F454699

General Info

Members Datasets Scaffolds Average Seq Length
495 302 990 110

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101148197|Ga0070664_1011481972
Length 117
Sequence MNELIVSLGIGVLTASGVWLLLRPRTFQVAIGLTLLAYAVNLFIFSMGRLRTGAAPVVTAAAADPSAYADPLPQALVLTAIVINFATTALLLVVVLASRGLRGTDHVDGQESTDDSP

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 2516143018 Ensifer sp. BR816 Isolate Nodule
276 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
277 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
278 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
279 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
280 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
281 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
282 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
283 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
284 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
285 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
286 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
287 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
288 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
289 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
290 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
291 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
292 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
293 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
294 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
295 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
296 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
297 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
298 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
299 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
300 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
301 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
302 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.14
Metatranscriptomes 0.2
Isolates 5.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.43
Nodule 3.84
Rhizoplane 5.05
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_101148197 3300005564 Bacteria 732
2 rootL2_10203169 3300003322 Bacteria 1743
3 Ga0065707_10147027 3300005295 Bacteria 1701
4 Ga0070658_10009913 3300005327 Bacteria 7655
5 Ga0070658_10060929 3300005327 Bacteria 3074
6 Ga0070658_10420986 3300005327 Bacteria 1148
7 Ga0070676_10085636 3300005328 Bacteria 1921
8 Ga0070676_10568101 3300005328 Bacteria 814
9 Ga0070683_100008005 3300005329 Bacteria 8969
10 Ga0070690_100010474 3300005330 Bacteria 5398
11 Ga0070670_100530285 3300005331 Bacteria 1049
12 Ga0070670_100777314 3300005331 Bacteria 864
13 Ga0068869_100660960 3300005334 Bacteria 888
14 Ga0068869_100813139 3300005334 Unclassified 804
15 Ga0070666_10025010 3300005335 Bacteria 3891
16 Ga0070680_100014420 3300005336 Bacteria 6177
17 Ga0070680_100082068 3300005336 Bacteria 2660
18 Ga0070680_100150011 3300005336 Bacteria 1957
19 Ga0070680_100184071 3300005336 Bacteria 1760
20 Ga0070682_100010286 3300005337 Bacteria 5308
21 Ga0070682_100067246 3300005337 Bacteria 2282
22 Ga0070682_100095987 3300005337 Bacteria 1948
23 Ga0068868_100530189 3300005338 Bacteria 1035
24 Ga0068868_101830663 3300005338 Bacteria 574
25 Ga0070660_100019751 3300005339 Bacteria 4942
26 Ga0070660_100069718 3300005339 Bacteria 2742
27 Ga0070660_100302192 3300005339 Bacteria 1312
28 Ga0070689_100284651 3300005340 Bacteria 1372
29 Ga0070691_10020419 3300005341 Bacteria 3061
30 Ga0070691_10339626 3300005341 Bacteria 831
31 Ga0070687_100016154 3300005343 Bacteria 3396
32 Ga0070687_100204002 3300005343 Bacteria 1200
33 Ga0070661_100006965 3300005344 Bacteria 7801
34 Ga0070661_100087159 3300005344 Bacteria 2309
35 Ga0070661_100199711 3300005344 Bacteria 1527
36 Ga0070661_100643809 3300005344 Bacteria 860
37 Ga0070692_10007879 3300005345 Bacteria 4722
38 Ga0070692_10170060 3300005345 Bacteria 1256
39 Ga0070692_10187435 3300005345 Bacteria 1203
40 Ga0070692_11031448 3300005345 Bacteria 577
41 Ga0070668_100119736 3300005347 Bacteria 2103
42 Ga0070669_100007367 3300005353 Bacteria 7889
43 Ga0070669_100021059 3300005353 Bacteria 4658
44 Ga0070675_100010896 3300005354 Bacteria 7112
45 Ga0070675_100536351 3300005354 Bacteria 1057
46 Ga0070671_100215278 3300005355 Bacteria 1630
47 Ga0070674_100835352 3300005356 Bacteria 798
48 Ga0070674_102134359 3300005356 Bacteria 511
49 Ga0070673_100050649 3300005364 Bacteria 3248
50 Ga0070673_101226158 3300005364 Bacteria 703
51 Ga0070688_100024071 3300005365 Bacteria 3587
52 Ga0070659_100000693 3300005366 Bacteria 24520
53 Ga0070659_101242215 3300005366 Bacteria 660
54 Ga0070667_100130344 3300005367 Bacteria 2194
55 Ga0070667_101025107 3300005367 Bacteria 770
56 Ga0070667_101957469 3300005367 Bacteria 552
