F454697

General Info

Members Datasets Scaffolds Average Seq Length
495 400 990 147

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100044525|Ga0070665_1000445253
Length 173
Sequence MAGGIREHHGEELAENHEINVTPFIDVILVLLIIFMVAAPLATVDVNVDLPASTAKPADRPEEPLYVTVKQDLSLNIGNDPVARDSFSTSLDAVTQGNRDRRIFLRADKAVDYGQFMEVMNLLRDAGYLKIALVGLETVPGAAPASAAPAQEGAHAATRSSTLPVNEPAGVTP

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
58 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
114 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
115 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
240 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
243 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
244 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
245 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
248 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
249 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
250 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
251 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
252 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
253 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
254 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
255 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
256 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
257 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
258 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
259 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
260 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
261 2643221558 Rhizobium sp. Root149 Isolate Unclassified
262 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
263 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
264 2643221719 Rhizobium sp. Root274 Isolate Unclassified
265 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
266 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
267 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
268 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
269 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
270 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
271 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
272 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
273 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
274 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
275 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
276 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
277 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
278 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
279 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
280 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
281 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
282 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
283 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
284 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
285 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
286 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
287 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
288 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
289 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
290 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
291 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
292 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
293 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
294 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
295 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
296 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
297 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
298 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
299 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
300 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
301 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
302 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
303 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
304 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
305 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
306 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
307 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
308 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
309 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
310 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
311 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
312 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
313 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
314 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
315 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
316 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
317 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
318 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
319 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
320 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
321 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
322 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
323 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
324 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
325 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
