | 3300049742 | Ga0501080_0013058 | Ga0501080_0013058_6258_6896 | 207 |
| 382 | 3300049742 | Ga0501080_0225768 | Ga0501080_0225768_615_1262 | 207 |
| 383 | 3300049743 | Ga0501081_0006124 | Ga0501081_0006124_6656_7288 | 207 |
| 384 | 3300049743 | Ga0501081_0021246 | Ga0501081_0021246_1059_1697 | 207 |
| 385 | 3300049824 | Ga0501045_0506550 | Ga0501045_0506550_121_759 | 207 |
| 386 | 3300050491 | nmdc:mga00v17_11646_c1 | nmdc:mga00v17_11646_c1_3404_4051 | 207 |
| 387 | 3300050491 | nmdc:mga00v17_1208_c1 | nmdc:mga00v17_1208_c1_5479_6126 | 207 |
| 388 | 3300050492 | nmdc:mga0yw44_16283_c1 | nmdc:mga0yw44_16283_c1_685_1323 | 207 |
| 389 | 3300050492 | nmdc:mga0yw44_59920_c1 | nmdc:mga0yw44_59920_c1_602_1249 | 207 |
| 390 | 3300050493 | nmdc:mga0k408_3364_c1 | nmdc:mga0k408_3364_c1_130_768 | 207 |
| 391 | 3300050493 | nmdc:mga0k408_37077_c1 | nmdc:mga0k408_37077_c1_939_1586 | 207 |
| 392 | 3300050493 | nmdc:mga0k408_4353_c1 | nmdc:mga0k408_4353_c1_2978_3625 | 207 |
| 393 | 3300050494 | nmdc:mga06z11_223886_c1 | nmdc:mga06z11_223886_c1_389_1036 | 207 |
| 394 | 3300050494 | nmdc:mga06z11_2962_c1 | nmdc:mga06z11_2962_c1_2833_3480 | 207 |
| 395 | 3300050494 | nmdc:mga06z11_3795_c1 | nmdc:mga06z11_3795_c1_470_1117 | 207 |
| 396 | 3300050495 | nmdc:mga04h51_141089_c1 | nmdc:mga04h51_141089_c1_40_687 | 207 |
| 397 | 3300050507 | nmdc:mga05p37_10279_c1 | nmdc:mga05p37_10279_c1_4559_5191 | 207 |
| 398 | 3300050507 | nmdc:mga05p37_30741_c1 | nmdc:mga05p37_30741_c1_92_730 | 207 |
| 399 | 3300050507 | nmdc:mga05p37_314958_c1 | nmdc:mga05p37_314958_c1_85_723 | 207 |
| 400 | 3300050507 | nmdc:mga05p37_32697_c1 | nmdc:mga05p37_32697_c1_4520_5158 | 207 |
| 401 | 3300050507 | nmdc:mga05p37_7719_c1 | nmdc:mga05p37_7719_c1_10213_10878 | 207 |
| 402 | 3300050507 | nmdc:mga05p37_8024_c1 | nmdc:mga05p37_8024_c1_10218_10880 | 207 |
| 403 | 3300050508 | nmdc:mga09592_2893_c1 | nmdc:mga09592_2893_c1_8868_9533 | 207 |
| 404 | 3300050509 | nmdc:mga0qj67_107929_c1 | nmdc:mga0qj67_107929_c1_222_860 | 207 |
| 405 | 3300050509 | nmdc:mga0qj67_324770_c1 | nmdc:mga0qj67_324770_c1_242_880 | 207 |
| 406 | 3300050509 | nmdc:mga0qj67_5114_c1 | nmdc:mga0qj67_5114_c1_7459_8097 | 207 |
| 407 | 3300050509 | nmdc:mga0qj67_794_c1 | nmdc:mga0qj67_794_c1_17012_17677 | 207 |
| 408 | 3300050510 | nmdc:mga06r32_723832_c1 | nmdc:mga06r32_723832_c1_252_890 | 207 |
| 409 | 3300050510 | nmdc:mga06r32_78570_c1 | nmdc:mga06r32_78570_c1_1827_2465 | 207 |
| 410 | 3300050511 | nmdc:mga08y16_130156_c1 | nmdc:mga08y16_130156_c1_838_1518 | 207 |
| 411 | 3300050511 | nmdc:mga08y16_2029_c1 | nmdc:mga08y16_2029_c1_9365_10030 | 207 |
| 412 | 3300050511 | nmdc:mga08y16_957265_c1 | nmdc:mga08y16_957265_c1_161_814 | 207 |