57 Ga0070703_10178768 3300005406 Bacteria 818
58 Ga0070714_100020726 3300005435 Bacteria 5373
59 Ga0070713_101499363 3300005436 Bacteria 654
60 Ga0070711_100130172 3300005439 Bacteria 1873
61 Ga0070700_100001753 3300005441 Bacteria 10904
62 Ga0070700_100588129 3300005441 Bacteria 870
63 Ga0070694_100402188 3300005444 Bacteria 1072
64 Ga0070694_101028356 3300005444 Bacteria 685
65 Ga0070663_100011149 3300005455 Bacteria 5628
66 Ga0070663_100012452 3300005455 Bacteria 5382
67 Ga0070663_100056190 3300005455 Bacteria 2819
68 Ga0070678_100227662 3300005456 Bacteria 1553
69 Ga0070678_100868910 3300005456 Bacteria 823
70 Ga0070662_100184692 3300005457 Bacteria 1646
71 Ga0070662_100265886 3300005457 Bacteria 1383
72 Ga0070662_101358624 3300005457 Bacteria 612
73 Ga0070681_10006828 3300005458 Bacteria 11113
74 Ga0070681_10017527 3300005458 Bacteria 7158
75 Ga0070681_10241619 3300005458 Bacteria 1719
76 Ga0068867_100001755 3300005459 Bacteria 15105
77 Ga0068867_100808459 3300005459 Bacteria 837
78 Ga0068867_100844762 3300005459 Unclassified 820
79 Ga0070685_10334377 3300005466 Bacteria 1031
80 Ga0070679_100028734 3300005530 Bacteria 5485
81 Ga0070679_100075251 3300005530 Bacteria 3366
82 Ga0070679_100449638 3300005530 Bacteria 1233
83 Ga0070684_100188684 3300005535 Bacteria 1875
84 Ga0068853_100003131 3300005539 Bacteria 12646
85 Ga0068853_100118457 3300005539 Bacteria 2360
86 Ga0068853_100642387 3300005539 Bacteria 1010
87 Ga0070672_100018691 3300005543 Bacteria 5017
88 Ga0070686_100596766 3300005544 Bacteria 870
89 Ga0070686_101378760 3300005544 Bacteria 591
90 Ga0070695_100332525 3300005545 Bacteria 1133
91 Ga0070695_100583481 3300005545 Bacteria 875
92 Ga0070696_100098675 3300005546 Bacteria 2090
93 Ga0070693_100030007 3300005547 Bacteria 2969
94 Ga0070665_100063019 3300005548 Bacteria 3718
95 Ga0070665_101161726 3300005548 Bacteria 783
96 Ga0070704_100642975 3300005549 Bacteria 936
97 Ga0068855_100063785 3300005563 Bacteria 4298
98 Ga0068855_100074798 3300005563 Bacteria 3934
99 Ga0068855_100444615 3300005563 Bacteria 1415
100 Ga0070664_100005054 3300005564 Bacteria 10577
101 Ga0070664_100014100 3300005564 Bacteria 6519
102 Ga0070664_100218943 3300005564 Bacteria 1703
103 Ga0070664_100996115 3300005564 Bacteria 788
104 Ga0070664_101742698 3300005564 Bacteria 591
105 Ga0068857_100015019 3300005577 Bacteria 6756
106 Ga0068857_100747171 3300005577 Bacteria 932
107 Ga0068854_100029205 3300005578 Bacteria 3816
108 Ga0068856_100197532 3300005614 Bacteria 2026
109 Ga0068856_100502063 3300005614 Bacteria 1234
110 Ga0068856_101443519 3300005614 Bacteria 702
111 Ga0070702_100489888 3300005615 Bacteria 900
112 Ga0068852_100320082 3300005616 Bacteria 1506
113 Ga0068852_100363817 3300005616 Bacteria 1415
114 Ga0068852_100375379 3300005616 Bacteria 1394
115 Ga0068859_100210991 3300005617 Bacteria 2028
116 Ga0068859_100351101 3300005617 Bacteria 1570
117 Ga0068859_102804066 3300005617 Bacteria 535
118 Ga0068864_101074540 3300005618 Bacteria 800
119 Ga0068866_10152414 3300005718 Bacteria 1340
120 Ga0068861_100001610 3300005719 Bacteria 14384
121 Ga0068861_100014724 3300005719 Bacteria 5494
122 Ga0068861_100299708 3300005719 Bacteria 1392
123 Ga0068861_100536626 3300005719 Bacteria 1064
124 Ga0068851_10002036 3300005834 Bacteria 8920
125 Ga0068851_10216247 3300005834 Bacteria 1075
126 Ga0068851_10270964 3300005834 Bacteria 968
127 Ga0068870_10012679 3300005840 Bacteria 3945
128 Ga0068870_10284481 3300005840 Bacteria 1038
129 Ga0068870_10995457 3300005840 Unclassified 597
130 Ga0068863_100485776 3300005841 Bacteria 1215
131 Ga0068858_101869927 3300005842 Bacteria 593
132 Ga0068860_100060858 3300005843 Bacteria 3588
133 Ga0068860_100281638 3300005843 Bacteria 1625
134 Ga0068862_100005068 3300005844 Bacteria 11085
135 Ga0068862_100487484 3300005844 Bacteria 1168
136 Ga0068862_100974044 3300005844 Bacteria 837
137 Ga0068862_102458499 3300005844 Bacteria 533
138 Ga0075365_10022211 3300006038 Bacteria 3972
139 Ga0075364_10815369 3300006051 Bacteria 636
140 Ga0075362_10098821 3300006177 Bacteria 1362
141 Ga0075367_10008005 3300006178 Bacteria 5449
142 Ga0075367_10015269 3300006178 Bacteria 4169
143 Ga0075366_10019210 3300006195 Bacteria 3951
144 Ga0075366_10351781 3300006195 Bacteria 904
145 Ga0097621_100423485 3300006237 Bacteria 1195
146 Ga0097621_101561744 3300006237 Bacteria 627
147 Ga0075370_10137065 3300006353 Bacteria 1430
148 Ga0075370_10260130 3300006353 Bacteria 1029
149 Ga0068871_100549003 3300006358 Bacteria 1046
150 Ga0068871_102419998 3300006358 Bacteria 501
151 Ga0075428_101436415 3300006844 Bacteria 723
152 Ga0075431_100811435 3300006847 Bacteria 908
153 Ga0075434_100547899 3300006871 Bacteria 1176
154 Ga0075429_100126670 3300006880 Bacteria 2233
155 Ga0068865_100004826 3300006881 Bacteria 8148
156 Ga0068865_100316804 3300006881 Bacteria 1253