326 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
327 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
328 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
329 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
330 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
331 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
332 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
333 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
334 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
335 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
336 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
337 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
338 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
339 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
340 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
341 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
342 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
343 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
344 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
345 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
346 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
347 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
348 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
349 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
350 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
351 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
352 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
353 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
354 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
355 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
356 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
357 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
358 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
359 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
360 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
361 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
362 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
363 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
364 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
365 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
366 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
367 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
368 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
369 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
370 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
371 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
372 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
373 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
374 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
375 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
376 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
377 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
378 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
379 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
380 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
381 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
382 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
383 3004167301 Mesorhizobium loti 582 Isolate Unclassified
384 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
385 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
386 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
387 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
388 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
389 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
390 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
391 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
392 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
393 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
394 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
395 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
396 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
397 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
398 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
399 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
400 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.29
Metatranscriptomes 0
Isolates 30.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.13
Nodule 23.84
Rhizoplane 1.82
Rhizosphere 45.66
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100044525 3300005548 Bacteria 4457
2 JGI25157J39369_1000607 3300002741 Bacteria 20657
3 JGI25165J46597_1010982 3300003214 Bacteria 1305
4 Ga0055536_1008697 3300003781 Bacteria 4316
5 Ga0055531_10010943 3300003794 Bacteria 4443
6 Ga0065165_1001079 3300005262 Bacteria 32537
7 Ga0065715_10332576 3300005293 Bacteria 981
8 Ga0065707_10976104 3300005295 Bacteria 545
9 Ga0070676_10189066 3300005328 Bacteria 1343
10 Ga0070680_101892842 3300005336 Bacteria 517
11 Ga0070682_100265024 3300005337 Bacteria 1245
12 Ga0070661_101051156 3300005344 Bacteria 677
13 Ga0070661_101241960 3300005344 Bacteria 624
14 Ga0070668_100109367 3300005347 Bacteria 2199
15 Ga0070668_101147401 3300005347 Bacteria 703
16 Ga0070669_100443675 3300005353 Bacteria 1069
17 Ga0070674_100067936 3300005356 Bacteria 2509
18 Ga0070673_100057738 3300005364 Bacteria 3067