| 413 | 3300050512 | nmdc:mga0n895_118543_c1 | nmdc:mga0n895_118543_c1_650_1297 | 207 |
| 414 | 3300050512 | nmdc:mga0n895_6302_c1 | nmdc:mga0n895_6302_c1_3230_3868 | 207 |
| 415 | 3300050513 | nmdc:mga0rr50_215427_c1 | nmdc:mga0rr50_215427_c1_765_1403 | 207 |
| 416 | 3300050513 | nmdc:mga0rr50_35899_c1 | nmdc:mga0rr50_35899_c1_805_1452 | 207 |
| 417 | 3300050515 | nmdc:mga0a205_18953_c1 | nmdc:mga0a205_18953_c1_2801_3463 | 207 |
| 418 | 3300050515 | nmdc:mga0a205_195795_c1 | nmdc:mga0a205_195795_c1_684_1322 | 207 |
| 419 | 3300053077 | Ga0495601_0035439 | Ga0495601_0035439_1407_2057 | 207 |
| 420 | 3300053084 | Ga0495595_0097526 | Ga0495595_0097526_568_1218 | 207 |
| 421 | 3300053084 | Ga0495595_0149778 | Ga0495595_0149778_119_766 | 207 |
| 422 | 3300053085 | Ga0495619_0154173 | Ga0495619_0154173_94_741 | 207 |
| 423 | 3300054114 | Ga0501084_0124323 | Ga0501084_0124323_581_1219 | 207 |
| 424 | 3300054114 | Ga0501084_0129921 | Ga0501084_0129921_90_728 | 207 |
| 425 | 3300059421 | Ga0590071_001485 | Ga0590071_001485_3693_4331 | 207 |
| 426 | 3300059424 | Ga0590075_001106 | Ga0590075_001106_1867_2505 | 207 |
| 427 | 3300059426 | Ga0590077_002251 | Ga0590077_002251_2588_3226 | 207 |
| 428 | 3300060353 | Ga0501082_0603908 | Ga0501082_0603908_183_821 | 207 |
| 429 | 3300061734 | Ga0530510_0367289 | Ga0530510_0367289_424_1056 | 207 |
| 430 | 3300005329 | Ga0070683_100588023 | Ga0070683_1005880232 | 208 |
| 431 | 3300005331 | Ga0070670_100283004 | Ga0070670_1002830042 | 208 |
| 432 | 3300005344 | Ga0070661_100285177 | Ga0070661_1002851772 | 208 |
| 433 | 3300005354 | Ga0070675_100181715 | Ga0070675_1001817151 | 208 |
| 434 | 3300005355 | Ga0070671_100194137 | Ga0070671_1001941372 | 208 |
| 435 | 3300005456 | Ga0070678_100797685 | Ga0070678_1007976851 | 208 |
| 436 | 3300005471 | Ga0070698_100036799 | Ga0070698_1000367993 | 208 |
| 437 | 3300005535 | Ga0070684_100570715 | Ga0070684_1005707152 | 208 |
| 438 | 3300005543 | Ga0070672_100011885 | Ga0070672_1000118853 | 208 |
| 439 | 3300005545 | Ga0070695_100038534 | Ga0070695_1000385345 | 208 |
| 440 | 3300005577 | Ga0068857_100189683 | Ga0068857_1001896833 | 208 |
| 441 | 3300006237 | Ga0097621_100323220 | Ga0097621_1003232203 | 208 |
| 442 | 3300006844 | Ga0075428_100002186 | Ga0075428_1000021867 | 208 |
| 443 | 3300006846 | Ga0075430_100188828 | Ga0075430_1001888283 | 208 |
| 444 | 3300006852 | Ga0075433_10259057 | Ga0075433_102590572 | 208 |
| 445 | 3300006880 | Ga0075429_100036803 | Ga0075429_1000368033 | 208 |
| 446 | 3300009094 | Ga0111539_10009925 | Ga0111539_100099257 | 208 |
| 447 | 3300009147 | Ga0114129_10032450 | Ga0114129_100324503 | 208 |
| 448 | 3300013296 | Ga0157374_10260324 | Ga0157374_102603243 | 208 |