157 Ga0068865_102048635 3300006881 Bacteria 520
158 Ga0097620_100210985 3300006931 Bacteria 2028
159 Ga0097620_100351121 3300006931 Bacteria 1570
160 Ga0097620_102804085 3300006931 Bacteria 535
161 Ga0105240_10154816 3300009093 Bacteria 2727
162 Ga0111539_10435108 3300009094 Bacteria 1527
163 Ga0105245_10284401 3300009098 Bacteria 1618
164 Ga0114129_11497195 3300009147 Bacteria 829
165 Ga0105243_10003862 3300009148 Bacteria 11970
166 Ga0105241_10003941 3300009174 Bacteria 10983
167 Ga0105241_10004527 3300009174 Bacteria 10281
168 Ga0105241_11631367 3300009174 Bacteria 625
169 Ga0105242_10581301 3300009176 Unclassified 1079
170 Ga0105242_12476425 3300009176 Bacteria 567
171 Ga0105248_10002755 3300009177 Bacteria 19524
172 Ga0105248_11869018 3300009177 Bacteria 681
173 Ga0105237_10026508 3300009545 Bacteria 5924
174 Ga0105237_10617846 3300009545 Bacteria 1091
175 Ga0105238_10113821 3300009551 Bacteria 2685
176 Ga0105249_10008393 3300009553 Bacteria 8998
177 Ga0105249_10918461 3300009553 Bacteria 943
178 Ga0105239_11818878 3300010375 Unclassified 706
179 Ga0157325_1014661 3300012485 Bacteria 632
180 Ga0157373_10003131 3300013100 Bacteria 12498
181 Ga0157373_10832597 3300013100 Unclassified 682
182 Ga0157371_10032993 3300013102 Bacteria 3722
183 Ga0157371_11297227 3300013102 Bacteria 563
184 Ga0157370_10468512 3300013104 Bacteria 1158
185 Ga0157370_10824077 3300013104 Bacteria 844
186 Ga0157369_12146314 3300013105 Bacteria 566
187 Ga0157374_10872402 3300013296 Bacteria 917
188 Ga0157378_10415706 3300013297 Bacteria 1328
189 Ga0157378_11413854 3300013297 Bacteria 739
190 Ga0157378_11553815 3300013297 Bacteria 707
191 Ga0157378_11917807 3300013297 Bacteria 642
192 Ga0157372_10296762 3300013307 Bacteria 1880
193 Ga0157372_10516559 3300013307 Bacteria 1392
194 Ga0157372_11805883 3300013307 Bacteria 703
195 Ga0157375_10336122 3300013308 Bacteria 1676
196 Ga0157375_11049202 3300013308 Bacteria 953
197 Ga0157380_10004661 3300014326 Bacteria 9541
198 Ga0157380_10059377 3300014326 Bacteria 3052
199 Ga0157380_11415837 3300014326 Bacteria 746
200 Ga0157377_10113500 3300014745 Bacteria 1632
201 Ga0157379_10035523 3300014968 Bacteria 4444
202 Ga0157379_10143491 3300014968 Bacteria 2153
203 Ga0157379_10413666 3300014968 Bacteria 1241
204 Ga0157376_10387064 3300014969 Bacteria 1349
205 Ga0157376_10918724 3300014969 Bacteria 894
206 Ga0157376_12927572 3300014969 Bacteria 517
207 Ga0163161_10469657 3300017792 Bacteria 1020
208 Ga0206356_10640862 3300020070 Bacteria 1226
209 Ga0207656_10020950 3300025321 Bacteria 2605
210 Ga0207682_10047333 3300025893 Bacteria 1770
211 Ga0207642_10018896 3300025899 Bacteria 2656
212 Ga0207688_10764732 3300025901 Bacteria 612
213 Ga0207680_10022011 3300025903 Bacteria 3461
214 Ga0207680_10454008 3300025903 Bacteria 910
215 Ga0207647_10116267 3300025904 Bacteria 1579
216 Ga0207645_10338398 3300025907 Bacteria 1006
217 Ga0207645_10503230 3300025907 Bacteria 820
218 Ga0207645_10989280 3300025907 Unclassified 570
219 Ga0207643_10063349 3300025908 Bacteria 2114
220 Ga0207643_10304098 3300025908 Unclassified 993
221 Ga0207643_10510622 3300025908 Bacteria 769
222 Ga0207705_10018450 3300025909 Bacteria 4989
223 Ga0207654_10048136 3300025911 Bacteria 2439
224 Ga0207654_10297623 3300025911 Bacteria 1096
225 Ga0207707_10000582 3300025912 Bacteria 37091
226 Ga0207707_10106258 3300025912 Bacteria 2454
227 Ga0207707_10212866 3300025912 Bacteria 1683
228 Ga0207695_10129333 3300025913 Bacteria 2484
229 Ga0207695_10713543 3300025913 Bacteria 883
230 Ga0207671_10058206 3300025914 Bacteria 2865
231 Ga0207671_10274369 3300025914 Bacteria 1329
232 Ga0207663_10219548 3300025916 Bacteria 1382
233 Ga0207660_10012873 3300025917 Bacteria 5477
234 Ga0207660_10033504 3300025917 Bacteria 3554
235 Ga0207660_10070599 3300025917 Bacteria 2539
236 Ga0207660_10122834 3300025917 Bacteria 1968
237 Ga0207660_10730628 3300025917 Bacteria 808
238 Ga0207662_10027658 3300025918 Bacteria 3274
239 Ga0207657_10000302 3300025919 Bacteria 52284
240 Ga0207657_10902777 3300025919 Unclassified 681
241 Ga0207649_10057670 3300025920 Bacteria 2429
242 Ga0207652_10004959 3300025921 Bacteria 10782
243 Ga0207652_10010922 3300025921 Bacteria 7320
244 Ga0207652_10424002 3300025921 Bacteria 1200
245 Ga0207681_10002070 3300025923 Bacteria 12847
246 Ga0207681_10043653 3300025923 Bacteria 3002
247 Ga0207694_10027148 3300025924 Bacteria 4360
248 Ga0207650_10291983 3300025925 Bacteria 1330
249 Ga0207650_10467897 3300025925 Bacteria 1051
250 Ga0207650_10513320 3300025925 Bacteria 1002
251 Ga0207659_10014621 3300025926 Bacteria 5067
252 Ga0207659_11483765 3300025926 Bacteria 580
253 Ga0207700_11575107 3300025928 Bacteria 582
254 Ga0207664_10272430 3300025929 Bacteria 1483
255 Ga0207664_11522102 3300025929 Bacteria 591
256 Ga0207644_10007077 3300025931 Bacteria 7312