19 Ga0070688_100971100 3300005365 Unclassified 673
20 Ga0070709_10039284 3300005434 Bacteria 2903
21 Ga0070709_10929682 3300005434 Bacteria 689
22 Ga0070714_100116184 3300005435 Bacteria 2375
23 Ga0070713_100065308 3300005436 Bacteria 3056
24 Ga0070710_10004393 3300005437 Bacteria 6674
25 Ga0070710_10709330 3300005437 Bacteria 711
26 Ga0070711_100061640 3300005439 Bacteria 2612
27 Ga0070711_101048984 3300005439 Bacteria 701
28 Ga0070663_100269665 3300005455 Bacteria 1353
29 Ga0070678_100171840 3300005456 Bacteria 1766
30 Ga0070678_101062306 3300005456 Bacteria 746
31 Ga0070662_100176797 3300005457 Bacteria 1680
32 Ga0070681_10803729 3300005458 Bacteria 858
33 Ga0070706_101099008 3300005467 Bacteria 732
34 Ga0070698_100167505 3300005471 Bacteria 2139
35 Ga0070699_100393142 3300005518 Bacteria 1253
36 Ga0070697_100501918 3300005536 Bacteria 1061
37 Ga0068853_100627883 3300005539 Bacteria 1021
38 Ga0068853_100640756 3300005539 Bacteria 1011
39 Ga0070665_100179558 3300005548 Bacteria 2118
40 Ga0070665_100439725 3300005548 Bacteria 1313
41 Ga0070665_101296214 3300005548 Unclassified 738
42 Ga0068855_100722740 3300005563 Bacteria 1064
43 Ga0070664_100415275 3300005564 Bacteria 1232
44 Ga0068864_100246608 3300005618 Bacteria 1657
45 Ga0068866_10254911 3300005718 Bacteria 1075
46 Ga0068866_11104072 3300005718 Unclassified 568
47 Ga0068861_100003138 3300005719 Bacteria 10921
48 Ga0068862_100116232 3300005844 Bacteria 2353
49 Ga0081455_10001444 3300005937 Bacteria 29403
50 Ga0081455_10109089 3300005937 Bacteria 2203
51 Ga0081540_1031281 3300005983 Bacteria 2929
52 Ga0070717_10023047 3300006028 Bacteria 4927
53 Ga0070717_10027566 3300006028 Bacteria 4541
54 Ga0075365_10027194 3300006038 Bacteria 3637
55 Ga0075365_10404887 3300006038 Bacteria 963
56 Ga0075365_10692577 3300006038 Bacteria 720
57 Ga0075364_10001561 3300006051 Bacteria 12531
58 Ga0075364_10058487 3300006051 Bacteria 2526
59 Ga0070715_10010105 3300006163 Bacteria 3353
60 Ga0070716_100615273 3300006173 Bacteria 819
61 Ga0070712_100042140 3300006175 Bacteria 3138
62 Ga0070712_100190266 3300006175 Bacteria 1605
63 Ga0075362_10253335 3300006177 Bacteria 866
64 Ga0075362_10370941 3300006177 Bacteria 719
65 Ga0075367_10446640 3300006178 Bacteria 819
66 Ga0075369_10080805 3300006186 Bacteria 1441
67 Ga0075369_10098897 3300006186 Bacteria 1307
68 Ga0075369_10267050 3300006186 Bacteria 796
69 Ga0075366_10003699 3300006195 Bacteria 8115
70 Ga0075366_10029583 3300006195 Bacteria 3218
71 Ga0075370_10081241 3300006353 Bacteria 1863
72 Ga0075428_101096348 3300006844 Bacteria 841
73 Ga0075430_100900968 3300006846 Bacteria 729
74 Ga0075430_101209867 3300006846 Bacteria 622
75 Ga0068865_100225019 3300006881 Bacteria 1468
76 Ga0068865_100529110 3300006881 Bacteria 987
77 Ga0075436_100870595 3300006914 Bacteria 673
78 Ga0099825_1054850 3300006941 Bacteria 776
79 Ga0099824_1017157 3300006942 Bacteria 6356
80 Ga0099824_1030101 3300006942 Bacteria 2219
81 Ga0099822_1027724 3300006943 Bacteria 4622
82 Ga0099823_1000044 3300006944 Bacteria 60201
83 Ga0075435_100813002 3300007076 Bacteria 814
84 Ga0105240_10179588 3300009093 Bacteria 2499
85 Ga0105240_10274849 3300009093 Bacteria 1938
86 Ga0105240_11058932 3300009093 Bacteria 865
87 Ga0105245_10121098 3300009098 Bacteria 2445
88 Ga0105245_11977453 3300009098 Bacteria 636
89 Ga0114129_10057579 3300009147 Bacteria 5438
90 Ga0105242_11667482 3300009176 Bacteria 673
91 Ga0105238_10018079 3300009551 Bacteria 7166
92 Ga0105238_10192033 3300009551 Bacteria 2018
93 Ga0105249_10103477 3300009553 Bacteria 2682
94 Ga0099796_10098673 3300010159 Bacteria 1096
95 Ga0157369_10273116 3300013105 Bacteria 1761
96 Ga0163162_10006478 3300013306 Bacteria 11335
97 Ga0157372_12470493 3300013307 Bacteria 597
98 Ga0157375_11254625 3300013308 Bacteria 870
99 Ga0163163_11357091 3300014325 Bacteria 773
100 Ga0157380_10001195 3300014326 Bacteria 16796
101 Ga0157376_10433729 3300014969 Bacteria 1278
102 Ga0182007_10143989 3300015262 Bacteria 807
103 Ga0163161_10658329 3300017792 Bacteria 868
104 Ga0224572_1069766 3300024225 Bacteria 650
105 Ga0209026_1000032 3300025250 Bacteria 322378
106 Ga0209677_100606 3300025253 Bacteria 19282
107 Ga0209148_1015511 3300025254 Bacteria 1329
108 Ga0209759_1000142 3300025256 Bacteria 124090
109 Ga0209455_1003086 3300025272 Bacteria 6081
110 Ga0209758_1001799 3300025297 Bacteria 23675
111 Ga0209758_1002861 3300025297 Bacteria 16759
112 Ga0209050_1005002 3300025298 Bacteria 8617
113 Ga0207426_1006468 3300025302 Bacteria 5094
114 Ga0209051_1000574 3300025303 Bacteria 44189
115 Ga0207692_10069004 3300025898 Bacteria 1856
116 Ga0207642_10135521 3300025899 Bacteria 1291
117 Ga0207685_10080400 3300025905 Bacteria 1347
118 Ga0207699_10575639 3300025906 Bacteria 818
119 Ga0207699_10733289 3300025906 Bacteria 724
120 Ga0207645_10419972 3300025907 Bacteria 901
121 Ga0207684_10042447 3300025910 Bacteria 3855
122 Ga0207695_10242502 3300025913 Bacteria 1703
123 Ga0207695_11330279 3300025913 Bacteria 599
124 Ga0207693_10051924 3300025915 Bacteria 3216
125 Ga0207693_10526499 3300025915 Bacteria 922
126 Ga0207693_10610179 3300025915 Bacteria 849
127 Ga0207663_10061037 3300025916 Bacteria 2391
128 Ga0207649_10200622 3300025920 Bacteria 1409
129 Ga0207646_10463531 3300025922 Bacteria 1143
130 Ga0207694_10095857 3300025924 Bacteria 2346
131 Ga0207694_10113251 3300025924 Bacteria 2160
132 Ga0207687_10598011 3300025927 Unclassified 929
133 Ga0207644_11624793 3300025931 Bacteria 542
134 Ga0207706_10141669 3300025933 Bacteria 2115
135 Ga0207669_10083636 3300025937 Bacteria 2053
136 Ga0207704_10097918 3300025938 Bacteria 1947
137 Ga0207704_10472055 3300025938 Bacteria 1005
138 Ga0207665_10106869 3300025939 Bacteria 1962
139 Ga0207665_10437949 3300025939 Bacteria 1001
140 Ga0207689_11578254 3300025942 Unclassified 546
141 Ga0207679_10617909 3300025945 Bacteria 978
142 Ga0207667_10593888 3300025949 Bacteria 1117
143 Ga0207667_11217640 3300025949 Bacteria 732
144 Ga0207668_10071586 3300025972 Bacteria 2477
145 Ga0207668_10838054 3300025972 Bacteria 816
146 Ga0207668_11397347 3300025972 Bacteria 631
147 Ga0207677_11513274 3300026023 Unclassified 620
148 Ga0207639_10058129 3300026041 Bacteria 2973
149 Ga0207639_10344478 3300026041 Bacteria 1329
150 Ga0207639_10400023 3300026041 Bacteria 1237
151 Ga0207702_11192180 3300026078 Bacteria 756
152 Ga0207675_100022261 3300026118 Bacteria 5902
153 Ga0207683_11152110 3300026121 Bacteria 719
154 Ga0209389_1000046 3300027296 Bacteria 117363
155 Ga0209589_1000175 3300027357 Bacteria 73346
156 Ga0209589_1006990 3300027357 Bacteria 18386
157 Ga0209489_100112 3300027361 Bacteria 117364
158 Ga0209489_106620 3300027361 Bacteria 18386
159 Ga0209700_100029 3300027363 Bacteria 214607
160 Ga0209700_106374 3300027363 Bacteria 18386
161 Ga0209813_10490596 3300027866 Bacteria 508
162 Ga0268266_10022546 3300028379 Bacteria 5364
163 Ga0268266_10089214 3300028379 Bacteria 2699
164 Ga0268266_11090255 3300028379 Bacteria 773
165 Ga0268265_10557980 3300028380 Bacteria 1088
166 Ga0268265_10765288 3300028380 Bacteria 938
167 Ga0268264_10000065 3300028381 Bacteria 298403
168 Ga0265326_10002939 3300028558 Bacteria 5693
169 Ga0265319_1007567 3300028563 Bacteria 4864
170 Ga0265334_10019631 3300028573 Bacteria 2777
171 Ga0265318_10050181 3300028577 Bacteria 1568
172 Ga0265323_10001443 3300028653 Bacteria 11682
173 Ga0265336_10000335 3300028666 Bacteria 31241
174 Ga0307515_10165774 3300028794 Bacteria 2228
175 Ga0265338_10000321 3300028800 Bacteria 87046
176 Ga0265338_10006337 3300028800 Bacteria 15116
177 Ga0265324_10002307 3300029957 Bacteria 9895
178 Ga0307511_10126278 3300030521 Bacteria 1559
179 Ga0265325_10005626 3300031241 Bacteria 7715
180 Ga0265325_10018416 3300031241 Bacteria 3873
181 Ga0265339_10000531 3300031249 Bacteria 29760
182 Ga0265339_10001451 3300031249 Bacteria 17559
183 Ga0265313_10000366 3300031595 Bacteria 49088
184 Ga0265313_10147947 3300031595 Bacteria 1006
185 Ga0265342_10211604 3300031712 Bacteria 1048
186 Ga0307516_10047725 3300031730 Bacteria 4216
187 Ga0307405_10331586 3300031731 Bacteria 1166
188 Ga0307405_10743556 3300031731 Bacteria 816
189 Ga0307413_10815028 3300031824 Bacteria 786
190 Ga0307406_11000789 3300031901 Bacteria 717
191 Ga0307407_10307434 3300031903 Bacteria 1108
192 Ga0307409_101166368 3300031995 Bacteria 793
193 Ga0307409_101876427 3300031995 Bacteria 629
194 Ga0307409_102223267 3300031995 Bacteria 578
195 Ga0307416_102948756 3300032002 Bacteria 569
196 Ga0307411_10472328 3300032005 Bacteria 1054
197 Ga0307411_11555826 3300032005 Bacteria 609
198 Ga0307415_101679176 3300032126 Bacteria 612
199 Ga0307507_10041543 3300033179 Bacteria 4599
200 Ga0307510_10310328 3300033180 Bacteria 1037
201 Ga0373926_0069246 3300035083 Bacteria 1295
202 Ga0373934_0349458 3300035086 Bacteria 616
203 Ga0373924_0145063 3300035410 Bacteria 1037
204 Ga0373935_1522474 3300035692 Bacteria 501
205 Ga0373927_0333579 3300035695 Bacteria 999
206 Ga0373933_0274910 3300035724 Bacteria 1088
207 Ga0373933_0648905 3300035724 Bacteria 694
208 Ga0373947_0551546 3300035725 Bacteria 785
209 Ga0373947_0630620 3300035725 Bacteria 731
210 Ga0373937_0707279 3300036401 Bacteria 954
211 Ga0373925_0067783 3300037068 Bacteria 2692
212 Ga0373925_0161750 3300037068 Bacteria 1764
213 Ga0395900_0539047 3300037418 Bacteria 1113
214 Ga0395900_1012552 3300037418 Bacteria 750
215 Ga0395898_0070882 3300037466 Bacteria 3369
216 Ga0395905_0001756 3300037471 Bacteria 25281
217 Ga0395905_0814151 3300037471 Bacteria 837
218 Ga0436364_0076071 3300037853 Bacteria 1096
219 Ga0436364_1287212 3300037853 Bacteria 657
220 Ga0395901_0661123 3300038443 Bacteria 1047
221 Ga0436365_0620432 3300039437 Bacteria 1283
222 Ga0436360_1238983 3300039438 Bacteria 927
223 Ga0436361_0706289 3300039447 Bacteria 1103
224 Ga0439453_0019896 3300041408 Bacteria 1199
225 Ga0439465_0014446 3300041413 Bacteria 2460
226 Ga0439448_0115528 3300042005 Bacteria 919
227 Ga0439456_005515 3300042013 Bacteria 2569
228 Ga0439435_0098681 3300042436 Bacteria 895
229 Ga0439459_0119026 3300042438 Bacteria 664
230 Ga0466965_0041130 3300044683 Bacteria 2277
231 Ga0466965_0136471 3300044683 Bacteria 1275
232 Ga0466970_0106484 3300044765 Bacteria 1530
233 Ga0466957_0245737 3300044842 Bacteria 1188
234 Ga0466959_0083146 3300045049 Bacteria 2306
235 Ga0466967_1395235 3300045976 Bacteria 698
236 Ga0495638_0061977 3300046460 Bacteria 2309
237 Ga0495628_1020664 3300046516 Bacteria 568
238 Ga0495587_0189716 3300046536 Bacteria 1164
239 Ga0495645_0518104 3300046543 Bacteria 743
240 Ga0495622_0205991 3300046557 Bacteria 875
241 Ga0495633_0251455 3300046558 Bacteria 806
242 Ga0495667_0067893 3300046559 Bacteria 2329
243 Ga0495588_0336937 3300046674 Bacteria 793
244 Ga0495599_0097678 3300046678 Bacteria 1831
245 Ga0495658_0223068 3300046683 Bacteria 1181
246 Ga0495658_0464592 3300046683 Bacteria 809
247 Ga0495600_0311374 3300046809 Bacteria 992
248 Ga0495660_0191680 3300046810 Bacteria 982
249 Ga0495680_0149363 3300047322 Bacteria 1705
250 Ga0495686_0051401 3300047472 Bacteria 2586
251 Ga0496100_0143978 3300048903 Bacteria 1693
252 Ga0496106_0001175 3300048909 Bacteria 19486
253 Ga0496106_1229587 3300048909 Bacteria 583
254 Ga0496108_1238282 3300048911 Bacteria 630
255 Ga0496110_0263513 3300048913 Bacteria 1569
256 Ga0496114_0513645 3300048917 Bacteria 1060
257 Ga0496114_1540480 3300048917 Bacteria 553
258 Ga0496115_0196498 3300048918 Bacteria 1667
259 Ga0496115_0777682 3300048918 Bacteria 747
260 Ga0496116_0126740 3300048919 Bacteria 1465
261 Ga0496117_0025015 3300048920 Bacteria 4703
262 Ga0496118_0003807 3300048921 Bacteria 18589
263 Ga0496118_0035920 3300048921 Bacteria 4015
264 Ga0496119_0036561 3300048922 Bacteria 3203
265 Ga0496119_0072702 3300048922 Bacteria 2008
266 Ga0496120_0003403 3300048923 Bacteria 14547
267 Ga0496120_0021153 3300048923 Bacteria 4116
268 Ga0496120_0079523 3300048923 Bacteria 1779
269 Ga0496121_0000001 3300048924 Bacteria 1830318
270 Ga0496121_0000668 3300048924 Bacteria 64093
271 Ga0496121_0005331 3300048924 Bacteria 16532
272 Ga0496121_0162567 3300048924 Bacteria 1631
273 Ga0496121_0560539 3300048924 Bacteria 713
274 Ga0496122_0000018 3300048925 Bacteria 426350
275 Ga0496123_0000015 3300048926 Bacteria 426088
276 Ga0496124_0000955 3300048927 Bacteria 46091
277 Ga0496124_0012140 3300048927 Bacteria 8535
278 Ga0496124_0060512 3300048927 Bacteria 3177
279 Ga0496125_0000001 3300048928 Bacteria 1766138
280 Ga0496125_0028110 3300048928 Bacteria 5085
281 Ga0496125_0400041 3300048928 Bacteria 803
282 Ga0496126_0036227 3300048929 Bacteria 4615
283 Ga0496126_0143765 3300048929 Bacteria 2051
284 Ga0496126_0333471 3300048929 Bacteria 1244
285 Ga0496126_0621706 3300048929 Bacteria 848
286 Ga0501034_0055571 3300049571 Bacteria 3984
287 Ga0501039_1305191 3300049575 Bacteria 560
288 Ga0501041_0440306 3300049577 Bacteria 827
289 Ga0501041_0611383 3300049577 Bacteria 696
290 Ga0501043_0438924 3300049579 Bacteria 982
291 Ga0501068_0628594 3300049584 Bacteria 700
292 Ga0501072_0390836 3300049588 Bacteria 1104
293 Ga0501075_0225892 3300049591 Bacteria 1428
294 Ga0501077_0330325 3300049593 Bacteria 972
295 Ga0501079_0989113 3300049741 Bacteria 663
296 Ga0501080_0052344 3300049742 Bacteria 3800
297 Ga0501035_1126655 3300049822 Bacteria 612
298 nmdc:mga03683_26118_c1 3300050489 Bacteria 2301
299 nmdc:mga03683_68105_c1 3300050489 Bacteria 1516
300 nmdc:mga03n38_425635_c1 3300050490 Bacteria 735
301 nmdc:mga00v17_2823_c1 3300050491 Bacteria 8927
302 nmdc:mga00v17_6014_c1 3300050491 Bacteria 6421
303 nmdc:mga0yw44_422490_c1 3300050492 Bacteria 902
304 nmdc:mga0yw44_466061_c1 3300050492 Bacteria 856
305 nmdc:mga0yw44_52103_c1 3300050492 Bacteria 2480
306 nmdc:mga0yw44_787467_c1 3300050492 Bacteria 646
307 nmdc:mga0k408_3292_c1 3300050493 Bacteria 8547
308 nmdc:mga04h51_482385_c1 3300050495 Bacteria 528
309 nmdc:mga05p37_52468_c1 3300050507 Bacteria 5014
310 nmdc:mga06r32_457689_c1 3300050510 Bacteria 1255
311 nmdc:mga08y16_477640_c1 3300050511 Bacteria 1269
312 nmdc:mga0n895_1031191_c1 3300050512 Bacteria 803
313 nmdc:mga0rr50_775327_c1 3300050513 Bacteria 818
314 nmdc:mga08x19_749829_c1 3300050514 Bacteria 693
315 nmdc:mga0sz30_83347_c1 3300050516 Bacteria 1385
316 Ga0500635_0007459 3300053080 Bacteria 2966
317 Ga0495595_0176372 3300053084 Bacteria 1059
318 Ga0495595_0264870 3300053084 Bacteria 862
319 Ga0500643_006454 3300053087 Bacteria 4900
320 Ga0500643_016590 3300053087 Bacteria 2491
321 Ga0500566_0033792 3300053094 Bacteria 2978
322 Ga0500572_000619 3300053111 Bacteria 11919
323 Ga0500595_103518 3300053119 Bacteria 814
324 Ga0500618_001577 3300053125 Bacteria 9932
325 Ga0500618_030561 3300053125 Bacteria 1266
326 Ga0500626_016092 3300053128 Bacteria 3271
327 Ga0500559_0440727 3300053136 Bacteria 603
328 Ga0500568_0000483 3300053139 Bacteria 29418
329 Ga0500573_0004069 3300053140 Bacteria 7651
330 Ga0500573_0029011 3300053140 Bacteria 3188
331 Ga0500590_121970 3300053148 Bacteria 1220
332 Ga0500616_0075609 3300053153 Bacteria 1704
333 Ga0500624_000277 3300053157 Bacteria 17671
334 Ga0500627_0185066 3300053158 Bacteria 936
335 Ga0500638_031835 3300053162 Bacteria 2545
336 Ga0500639_134400 3300053163 Bacteria 1167
337 Ga0500636_0005564 3300053177 Bacteria 7193
338 Ga0500636_0107524 3300053177 Bacteria 1579
339 Ga0500636_0304954 3300053177 Bacteria 782
340 Ga0500636_0445846 3300053177 Bacteria 586
341 Ga0500576_021443 3300053725 Bacteria 2949
342 Ga0500552_000619 3300053733 Bacteria 3348
343 Ga0500596_003471 3300053735 Bacteria 2992
344 2509372537 2509276018 Bacteria 6910194
345 2510839733 2510461069 Bacteria 5505000
346 2512933462 2512875016 Bacteria 6529530
347 2513645531 2513237095 Bacteria 8976980
348 2513873061 2513237139 Bacteria 8737671
349 2514015639 2513237161 Bacteria 8871253
350 2524437644 2524023205 Bacteria 8918781
351 2586002886 2585427634 Bacteria 6455027
352 2588519532 2588253730 Bacteria 6881675
353 2597811826 2597489875 Bacteria 7010078
354 2617347076 2617270735 Bacteria 9163226
355 2643812428 2643221558 Bacteria 5460675
356 2644154680 2643221627 Bacteria 6761570
357 2644300465 2643221653 Bacteria 4569637
358 2644658806 2643221719 Bacteria 4568197
359 2671695519 2671180139 Bacteria 4196045
360 2688596428 2687453392 Bacteria 6880454
361 2694635556 2693429784 Bacteria 7241525
362 2723573519 2721755686 Bacteria 7343952
363 2745079577 2744054633 Bacteria 8678936
364 2756673814 2756170246 Bacteria 7451806
365 2757570555 2757320392 Bacteria 3737298
366 2793062676 2791355196 Bacteria 7323613
367 2805915040 2802429603 Bacteria 8777136
368 2818238578 2816332527 Bacteria 8933356
369 2819243445 2818991272 Bacteria 4622173
370 2824674896 2824671348 Bacteria 8369588
371 2824691321 2824687955 Bacteria 8360029
372 2824699499 2824696289 Bacteria 8335049
373 2838123430 2838122688 Bacteria 8803140
374 2841947797 2841941048 Bacteria 8688029
375 2841949532 2841949485 Bacteria 8680857
376 2841964127 2841957949 Bacteria 8652217
377 2841971961 2841966195 Bacteria 8673214
378 2841974696 2841974524 Bacteria 8931498
379 2841983746 2841983080 Bacteria 8395090
380 2842040104 2842038055 Bacteria 8002051
381 2842046951 2842045827 Bacteria 8006841
382 2842337366 2842333319 Bacteria 8899485
383 2844003007 2844002411 Bacteria 7168230
384 2844319340 2844315083 Bacteria 8138177
385 2847946862 2847939898 Bacteria 8606328
386 2849079034 2849076700 Bacteria 7039503
387 2854918146 2854916844 Bacteria 5725939
388 2856327289 2856320880 Bacteria 7263508
389 2856338615 2856334872 Bacteria 7037011
390 2857373429 2857367948 Bacteria 6965560
391 2869253245 2869249662 Bacteria 6868783
392 2869266432 2869264136 Bacteria 6880765
393 2869279483 2869278585 Bacteria 7077053
394 2869286381 2869285874 Bacteria 6901219
395 2871430350 2871429161 Bacteria 6547891
396 2871453386 2871451962 Bacteria 7336357
397 2871461405 2871459585 Bacteria 6866887
398 2871469793 2871466892 Bacteria 6923287
399 2874130172 2874123672 Bacteria 7238285
400 2874135271 2874131515 Bacteria 6820270
401 2874139526 2874139085 Bacteria 7021506
402 2874146768 2874146452 Bacteria 7533118
403 2874155841 2874155637 Bacteria 6724144
404 2874176732 2874168670 Bacteria 8062617
405 2874627510 2874620515 Bacteria 8290088
406 2874632172 2874628541 Bacteria 8630250
407 2876364284 2876363079 Bacteria 6544991
408 2876377593 2876369609 Bacteria 6807521
409 2876399309 2876392853 Bacteria 6660880
410 2876414170 2876413966 Bacteria 6831344
411 2876764872 2876761206 Bacteria 10111113
412 2878742009 2878738818 Bacteria 7136951
413 2878746546 2878745973 Bacteria 6867388
414 2881368558 2881364244 Bacteria 7710352
415 2881868090 2881861095 Bacteria 7128710
416 2882640279 2882632389 Bacteria 8154593
417 2885307263 2885305155 Bacteria 7348390
418 2885323479 2885318864 Bacteria 6729568
419 2885338140 2885334103 Bacteria 7216818
420 2885386397 2885383462 Bacteria 9473874
421 2885410461 2885409591 Bacteria 9235467
422 2888384392 2888378607 Bacteria 9652610
423 2899805088 2899803654 Bacteria 5577784
424 2903455191 2903448605 Bacteria 7357801
425 2903499736 2903492973 Bacteria 13473544
426 2903525556 2903521522 Bacteria 6525694
427 2903532897 2903528002 Bacteria 6586099
428 2903734281 2903727486 Bacteria 8281579
429 2903751140 2903748898 Bacteria 9972761
430 2904665836 2904659560 Bacteria 6685615
431 2904673170 2904666416 Bacteria 8226587
432 2906308947 2906308376 Bacteria 6841989
433 2906322228 2906321335 Bacteria 6579571
434 2906369064 2906363423 Bacteria 6856682
435 2906376371 2906370794 Bacteria 6881062
436 2906380563 2906378014 Bacteria 6911440
437 2906400238 2906393657 Bacteria 6790866
438 2906605526 2906602504 Bacteria 8295279
439 2917556460 2917554339 Bacteria 4987857
440 2924724794 2924718760 Bacteria 6331356
441 2924768425 2924762789 Bacteria 6561353
442 2924779693 2924776078 Bacteria 7492003
443 2924790766 2924784321 Bacteria 7416538
444 2929138774 2929138655 Bacteria 5810547
445 2937822287 2937813078 Bacteria 7783518
446 2937823974 2937822353 Bacteria 7290551
447 2937880162 2937877337 Bacteria 7246526
448 2958035061 2958034702 Bacteria 6989922
449 2958044092 2958041894 Bacteria 13082850
450 2958044947 2958041894 Bacteria 13082850
451 2958087215 2958084443 Bacteria 7312792
452 2958099465 2958092219 Bacteria 6861151
453 2958122969 2958122699 Bacteria 7280457
454 2958130781 2958130278 Bacteria 6897202
455 2958151264 2958144490 Bacteria 6677056
456 2958180119 2958179912 Bacteria 6874908
457 2961077946 2961077736 Bacteria 7079850
458 2961121179 2961114664 Bacteria 6680456
459 2963645742 2963644680 Bacteria 6530403
460 2965038206 2965032056 Bacteria 6887443
461 2965042416 2965040258 Bacteria 6855979
462 2965092958 2965089291 Bacteria 6866420
463 2968023481 2968016561 Bacteria 7022047
464 2968089251 2968083720 Bacteria 7351627
465 2968117329 2968110612 Bacteria 6814636
466 2970476063 2970469710 Bacteria 6969209
467 2970594083 2970593180 Bacteria 7073582
468 2977844217 2977843712 Bacteria 6753583
469 2977878398 2977872689 Bacteria 7270173
470 2977920607 2977915119 Bacteria 6829656
471 2977929415 2977922695 Bacteria 6956781
472 2977954434 2977950692 Bacteria 6893264
473 2977962664 2977957713 Bacteria 6877875
474 2987672305 2987666974 Bacteria 6509233
475 2989781019 2989776772 Bacteria 4843317
476 2996313643 2996310559 Bacteria 6357320
477 2996354644 2996348954 Bacteria 7239054
478 3004173764 3004167301 Bacteria 8330599
479 3004199838 3004195979 Bacteria 6776956
480 3004218267 3004211236 Bacteria 7417683
481 3004219636 3004218560 Bacteria 7421728
482 3004244010 3004239961 Bacteria 6892290
483 3004281292 3004275668 Bacteria 7114440
484 3004296531 3004289098 Bacteria 6135450
485 3004336780 3004334049 Bacteria 8449246
486 3005599527 3005594810 Bacteria 8716512
487 637076563 637000159 Bacteria 7596297
488 649870979 649633066 Bacteria 6690028
489 8004363248 8004361976 Bacteria 6858373
490 8004388581 8004387939 Bacteria 7049250
491 8004715203 8004714634 Bacteria 6776161
492 8005251482 8005246636 Bacteria 4933972
493 8006931544 8006926726 Bacteria 6749210
494 8056878574 8056875544 Bacteria 4355797
495 8056968316 8056967851 Bacteria 9038162
496 Ga0070665_100044525
497 JGI25157J39369_1000607
498 JGI25165J46597_1010982
499 Ga0055536_1008697
500 Ga0055531_10010943
501 Ga0065165_1001079
502 Ga0065715_10332576
503 Ga0065707_10976104
504 Ga0070676_10189066
505 Ga0070680_101892842
506 Ga0070682_100265024
507 Ga0070661_101051156
508 Ga0070661_101241960
509 Ga0070668_100109367
510 Ga0070668_101147401
511 Ga0070669_100443675
512 Ga0070674_100067936
513 Ga0070673_100057738
514 Ga0070688_100971100
515 Ga0070709_10039284
516 Ga0070709_10929682
517 Ga0070714_100116184
518 Ga0070713_100065308
519 Ga0070710_10004393
520 Ga0070710_10709330
521 Ga0070711_100061640
522 Ga0070711_101048984
523 Ga0070663_100269665
524 Ga0070678_100171840
525 Ga0070678_101062306
526 Ga0070662_100176797
527 Ga0070681_10803729
528 Ga0070706_101099008
529 Ga0070698_100167505
530 Ga0070699_100393142
531 Ga0070697_100501918
532 Ga0068853_100627883
533 Ga0068853_100640756
534 Ga0070665_100179558
535 Ga0070665_100439725
536 Ga0070665_101296214
537 Ga0068855_100722740
538 Ga0070664_100415275
539 Ga0068864_100246608
540 Ga0068866_10254911
541 Ga0068866_11104072
542 Ga0068861_100003138
543 Ga0068862_100116232
544 Ga0081455_10001444
545 Ga0081455_10109089
546 Ga0081540_1031281
547 Ga0070717_10023047
548 Ga0070717_10027566
549 Ga0075365_10027194
550 Ga0075365_10404887
551 Ga0075365_10692577
552 Ga0075364_10001561
553 Ga0075364_10058487
554 Ga0070715_10010105
555 Ga0070716_100615273
556 Ga0070712_100042140
557 Ga0070712_100190266
558 Ga0075362_10253335
559 Ga0075362_10370941
560 Ga0075367_10446640
561 Ga0075369_10080805
562 Ga0075369_10098897
563 Ga0075369_10267050
564 Ga0075366_10003699
565 Ga0075366_10029583
566 Ga0075370_10081241
567 Ga0075428_101096348
568 Ga0075430_100900968
569 Ga0075430_101209867
570 Ga0068865_100225019
571 Ga0068865_100529110
572 Ga0075436_100870595
573 Ga0099825_1054850
574 Ga0099824_1017157
575 Ga0099824_1030101
576 Ga0099822_1027724
577 Ga0099823_1000044
578 Ga0075435_100813002
579 Ga0105240_10179588
580 Ga0105240_10274849
581 Ga0105240_11058932
582 Ga0105245_10121098
583 Ga0105245_11977453
584 Ga0114129_10057579
585 Ga0105242_11667482
586 Ga0105238_10018079
587 Ga0105238_10192033
588 Ga0105249_10103477
589 Ga0099796_10098673
590 Ga0157369_10273116
591 Ga0163162_10006478
592 Ga0157372_12470493
593 Ga0157375_11254625
594 Ga0163163_11357091
595 Ga0157380_10001195
596 Ga0157376_10433729
597 Ga0182007_10143989
598 Ga0163161_10658329
599 Ga0224572_1069766
600 Ga0209026_1000032
601 Ga0209677_100606
602 Ga0209148_1015511
603 Ga0209759_1000142
604 Ga0209455_1003086
605 Ga0209758_1001799
606 Ga0209758_1002861
607 Ga0209050_1005002
608 Ga0207426_1006468
609 Ga0209051_1000574
610 Ga0207692_10069004
611 Ga0207642_10135521
612 Ga0207685_10080400
613 Ga0207699_10575639
614 Ga0207699_10733289
615 Ga0207645_10419972
616 Ga0207684_10042447
617 Ga0207695_10242502
618 Ga0207695_11330279
619 Ga0207693_10051924
620 Ga0207693_10526499
621 Ga0207693_10610179
622 Ga0207663_10061037
623 Ga0207649_10200622
624 Ga0207646_10463531
625 Ga0207694_10095857
626 Ga0207694_10113251
627 Ga0207687_10598011
628 Ga0207644_11624793
629 Ga0207706_10141669
630 Ga0207669_10083636
631 Ga0207704_10097918
632 Ga0207704_10472055
633 Ga0207665_10106869
634 Ga0207665_10437949
635 Ga0207689_11578254
636 Ga0207679_10617909
637 Ga0207667_10593888
638 Ga0207667_11217640
639 Ga0207668_10071586
640 Ga0207668_10838054
641 Ga0207668_11397347
642 Ga0207677_11513274
643 Ga0207639_10058129
644 Ga0207639_10344478
645 Ga0207639_10400023
646 Ga0207702_11192180
647 Ga0207675_100022261
648 Ga0207683_11152110
649 Ga0209389_1000046
650 Ga0209589_1000175
651 Ga0209589_1006990
652 Ga0209489_100112
653 Ga0209489_106620
654 Ga0209700_100029
655 Ga0209700_106374
656 Ga0209813_10490596
657 Ga0268266_10022546
658 Ga0268266_10089214
659 Ga0268266_11090255
660 Ga0268265_10557980
661 Ga0268265_10765288
662 Ga0268264_10000065
663 Ga0265326_10002939
664 Ga0265319_1007567
665 Ga0265334_10019631
666 Ga0265318_10050181
667 Ga0265323_10001443
668 Ga0265336_10000335
669 Ga0307515_10165774
670 Ga0265338_10000321
671 Ga0265338_10006337
672 Ga0265324_10002307
673 Ga0307511_10126278
674 Ga0265325_10005626
675 Ga0265325_10018416
676 Ga0265339_10000531
677 Ga0265339_10001451
678 Ga0265313_10000366
679 Ga0265313_10147947
680 Ga0265342_10211604
681 Ga0307516_10047725
682 Ga0307405_10331586
683 Ga0307405_10743556
684 Ga0307413_10815028
685 Ga0307406_11000789
686 Ga0307407_10307434
687 Ga0307409_101166368
688 Ga0307409_101876427
689 Ga0307409_102223267
690 Ga0307416_102948756
691 Ga0307411_10472328
692 Ga0307411_11555826
693 Ga0307415_101679176
694 Ga0307507_10041543
695 Ga0307510_10310328
696 Ga0373926_0069246
697 Ga0373934_0349458
698 Ga0373924_0145063
699 Ga0373935_1522474
700 Ga0373927_0333579
701 Ga0373933_0274910
702 Ga0373933_0648905
703 Ga0373947_0551546
704 Ga0373947_0630620
705 Ga0373937_0707279
706 Ga0373925_0067783
707 Ga0373925_0161750
708 Ga0395900_0539047
709 Ga0395900_1012552
710 Ga0395898_0070882
711 Ga0395905_0001756
712 Ga0395905_0814151
713 Ga0436364_0076071
714 Ga0436364_1287212
715 Ga0395901_0661123
716 Ga0436365_0620432
717 Ga0436360_1238983
718 Ga0436361_0706289
719 Ga0439453_0019896
720 Ga0439465_0014446
721 Ga0439448_0115528
722 Ga0439456_005515
723 Ga0439435_0098681
724 Ga0439459_0119026
725 Ga0466965_0041130
726 Ga0466965_0136471
727 Ga0466970_0106484
728 Ga0466957_0245737
729 Ga0466959_0083146
730 Ga0466967_1395235
731 Ga0495638_0061977
732 Ga0495628_1020664
733 Ga0495587_0189716
734 Ga0495645_0518104
735 Ga0495622_0205991
736 Ga0495633_0251455
737 Ga0495667_0067893
738 Ga0495588_0336937
739 Ga0495599_0097678
740 Ga0495658_0223068
741 Ga0495658_0464592
742 Ga0495600_0311374
743 Ga0495660_0191680
744 Ga0495680_0149363
745 Ga0495686_0051401
746 Ga0496100_0143978
747 Ga0496106_0001175
748 Ga0496106_1229587
749 Ga0496108_1238282
750 Ga0496110_0263513
751 Ga0496114_0513645
752 Ga0496114_1540480
753 Ga0496115_0196498
754 Ga0496115_0777682
755 Ga0496116_0126740
756 Ga0496117_0025015
757 Ga0496118_0003807
758 Ga0496118_0035920
759 Ga0496119_0036561
760 Ga0496119_0072702
761 Ga0496120_0003403
762 Ga0496120_0021153
763 Ga0496120_0079523
764 Ga0496121_0000001
765 Ga0496121_0000668
766 Ga0496121_0005331
767 Ga0496121_0162567
768 Ga0496121_0560539
769 Ga0496122_0000018
770 Ga0496123_0000015
771 Ga0496124_0000955
772 Ga0496124_0012140
773 Ga0496124_0060512
774 Ga0496125_0000001
775 Ga0496125_0028110
776 Ga0496125_0400041
777 Ga0496126_0036227
778 Ga0496126_0143765
779 Ga0496126_0333471
780 Ga0496126_0621706
781 Ga0501034_0055571
782 Ga0501039_1305191
783 Ga0501041_0440306
784 Ga0501041_0611383
785 Ga0501043_0438924
786 Ga0501068_0628594
787 Ga0501072_0390836
788 Ga0501075_0225892
789 Ga0501077_0330325
790 Ga0501079_0989113
791 Ga0501080_0052344
792 Ga0501035_1126655
793 nmdc:mga03683_26118_c1
794 nmdc:mga03683_68105_c1
795 nmdc:mga03n38_425635_c1
796 nmdc:mga00v17_2823_c1
797 nmdc:mga00v17_6014_c1
798 nmdc:mga0yw44_422490_c1
799 nmdc:mga0yw44_466061_c1
800 nmdc:mga0yw44_52103_c1
801 nmdc:mga0yw44_787467_c1
802 nmdc:mga0k408_3292_c1
803 nmdc:mga04h51_482385_c1
804 nmdc:mga05p37_52468_c1
805 nmdc:mga06r32_457689_c1
806 nmdc:mga08y16_477640_c1
807 nmdc:mga0n895_1031191_c1
808 nmdc:mga0rr50_775327_c1
809 nmdc:mga08x19_749829_c1
810 nmdc:mga0sz30_83347_c1
811 Ga0500635_0007459
812 Ga0495595_0176372
813 Ga0495595_0264870
814 Ga0500643_006454
815 Ga0500643_016590
816 Ga0500566_0033792
817 Ga0500572_000619
818 Ga0500595_103518
819 Ga0500618_001577
820 Ga0500618_030561
821 Ga0500626_016092
822 Ga0500559_0440727
823 Ga0500568_0000483
824 Ga0500573_0004069
825 Ga0500573_0029011
826 Ga0500590_121970
827 Ga0500616_0075609
828 Ga0500624_000277
829 Ga0500627_0185066
830 Ga0500638_031835
831 Ga0500639_134400
832 Ga0500636_0005564
833 Ga0500636_0107524
834 Ga0500636_0304954
835 Ga0500636_0445846
836 Ga0500576_021443
837 Ga0500552_000619
838 Ga0500596_003471
839 2509372537
840 2510839733
841 2512933462
842 2513645531
843 2513873061
844 2514015639
845 2524437644
846 2586002886
847 2588519532
848 2597811826
849 2617347076
850 2643812428
851 2644154680
852 2644300465
853 2644658806
854 2671695519
855 2688596428
856 2694635556
857 2723573519
858 2745079577
859 2756673814
860 2757570555
861 2793062676
862 2805915040
863 2818238578
864 2819243445
865 2824674896
866 2824691321
867 2824699499
868 2838123430
869 2841947797
870 2841949532
871 2841964127
872 2841971961
873 2841974696
874 2841983746
875 2842040104
876 2842046951
877 2842337366
878 2844003007
879 2844319340
880 2847946862
881 2849079034
882 2854918146
883 2856327289
884 2856338615
885 2857373429
886 2869253245
887 2869266432
888 2869279483
889 2869286381
890 2871430350
891 2871453386
892 2871461405
893 2871469793
894 2874130172
895 2874135271
896 2874139526
897 2874146768
898 2874155841
899 2874176732
900 2874627510
901 2874632172
902 2876364284
903 2876377593
904 2876399309
905 2876414170
906 2876764872
907 2878742009
908 2878746546
909 2881368558
910 2881868090
911 2882640279
912 2885307263
913 2885323479
914 2885338140
915 2885386397
916 2885410461
917 2888384392
918 2899805088
919 2903455191
920 2903499736
921 2903525556
922 2903532897
923 2903734281
924 2903751140
925 2904665836
926 2904673170
927 2906308947
928 2906322228
929 2906369064
930 2906376371
931 2906380563
932 2906400238
933 2906605526
934 2917556460
935 2924724794
936 2924768425
937 2924779693
938 2924790766
939 2929138774
940 2937822287
941 2937823974
942 2937880162
943 2958035061
944 2958044092
945 2958044947
946 2958087215
947 2958099465
948 2958122969
949 2958130781
950 2958151264
951 2958180119
952 2961077946
953 2961121179
954 2963645742
955 2965038206
956 2965042416
957 2965092958
958 2968023481
959 2968089251
960 2968117329
961 2970476063
962 2970594083
963 2977844217
964 2977878398
965 2977920607
966 2977929415
967 2977954434
968 2977962664
969 2987672305
970 2989781019
971 2996313643
972 2996354644
973 3004173764
974 3004199838
975 3004218267
976 3004219636
977 3004244010
978 3004281292
979 3004296531
980 3004336780
981 3005599527
982 637076563
983 649870979
984 8004363248
985 8004388581
986 8004715203
987 8005251482
988 8006931544
989 8056878574
990 8056968316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

13

137

0.98

Map