| 449 | 3300013308 | Ga0157375_11360521 | Ga0157375_113605212 | 208 |
| 450 | 3300014969 | Ga0157376_10080953 | Ga0157376_100809532 | 208 |
| 451 | 3300014969 | Ga0157376_10381974 | Ga0157376_103819742 | 208 |
| 452 | 3300025920 | Ga0207649_10286088 | Ga0207649_102860882 | 208 |
| 453 | 3300025923 | Ga0207681_10213860 | Ga0207681_102138603 | 208 |
| 454 | 3300025931 | Ga0207644_10384381 | Ga0207644_103843812 | 208 |
| 455 | 3300025940 | Ga0207691_10169722 | Ga0207691_101697221 | 208 |
| 456 | 3300026121 | Ga0207683_10961281 | Ga0207683_109612811 | 208 |
| 457 | 3300028381 | Ga0268264_10645178 | Ga0268264_106451782 | 208 |
| 458 | 3300031731 | Ga0307405_10012845 | Ga0307405_100128453 | 208 |
| 459 | 3300031852 | Ga0307410_10044118 | Ga0307410_100441183 | 208 |
| 460 | 3300031903 | Ga0307407_10095160 | Ga0307407_100951603 | 208 |
| 461 | 3300031911 | Ga0307412_10019332 | Ga0307412_100193322 | 208 |
| 462 | 3300031995 | Ga0307409_100017600 | Ga0307409_1000176005 | 208 |
| 463 | 3300031995 | Ga0307409_100023507 | Ga0307409_1000235073 | 208 |
| 464 | 3300032002 | Ga0307416_100003678 | Ga0307416_1000036784 | 208 |
| 465 | 3300032002 | Ga0307416_100012528 | Ga0307416_1000125283 | 208 |
| 466 | 3300032004 | Ga0307414_10031132 | Ga0307414_100311322 | 208 |
| 467 | 3300032004 | Ga0307414_10314510 | Ga0307414_103145102 | 208 |
| 468 | 3300032005 | Ga0307411_10030399 | Ga0307411_100303993 | 208 |
| 469 | 3300032126 | Ga0307415_100055135 | Ga0307415_1000551353 | 208 |
| 470 | 3300032126 | Ga0307415_101042865 | Ga0307415_1010428651 | 208 |
| 471 | 3300041458 | Ga0451798_0999571 | Ga0451798_0999571_54_680 | 208 |
| 472 | 3300046499 | Ga0495594_0251175 | Ga0495594_0251175_318_959 | 208 |
| 473 | 3300050507 | nmdc:mga05p37_692514_c1 | nmdc:mga05p37_692514_c1_11_637 | 208 |
| 474 | 3300050508 | nmdc:mga09592_13838_c1 | nmdc:mga09592_13838_c1_4241_4867 | 208 |
| 475 | 3300050509 | nmdc:mga0qj67_52953_c2 | nmdc:mga0qj67_52953_c2_969_1595 | 208 |
| 476 | 3300050510 | nmdc:mga06r32_68021_c1 | nmdc:mga06r32_68021_c1_1040_1666 | 208 |
| 477 | 3300050515 | nmdc:mga0a205_94173_c1 | nmdc:mga0a205_94173_c1_1838_2473 | 208 |
| 478 | 3300005289 | Ga0065704_10265935 | Ga0065704_102659352 | 209 |
| 479 | 3300005295 | Ga0065707_10001636 | Ga0065707_100016364 | 209 |
| 480 | 3300009147 | Ga0114129_10087394 | Ga0114129_100873943 | 209 |
| 481 | 3300009147 | Ga0114129_10220396 | Ga0114129_102203962 | 209 |
| 482 | 3300009147 | Ga0114129_11144541 | Ga0114129_111445412 | 209 |
| 483 | 3300031824 | Ga0307413_10222171 | Ga0307413_102221712 | 209 |
| 484 | 3300031903 | Ga0307407_10390630 | Ga0307407_103906302 | 209 |
| 485 | 3300035691 | Ga0373931_0170531 | Ga0373931_0170531_214_843 | 209 |