257 Ga0207690_10071890 3300025932 Bacteria 2387
258 Ga0207706_10040247 3300025933 Bacteria 4142
259 Ga0207706_10178192 3300025933 Bacteria 1867
260 Ga0207706_10425564 3300025933 Bacteria 1150
261 Ga0207686_11000011 3300025934 Unclassified 679
262 Ga0207709_10002476 3300025935 Bacteria 11575
263 Ga0207709_10051400 3300025935 Bacteria 2526
264 Ga0207670_10436218 3300025936 Bacteria 1054
265 Ga0207669_10220223 3300025937 Bacteria 1392
266 Ga0207669_11738430 3300025937 Bacteria 533
267 Ga0207704_10021013 3300025938 Bacteria 3467
268 Ga0207691_10030728 3300025940 Bacteria 5017
269 Ga0207691_11501650 3300025940 Bacteria 551
270 Ga0207711_10029358 3300025941 Bacteria 4638
271 Ga0207689_10168247 3300025942 Bacteria 1806
272 Ga0207689_10728454 3300025942 Bacteria 837
273 Ga0207661_10077775 3300025944 Bacteria 2730
274 Ga0207679_10350683 3300025945 Bacteria 1286
275 Ga0207679_10369263 3300025945 Bacteria 1255
276 Ga0207679_10535105 3300025945 Bacteria 1049
277 Ga0207679_11275729 3300025945 Bacteria 674
278 Ga0207667_10001606 3300025949 Bacteria 28419
279 Ga0207667_10107421 3300025949 Bacteria 2879
280 Ga0207667_10328663 3300025949 Bacteria 1561
281 Ga0207651_10050020 3300025960 Bacteria 2836
282 Ga0207651_10110517 3300025960 Bacteria 2062
283 Ga0207651_11069904 3300025960 Bacteria 722
284 Ga0207712_10002513 3300025961 Bacteria 11800
285 Ga0207668_10003072 3300025972 Bacteria 9786
286 Ga0207668_10460664 3300025972 Bacteria 1087
287 Ga0207668_10614727 3300025972 Bacteria 948
288 Ga0207640_10067218 3300025981 Bacteria 2397
289 Ga0207640_10227542 3300025981 Bacteria 1432
290 Ga0207640_10397591 3300025981 Bacteria 1121
291 Ga0207658_10067166 3300025986 Bacteria 2700
292 Ga0207658_10227874 3300025986 Bacteria 1571
293 Ga0207658_11841423 3300025986 Bacteria 552
294 Ga0207677_10328649 3300026023 Bacteria 1273
295 Ga0207677_10491837 3300026023 Bacteria 1059
296 Ga0207677_10621355 3300026023 Bacteria 950
297 Ga0207703_10075600 3300026035 Bacteria 2792
298 Ga0207703_10159169 3300026035 Bacteria 1976
299 Ga0207703_11113226 3300026035 Bacteria 759
300 Ga0207703_11738390 3300026035 Bacteria 600
301 Ga0207639_10012400 3300026041 Bacteria 5934
302 Ga0207639_10132595 3300026041 Bacteria 2065
303 Ga0207678_10004254 3300026067 Bacteria 12835
304 Ga0207678_10011384 3300026067 Bacteria 7807
305 Ga0207678_10604975 3300026067 Bacteria 961
306 Ga0207678_10643860 3300026067 Bacteria 931
307 Ga0207678_10839966 3300026067 Bacteria 811
308 Ga0207708_10006309 3300026075 Bacteria 8789
309 Ga0207702_10007075 3300026078 Bacteria 9597
310 Ga0207702_10516996 3300026078 Bacteria 1165
311 Ga0207702_11250876 3300026078 Unclassified 736
312 Ga0207641_10563807 3300026088 Bacteria 1112
313 Ga0207641_11489800 3300026088 Bacteria 678
314 Ga0207648_10011201 3300026089 Bacteria 8455
315 Ga0207648_10653440 3300026089 Bacteria 972
316 Ga0207676_11475829 3300026095 Bacteria 677
317 Ga0207674_10000251 3300026116 Bacteria 66996
318 Ga0207674_10314059 3300026116 Bacteria 1516
319 Ga0207674_10599495 3300026116 Bacteria 1064
320 Ga0207675_100010339 3300026118 Bacteria 8745
321 Ga0207675_100469195 3300026118 Bacteria 1249
322 Ga0207675_101349580 3300026118 Bacteria 734
323 Ga0207683_10434885 3300026121 Bacteria 1209
324 Ga0207683_10656541 3300026121 Bacteria 972
325 Ga0207698_10068386 3300026142 Bacteria 2804
326 Ga0207698_10195119 3300026142 Bacteria 1808
327 Ga0207698_10209742 3300026142 Bacteria 1752
328 Ga0209971_1039403 3300027682 Bacteria 1138
329 Ga0209966_1010430 3300027695 Bacteria 1675
330 Ga0209998_10085910 3300027717 Bacteria 767
331 Ga0268266_10052746 3300028379 Bacteria 3493
332 Ga0268266_10481806 3300028379 Bacteria 1183
333 Ga0268266_10507812 3300028379 Bacteria 1152
334 Ga0268265_10000291 3300028380 Bacteria 56604
335 Ga0268265_10522708 3300028380 Bacteria 1122
336 Ga0268265_10689427 3300028380 Bacteria 986
337 Ga0268264_10005401 3300028381 Bacteria 10823
338 Ga0268264_10388337 3300028381 Bacteria 1338
339 Ga0268264_10529826 3300028381 Bacteria 1153
340 Ga0307408_101212266 3300031548 Bacteria 704
341 Ga0307405_11879462 3300031731 Bacteria 534
342 Ga0307407_10560613 3300031903 Bacteria 846
343 Ga0307409_101561740 3300031995 Bacteria 688
344 Ga0307416_100012292 3300032002 Bacteria 5760
345 Ga0307416_100844311 3300032002 Bacteria 1014
346 Ga0307416_102718420 3300032002 Bacteria 591
347 Ga0307416_103179502 3300032002 Bacteria 549
348 Ga0307411_10763327 3300032005 Bacteria 848
349 Ga0307415_100023641 3300032126 Bacteria 3820
350 Ga0373930_0008971 3300034816 Bacteria 1760
351 Ga0373948_0023623 3300034817 Bacteria 1194
352 Ga0373928_0005437 3300035084 Bacteria 2436
353 Ga0373929_0004743 3300035085 Bacteria 2437
354 Ga0373934_0249697 3300035086 Bacteria 733
355 Ga0373940_0004866 3300035088 Bacteria 2867
356 Ga0373949_0008294 3300035090 Bacteria 2275
357 Ga0373951_0032877 3300035091 Bacteria 1228
358 Ga0373932_0001687 3300035112 Bacteria 6016
359 Ga0373939_0000922 3300035114 Bacteria 7298
360 Ga0373941_0000933 3300035115 Bacteria 6034
361 Ga0373953_0043175 3300035117 Bacteria 1799
362 Ga0373954_0027058 3300035118 Bacteria 2630
363 Ga0373956_0114304 3300035119 Bacteria 1258
364 Ga0373955_0180276 3300035172 Bacteria 1253
365 Ga0373962_0003112 3300035242 Bacteria 3974
366 Ga0373931_0000344 3300035691 Bacteria 19127
367 Ga0373933_0068256 3300035724 Bacteria 2159
368 Ga0373937_0009190 3300036401 Bacteria 8580
369 Ga0373925_0192333 3300037068 Bacteria 1619
370 Ga0395899_0102890 3300037312 Bacteria 2060
371 Ga0395900_0008836 3300037418 Bacteria 10348
372 Ga0395900_0148643 3300037418 Bacteria 2395
373 Ga0395900_0384718 3300037418 Bacteria 1370
374 Ga0395898_0020070 3300037466 Bacteria 6791
375 Ga0395898_0412455 3300037466 Bacteria 1287
376 Ga0395905_0399306 3300037471 Bacteria 1270
377 Ga0395901_0013535 3300038443 Bacteria 8296
378 Ga0451800_0017687 3300041459 Bacteria 610
379 Ga0451833_0590600 3300041491 Bacteria 658
380 Ga0451853_0476034 3300041512 Bacteria 556
381 Ga0451853_2948516 3300041512 Bacteria 591
382 Ga0439449_0057240 3300042007 Bacteria 1439
383 Ga0450921_005103 3300042123 Bacteria 983
384 Ga0451577_0198323 3300042876 Bacteria 1812
385 Ga0466963_0147916 3300044694 Bacteria 1631
386 Ga0466964_0523096 3300044706 Bacteria 640
387 Ga0466957_0521857 3300044842 Bacteria 825
388 Ga0451576_0027587 3300045051 Bacteria 6096
389 Ga0466958_0370109 3300045836 Bacteria 923
390 Ga0495592_0020432 3300046454 Bacteria 5036
391 Ga0495651_0006031 3300046462 Bacteria 9252
392 Ga0495653_0176848 3300046463 Bacteria 1468
393 Ga0495608_0119649 3300046511 Bacteria 1689
394 Ga0495628_0079641 3300046516 Bacteria 2547
395 Ga0495652_0008742 3300046529 Bacteria 9219
396 Ga0495640_0277998 3300046533 Bacteria 1043
397 Ga0495587_0002777 3300046536 Bacteria 11689
398 Ga0495667_0029932 3300046559 Bacteria 3662
399 Ga0495635_1059976 3300046663 Bacteria 514
400 Ga0495657_0035784 3300046675 Bacteria 3438
401 Ga0495599_0005909 3300046678 Bacteria 7356
402 Ga0495623_0007781 3300046679 Bacteria 6966
403 Ga0495646_0148824 3300046680 Bacteria 1304
404 Ga0495604_0008315 3300047317 Bacteria 8206
405 Ga0495680_0093764 3300047322 Bacteria 2247
406 Ga0495675_0015410 3300047444 Bacteria 4835
407 Ga0495602_0034886 3300048088 Bacteria 4697
408 Ga0496100_0169290 3300048903 Bacteria 1572
409 Ga0496100_0952945 3300048903 Bacteria 675
410 Ga0496102_0112568 3300048905 Bacteria 2539
411 Ga0496102_0501069 3300048905 Bacteria 1136
412 Ga0496102_0520546 3300048905 Bacteria 1112
413 Ga0496102_1750836 3300048905 Bacteria 539
414 Ga0496103_0003025 3300048906 Bacteria 10357
415 Ga0496103_0540004 3300048906 Bacteria 745
416 Ga0496104_0735200 3300048907 Unclassified 894
417 Ga0496106_0015222 3300048909 Bacteria 5692
418 Ga0496106_0090086 3300048909 Bacteria 2367
419 Ga0496106_0431642 3300048909 Bacteria 1059
420 Ga0496106_1389997 3300048909 Bacteria 543
421 Ga0496107_0021433 3300048910 Bacteria 4567
422 Ga0496108_0135605 3300048911 Bacteria 2118
423 Ga0496108_0589047 3300048911 Bacteria 969
424 Ga0496108_1545724 3300048911 Bacteria 551
425 Ga0496109_0746266 3300048912 Bacteria 917
426 Ga0496109_0947074 3300048912 Bacteria 799
427 Ga0496111_0547043 3300048914 Bacteria 850
428 Ga0496112_0884234 3300048915 Bacteria 816
429 Ga0496112_0943992 3300048915 Bacteria 784
430 Ga0496114_0248261 3300048917 Bacteria 1566
431 Ga0496115_0039507 3300048918 Bacteria 3748
432 Ga0501036_0201429 3300049572 Bacteria 1674
433 Ga0501036_1014269 3300049572 Bacteria 679
434 Ga0501040_0068260 3300049576 Bacteria 2452
435 Ga0501043_0389105 3300049579 Bacteria 1055
436 Ga0501047_0025007 3300049581 Bacteria 5736
437 Ga0501047_0859495 3300049581 Bacteria 721
438 Ga0501048_0308681 3300049582 Bacteria 1126
439 Ga0501071_0525392 3300049587 Bacteria 908
440 Ga0501072_0243866 3300049588 Bacteria 1431
441 Ga0501074_0654559 3300049590 Bacteria 742
442 Ga0501075_0013470 3300049591 Bacteria 5836
443 Ga0501076_0021916 3300049592 Bacteria 4906
444 Ga0501236_112788 3300049670 Bacteria 545
445 Ga0501081_0134753 3300049743 Bacteria 1767
446 Ga0501083_0729326 3300049744 Bacteria 645
447 Ga0501283_053057 3300049779 Bacteria 721
448 Ga0501044_0168518 3300049823 Bacteria 2163
449 Ga0501045_0032604 3300049824 Bacteria 3776
450 nmdc:mga03n38_806249_c1 3300050490 Bacteria 547
451 nmdc:mga00v17_818084_c1 3300050491 Bacteria 593
452 nmdc:mga0yw44_301242_c1 3300050492 Bacteria 1074
453 nmdc:mga0k408_42546_c1 3300050493 Bacteria 2616
454 nmdc:mga06z11_146038_c1 3300050494 Bacteria 1341
455 nmdc:mga06z11_70385_c1 3300050494 Bacteria 1849
456 nmdc:mga07m45_554088_c1 3300050496 Bacteria 665
457 nmdc:mga05p37_1219095_c1 3300050507 Bacteria 775
458 nmdc:mga0qj67_151587_c1 3300050509 Bacteria 1881
459 nmdc:mga0qj67_49109_c1 3300050509 Bacteria 3335
460 nmdc:mga06r32_326437_c1 3300050510 Bacteria 1520
461 nmdc:mga08y16_1470445_c1 3300050511 Bacteria 643
462 nmdc:mga08y16_301535_c1 3300050511 Bacteria 1651
463 nmdc:mga0n895_2102802_c1 3300050512 Bacteria 521
464 nmdc:mga0sz30_143305_c1 3300050516 Bacteria 1055
465 Ga0495601_0084264 3300053077 Bacteria 2042
466 Ga0495619_0089480 3300053085 Bacteria 2083
467 Ga0501082_0502572 3300060353 Bacteria 1060
468 2516205324 2516143018 Bacteria 6951533
469 2644085821 2643221614 Bacteria 4260023
470 2644345003 2643221661 Bacteria 4267604
471 2644369277 2643221666 Bacteria 4265935
472 2692314428 2690316117 Bacteria 6800650
473 2738745994 2738541281 Bacteria 5112672
474 2739355224 2738543032 Bacteria 5115625
475 2753461013 2751185821 Bacteria 6189929
476 2792624350 2791355091 Bacteria 6135441
477 2792625648 2791355092 Bacteria 6248105
478 2792643724 2791355094 Bacteria 7011481
479 2844004671 2844002411 Bacteria 7168230
480 2847420520 2847417321 Bacteria 6913799
481 2848995392 2848992105 Bacteria 6810864
482 2855878353 2855872281 Bacteria 6964271
483 2856336014 2856334872 Bacteria 7037011
484 2857369078 2857367948 Bacteria 6965560
485 2878782261 2878781027 Bacteria 6834456
486 2922152015 2922151315 Bacteria 6902399
487 2958129316 2958122699 Bacteria 7280457
488 2965038820 2965032056 Bacteria 6887443
489 2965112047 2965110997 Bacteria 6693150
490 2977878477 2977872689 Bacteria 7270173
491 2977959125 2977957713 Bacteria 6877875
492 2987675752 2987673487 Bacteria 6884027
493 3004244547 3004239961 Bacteria 6892290
494 643827158 643692032 Bacteria 6891900
495 8004695776 8004695233 Bacteria 6731676
496 Ga0070664_101148197
497 rootL2_10203169
498 Ga0065707_10147027
499 Ga0070658_10009913
500 Ga0070658_10060929
501 Ga0070658_10420986
502 Ga0070676_10085636
503 Ga0070676_10568101
504 Ga0070683_100008005
505 Ga0070690_100010474
506 Ga0070670_100530285
507 Ga0070670_100777314
508 Ga0068869_100660960
509 Ga0068869_100813139
510 Ga0070666_10025010
511 Ga0070680_100014420
512 Ga0070680_100082068
513 Ga0070680_100150011
514 Ga0070680_100184071
515 Ga0070682_100010286
516 Ga0070682_100067246
517 Ga0070682_100095987
518 Ga0068868_100530189
519 Ga0068868_101830663
520 Ga0070660_100019751
521 Ga0070660_100069718
522 Ga0070660_100302192
523 Ga0070689_100284651
524 Ga0070691_10020419
525 Ga0070691_10339626
526 Ga0070687_100016154
527 Ga0070687_100204002
528 Ga0070661_100006965
529 Ga0070661_100087159
530 Ga0070661_100199711
531 Ga0070661_100643809
532 Ga0070692_10007879
533 Ga0070692_10170060
534 Ga0070692_10187435
535 Ga0070692_11031448
536 Ga0070668_100119736
537 Ga0070669_100007367
538 Ga0070669_100021059
539 Ga0070675_100010896
540 Ga0070675_100536351
541 Ga0070671_100215278
542 Ga0070674_100835352
543 Ga0070674_102134359
544 Ga0070673_100050649
545 Ga0070673_101226158
546 Ga0070688_100024071
547 Ga0070659_100000693
548 Ga0070659_101242215
549 Ga0070667_100130344
550 Ga0070667_101025107
551 Ga0070667_101957469
552 Ga0070703_10178768
553 Ga0070714_100020726
554 Ga0070713_101499363
555 Ga0070711_100130172
556 Ga0070700_100001753
557 Ga0070700_100588129
558 Ga0070694_100402188
559 Ga0070694_101028356
560 Ga0070663_100011149
561 Ga0070663_100012452
562 Ga0070663_100056190
563 Ga0070678_100227662
564 Ga0070678_100868910
565 Ga0070662_100184692
566 Ga0070662_100265886
567 Ga0070662_101358624
568 Ga0070681_10006828
569 Ga0070681_10017527
570 Ga0070681_10241619
571 Ga0068867_100001755
572 Ga0068867_100808459
573 Ga0068867_100844762
574 Ga0070685_10334377
575 Ga0070679_100028734
576 Ga0070679_100075251
577 Ga0070679_100449638
578 Ga0070684_100188684
579 Ga0068853_100003131
580 Ga0068853_100118457
581 Ga0068853_100642387
582 Ga0070672_100018691
583 Ga0070686_100596766
584 Ga0070686_101378760
585 Ga0070695_100332525
586 Ga0070695_100583481
587 Ga0070696_100098675
588 Ga0070693_100030007
589 Ga0070665_100063019
590 Ga0070665_101161726
591 Ga0070704_100642975
592 Ga0068855_100063785
593 Ga0068855_100074798
594 Ga0068855_100444615
595 Ga0070664_100005054
596 Ga0070664_100014100
597 Ga0070664_100218943
598 Ga0070664_100996115
599 Ga0070664_101742698
600 Ga0068857_100015019
601 Ga0068857_100747171
602 Ga0068854_100029205
603 Ga0068856_100197532
604 Ga0068856_100502063
605 Ga0068856_101443519
606 Ga0070702_100489888
607 Ga0068852_100320082
608 Ga0068852_100363817
609 Ga0068852_100375379
610 Ga0068859_100210991
611 Ga0068859_100351101
612 Ga0068859_102804066
613 Ga0068864_101074540
614 Ga0068866_10152414
615 Ga0068861_100001610
616 Ga0068861_100014724
617 Ga0068861_100299708
618 Ga0068861_100536626
619 Ga0068851_10002036
620 Ga0068851_10216247
621 Ga0068851_10270964
622 Ga0068870_10012679
623 Ga0068870_10284481
624 Ga0068870_10995457
625 Ga0068863_100485776
626 Ga0068858_101869927
627 Ga0068860_100060858
628 Ga0068860_100281638
629 Ga0068862_100005068
630 Ga0068862_100487484
631 Ga0068862_100974044
632 Ga0068862_102458499
633 Ga0075365_10022211
634 Ga0075364_10815369
635 Ga0075362_10098821
636 Ga0075367_10008005
637 Ga0075367_10015269
638 Ga0075366_10019210
639 Ga0075366_10351781
640 Ga0097621_100423485
641 Ga0097621_101561744
642 Ga0075370_10137065
643 Ga0075370_10260130
644 Ga0068871_100549003
645 Ga0068871_102419998
646 Ga0075428_101436415
647 Ga0075431_100811435
648 Ga0075434_100547899
649 Ga0075429_100126670
650 Ga0068865_100004826
651 Ga0068865_100316804
652 Ga0068865_102048635
653 Ga0097620_100210985
654 Ga0097620_100351121
655 Ga0097620_102804085
656 Ga0105240_10154816
657 Ga0111539_10435108
658 Ga0105245_10284401
659 Ga0114129_11497195
660 Ga0105243_10003862
661 Ga0105241_10003941
662 Ga0105241_10004527
663 Ga0105241_11631367
664 Ga0105242_10581301
665 Ga0105242_12476425
666 Ga0105248_10002755
667 Ga0105248_11869018
668 Ga0105237_10026508
669 Ga0105237_10617846
670 Ga0105238_10113821
671 Ga0105249_10008393
672 Ga0105249_10918461
673 Ga0105239_11818878
674 Ga0157325_1014661
675 Ga0157373_10003131
676 Ga0157373_10832597
677 Ga0157371_10032993
678 Ga0157371_11297227
679 Ga0157370_10468512
680 Ga0157370_10824077
681 Ga0157369_12146314
682 Ga0157374_10872402
683 Ga0157378_10415706
684 Ga0157378_11413854
685 Ga0157378_11553815
686 Ga0157378_11917807
687 Ga0157372_10296762
688 Ga0157372_10516559
689 Ga0157372_11805883
690 Ga0157375_10336122
691 Ga0157375_11049202
692 Ga0157380_10004661
693 Ga0157380_10059377
694 Ga0157380_11415837
695 Ga0157377_10113500
696 Ga0157379_10035523
697 Ga0157379_10143491
698 Ga0157379_10413666
699 Ga0157376_10387064
700 Ga0157376_10918724
701 Ga0157376_12927572
702 Ga0163161_10469657
703 Ga0206356_10640862
704 Ga0207656_10020950
705 Ga0207682_10047333
706 Ga0207642_10018896
707 Ga0207688_10764732
708 Ga0207680_10022011
709 Ga0207680_10454008
710 Ga0207647_10116267
711 Ga0207645_10338398
712 Ga0207645_10503230
713 Ga0207645_10989280
714 Ga0207643_10063349
715 Ga0207643_10304098
716 Ga0207643_10510622
717 Ga0207705_10018450
718 Ga0207654_10048136
719 Ga0207654_10297623
720 Ga0207707_10000582
721 Ga0207707_10106258
722 Ga0207707_10212866
723 Ga0207695_10129333
724 Ga0207695_10713543
725 Ga0207671_10058206
726 Ga0207671_10274369
727 Ga0207663_10219548
728 Ga0207660_10012873
729 Ga0207660_10033504
730 Ga0207660_10070599
731 Ga0207660_10122834
732 Ga0207660_10730628
733 Ga0207662_10027658
734 Ga0207657_10000302
735 Ga0207657_10902777
736 Ga0207649_10057670
737 Ga0207652_10004959
738 Ga0207652_10010922
739 Ga0207652_10424002
740 Ga0207681_10002070
741 Ga0207681_10043653
742 Ga0207694_10027148
743 Ga0207650_10291983
744 Ga0207650_10467897
745 Ga0207650_10513320
746 Ga0207659_10014621
747 Ga0207659_11483765
748 Ga0207700_11575107
749 Ga0207664_10272430
750 Ga0207664_11522102
751 Ga0207644_10007077
752 Ga0207690_10071890
753 Ga0207706_10040247
754 Ga0207706_10178192
755 Ga0207706_10425564
756 Ga0207686_11000011
757 Ga0207709_10002476
758 Ga0207709_10051400
759 Ga0207670_10436218
760 Ga0207669_10220223
761 Ga0207669_11738430
762 Ga0207704_10021013
763 Ga0207691_10030728
764 Ga0207691_11501650
765 Ga0207711_10029358
766 Ga0207689_10168247
767 Ga0207689_10728454
768 Ga0207661_10077775
769 Ga0207679_10350683
770 Ga0207679_10369263
771 Ga0207679_10535105
772 Ga0207679_11275729
773 Ga0207667_10001606
774 Ga0207667_10107421
775 Ga0207667_10328663
776 Ga0207651_10050020
777 Ga0207651_10110517
778 Ga0207651_11069904
779 Ga0207712_10002513
780 Ga0207668_10003072
781 Ga0207668_10460664
782 Ga0207668_10614727
783 Ga0207640_10067218
784 Ga0207640_10227542
785 Ga0207640_10397591
786 Ga0207658_10067166
787 Ga0207658_10227874
788 Ga0207658_11841423
789 Ga0207677_10328649
790 Ga0207677_10491837
791 Ga0207677_10621355
792 Ga0207703_10075600
793 Ga0207703_10159169
794 Ga0207703_11113226
795 Ga0207703_11738390
796 Ga0207639_10012400
797 Ga0207639_10132595
798 Ga0207678_10004254
799 Ga0207678_10011384
800 Ga0207678_10604975
801 Ga0207678_10643860
802 Ga0207678_10839966
803 Ga0207708_10006309
804 Ga0207702_10007075
805 Ga0207702_10516996
806 Ga0207702_11250876
807 Ga0207641_10563807
808 Ga0207641_11489800
809 Ga0207648_10011201
810 Ga0207648_10653440
811 Ga0207676_11475829
812 Ga0207674_10000251
813 Ga0207674_10314059
814 Ga0207674_10599495
815 Ga0207675_100010339
816 Ga0207675_100469195
817 Ga0207675_101349580
818 Ga0207683_10434885
819 Ga0207683_10656541
820 Ga0207698_10068386
821 Ga0207698_10195119
822 Ga0207698_10209742
823 Ga0209971_1039403
824 Ga0209966_1010430
825 Ga0209998_10085910
826 Ga0268266_10052746
827 Ga0268266_10481806
828 Ga0268266_10507812
829 Ga0268265_10000291
830 Ga0268265_10522708
831 Ga0268265_10689427
832 Ga0268264_10005401
833 Ga0268264_10388337
834 Ga0268264_10529826
835 Ga0307408_101212266
836 Ga0307405_11879462
837 Ga0307407_10560613
838 Ga0307409_101561740
839 Ga0307416_100012292
840 Ga0307416_100844311
841 Ga0307416_102718420
842 Ga0307416_103179502
843 Ga0307411_10763327
844 Ga0307415_100023641
845 Ga0373930_0008971
846 Ga0373948_0023623
847 Ga0373928_0005437
848 Ga0373929_0004743
849 Ga0373934_0249697
850 Ga0373940_0004866
851 Ga0373949_0008294
852 Ga0373951_0032877
853 Ga0373932_0001687
854 Ga0373939_0000922
855 Ga0373941_0000933
856 Ga0373953_0043175
857 Ga0373954_0027058
858 Ga0373956_0114304
859 Ga0373955_0180276
860 Ga0373962_0003112
861 Ga0373931_0000344
862 Ga0373933_0068256
863 Ga0373937_0009190
864 Ga0373925_0192333
865 Ga0395899_0102890
866 Ga0395900_0008836
867 Ga0395900_0148643
868 Ga0395900_0384718
869 Ga0395898_0020070
870 Ga0395898_0412455
871 Ga0395905_0399306
872 Ga0395901_0013535
873 Ga0451800_0017687
874 Ga0451833_0590600
875 Ga0451853_0476034
876 Ga0451853_2948516
877 Ga0439449_0057240
878 Ga0450921_005103
879 Ga0451577_0198323
880 Ga0466963_0147916
881 Ga0466964_0523096
882 Ga0466957_0521857
883 Ga0451576_0027587
884 Ga0466958_0370109
885 Ga0495592_0020432
886 Ga0495651_0006031
887 Ga0495653_0176848
888 Ga0495608_0119649
889 Ga0495628_0079641
890 Ga0495652_0008742
891 Ga0495640_0277998
892 Ga0495587_0002777
893 Ga0495667_0029932
894 Ga0495635_1059976
895 Ga0495657_0035784
896 Ga0495599_0005909
897 Ga0495623_0007781
898 Ga0495646_0148824
899 Ga0495604_0008315
900 Ga0495680_0093764
901 Ga0495675_0015410
902 Ga0495602_0034886
903 Ga0496100_0169290
904 Ga0496100_0952945
905 Ga0496102_0112568
906 Ga0496102_0501069
907 Ga0496102_0520546
908 Ga0496102_1750836
909 Ga0496103_0003025
910 Ga0496103_0540004
911 Ga0496104_0735200
912 Ga0496106_0015222
913 Ga0496106_0090086
914 Ga0496106_0431642
915 Ga0496106_1389997
916 Ga0496107_0021433
917 Ga0496108_0135605
918 Ga0496108_0589047
919 Ga0496108_1545724
920 Ga0496109_0746266
921 Ga0496109_0947074
922 Ga0496111_0547043
923 Ga0496112_0884234
924 Ga0496112_0943992
925 Ga0496114_0248261
926 Ga0496115_0039507
927 Ga0501036_0201429
928 Ga0501036_1014269
929 Ga0501040_0068260
930 Ga0501043_0389105
931 Ga0501047_0025007
932 Ga0501047_0859495
933 Ga0501048_0308681
934 Ga0501071_0525392
935 Ga0501072_0243866
936 Ga0501074_0654559
937 Ga0501075_0013470
938 Ga0501076_0021916
939 Ga0501236_112788
940 Ga0501081_0134753
941 Ga0501083_0729326
942 Ga0501283_053057
943 Ga0501044_0168518
944 Ga0501045_0032604
945 nmdc:mga03n38_806249_c1
946 nmdc:mga00v17_818084_c1
947 nmdc:mga0yw44_301242_c1
948 nmdc:mga0k408_42546_c1
949 nmdc:mga06z11_146038_c1
950 nmdc:mga06z11_70385_c1
951 nmdc:mga07m45_554088_c1
952 nmdc:mga05p37_1219095_c1
953 nmdc:mga0qj67_151587_c1
954 nmdc:mga0qj67_49109_c1
955 nmdc:mga06r32_326437_c1
956 nmdc:mga08y16_1470445_c1
957 nmdc:mga08y16_301535_c1
958 nmdc:mga0n895_2102802_c1
959 nmdc:mga0sz30_143305_c1
960 Ga0495601_0084264
961 Ga0495619_0089480
962 Ga0501082_0502572
963 2516205324
964 2644085821
965 2644345003
966 2644369277
967 2692314428
968 2738745994
969 2739355224
970 2753461013
971 2792624350
972 2792625648
973 2792643724
974 2844004671
975 2847420520
976 2848995392
977 2855878353
978 2856336014
979 2857369078
980 2878782261
981 2922152015
982 2958129316
983 2965038820
984 2965112047
985 2977878477
986 2977959125
987 2987675752
988 3004244547
989 643827158
990 8004695776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

5

114

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nyu-assembly1.cif.gz_K respiratory complex i from escherichia coli - conformation 2 0.5608 7 99
7bv1-assembly1.cif.gz_A cryo-em structure of the apo nsp12-nsp7-nsp8 complex 0.5398 2 56
2nr5-assembly1.cif.gz_C crystal structure of protein of unknown function so2669 from shewanella oneidensis mr-1 0.5311 2 54
7d3u-assembly1.cif.gz_C structure of mrp complex from dietzia sp. dq12-45-1b 0.5227 4 98
8gwe-assembly1.cif.gz_A sars-cov-2 e-rtc complex with rna-nsp9 and gmppnp 0.4982 3 71
ID Description Score Start End Superfamily
af_A0A0P0X9L3_107_499_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9324 5 50 1.10.3860.10
af_H0WEV0_822_1008_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.891 1 48 1.25.40.10
af_Q19153_735_929_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.8677 2 43 1.20.1640.10
af_I1JYC9_28_130_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.827 12 52 1.20.930.10
af_I1KB67_1_98_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.821 13 53 1.20.930.10
ID Description Score Start End GO Terms
AF-A0A512CS11-F1-model_v4 deleted 0.9557 1 51
AF-A0A1H0BM56-F1-model_v4 DUF3239 domain-containing protein 0.848 3 55 GO:0016020
AF-A0A2H0ERF4-F1-model_v4 Na+/H+ antiporter subunit C 0.8309 1 61 GO:0016020
AF-A0A2H0ERF4-F1-model_v4 Na+/H+ antiporter subunit C 0.8185 1 61 GO:0016020
AF-Q8NT24-F1-model_v4 Hypothetical membrane protein 0.8153 5 57 GO:0016020

Map