| 486 | 3300044673 | Ga0453683_0000748 | Ga0453683_0000748_27605_28234 | 209 |
| 487 | 3300045051 | Ga0451576_0028911 | Ga0451576_0028911_4522_5151 | 209 |
| 488 | 3300049770 | Ga0501273_031241 | Ga0501273_031241_62_691 | 209 |
| 489 | 3300050507 | nmdc:mga05p37_26364_c1 | nmdc:mga05p37_26364_c1_3236_3865 | 209 |
| 490 | 3300050507 | nmdc:mga05p37_316449_c1 | nmdc:mga05p37_316449_c1_188_817 | 209 |
| 491 | 3300050507 | nmdc:mga05p37_3405_c1 | nmdc:mga05p37_3405_c1_251_880 | 209 |
| 492 | 3300050507 | nmdc:mga05p37_441148_c1 | nmdc:mga05p37_441148_c1_135_764 | 209 |
| 493 | 3300050510 | nmdc:mga06r32_34767_c1 | nmdc:mga06r32_34767_c1_2021_2650 | 209 |
| 494 | 3300050512 | nmdc:mga0n895_357246_c1 | nmdc:mga0n895_357246_c1_710_1339 | 209 |
| 495 | 3300050515 | nmdc:mga0a205_67532_c1 | nmdc:mga0a205_67532_c1_2083_2712 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xmk-assembly1.cif.gz_I | cryo-em structure of the atp-bound vps4 mutant-e233q complex with vta1 (masked) | 0.9164 | 6 | 40 |
| 5xmk-assembly1.cif.gz_M | cryo-em structure of the atp-bound vps4 mutant-e233q complex with vta1 (masked) | 0.9004 | 6 | 40 |
| 2rkl-assembly2.cif.gz_D | crystal structure of s.cerevisiae vta1 c-terminal domain | 0.8986 | 6 | 40 |
| 7cnx-assembly2.cif.gz_E | crystal structure of apo psd from e. coli (2.63 a) | 0.8193 | 44 | 176 |
| 2rkl-assembly2.cif.gz_D | crystal structure of s.cerevisiae vta1 c-terminal domain | 0.7491 | 6 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1P8BFL1_384_528_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9345 | 5 | 41 | 1.25.40.10 |
| af_P9WHQ5_55_228_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9342 | 37 | 206 | 2.70.70.10 |
| af_P9WHQ5_55_228_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9085 | 37 | 206 | 2.70.70.10 |
| 3ax2G00 | Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain | 0.9034 | 4 | 40 | 1.20.960.10 |
| af_Q4D7C7_4_76_1.20.58.80 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.9023 | 4 | 40 | 1.20.58.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Y1BSU0-F1-model_v4 | deleted | 0.9892 | 107 | 207 |
|
| AF-A0A1V3WNV3-F1-model_v4 | Phosphatidylserine decarboxylase family protein | 0.9884 | 98 | 209 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A359LQR7-F1-model_v4 | Phosphatidylserine decarboxylase family protein | 0.9854 | 84 | 209 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A7Z9S463-F1-model_v4 | Phosphatidylserine decarboxylase family protein (EC 4.1.1.65) | 0.9835 | 84 | 206 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A378VWY5-F1-model_v4 | Phosphatidylserine decarboxylase | 0.9811 | 94 | 209 |
GO:0004609
GO:0005886 GO:0008654 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar