F454723

General Info

Members Datasets Scaffolds Average Seq Length
495 252 990 215

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10052749|Ga0182008_100527493
Length 258
Sequence MGTKTGFVRPDFRLSESFTAELSETLGPSIKYFLIILRRRASRNGRPRWHTMRMNHDDITRSTLQHYNEHAEDFFNGTIDHDVSQNIDALLGAIATPAPHTILDLGCGPGRDLKTFSGLGHRAIGVDGSERFVAMARQYSGCDVWQQDFLHLDLPPALFDGVFANAVLFHVPSAALPHTLDQLFGTLKPGGVLFTSNPRGQNQEGWNGDRYGSYHDYESWERFLLAAGFVALHHYYRPPGLPRDQQPWLASVWRKPVC

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
120 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
121 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
124 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
125 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
126 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
127 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
128 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
129 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
130 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
131 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
132 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
133 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
134 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
147 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
228 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
233 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
245 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
246 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
247 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
248 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
249 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
250 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
251 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
252 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 0.4
Rhizoplane 2.22
Rhizosphere 89.7
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10052749 3300014497 Bacteria 2015
2 SwRhRL2b_contig_2552633 2162886007 Bacteria 3625
3 JGI25151J46595_10000357 3300003187 Bacteria 48666
4 Ga0055530_10000670 3300003791 Bacteria 29180
5 Ga0055540_1000101 3300003792 Bacteria 96054
6 Ga0065714_10000376 3300005288 Bacteria 5136
7 Ga0065704_10070593 3300005289 Bacteria 19557
8 Ga0065712_10101999 3300005290 Bacteria 2020
9 Ga0070670_100001832 3300005331 Bacteria 17310
10 Ga0070680_100208705 3300005336 Bacteria 1648
11 Ga0070689_100607638 3300005340 Bacteria 948
12 Ga0070673_100031954 3300005364 Bacteria 3957
13 Ga0070673_100044518 3300005364 Bacteria 3437
14 Ga0070667_100243789 3300005367 Bacteria 1605
15 Ga0070667_100314096 3300005367 Bacteria 1413
16 Ga0070714_100191960 3300005435 Bacteria 1864
17 Ga0070713_100016014 3300005436 Bacteria 5627
18 Ga0070710_10024035 3300005437 Bacteria 3210
19 Ga0070711_100085185 3300005439 Bacteria 2263
20 Ga0070663_100186984 3300005455 Bacteria 1610
21 Ga0070678_100075198 3300005456 Bacteria 2540
22 Ga0070662_100473825 3300005457 Bacteria 1042
23 Ga0070706_100626388 3300005467 Unclassified 999
24 Ga0070698_100538186 3300005471 Bacteria 1107
25 Ga0070679_100159348 3300005530 Bacteria 2231
26 Ga0070672_100019137 3300005543 Bacteria 4964
27 Ga0070665_101095668 3300005548 Bacteria 808
28 Ga0070704_100000334 3300005549 Bacteria 21352
29 Ga0068855_100860458 3300005563 Bacteria 960
30 Ga0068852_100797180 3300005616 Bacteria 959
31 Ga0068870_10082991 3300005840 Bacteria 1776
32 Ga0068863_100054397 3300005841 Bacteria 3792
33 Ga0068862_100035457 3300005844 Bacteria 4225
34 Ga0075364_10081244 3300006051 Bacteria 2143
35 Ga0075432_10117078 3300006058 Bacteria 998
36 Ga0075362_10012865 3300006177 Bacteria 3336
37 Ga0075362_10013390 3300006177 Bacteria 3284
38 Ga0075369_10026613 3300006186 Bacteria 2412
39 Ga0075369_10147248 3300006186 Bacteria 1075
40 Ga0075370_10137461 3300006353 Bacteria 1428
41 Ga0075428_100326440 3300006844 Bacteria 1649
42 Ga0075431_100005078 3300006847 Bacteria 12949
43 Ga0075431_100024317 3300006847 Bacteria 6206
44 Ga0075433_10317376 3300006852 Bacteria 1379
45 Ga0075429_100002970 3300006880 Bacteria 14385
46 Ga0075436_100194557 3300006914 Bacteria 1435
47 Ga0075436_100236297 3300006914 Bacteria 1299
48 Ga0075436_100358740 3300006914 Bacteria 1051
49 Ga0079104_1000104 3300006946 Bacteria 123967
50 Ga0075435_100051083 3300007076 Bacteria 3329
51 Ga0105251_10009327 3300009011 Bacteria 5805
52 Ga0105244_10020297 3300009036 Bacteria 3694
53 Ga0105244_10074515 3300009036 Bacteria 1688
54 Ga0105244_10190239 3300009036 Bacteria 971
55 Ga0105240_10006057 3300009093 Bacteria 17866
56 Ga0105245_10360048 3300009098 Bacteria 1444
57 Ga0105247_10507630 3300009101 Bacteria 879
58 Ga0114129_10007699 3300009147 Bacteria 15329
59 Ga0105243_10001643 3300009148 Bacteria 19417
60 Ga0105243_10014739 3300009148 Bacteria 5912
61 Ga0105242_10026625 3300009176 Bacteria 4584
62 Ga0105248_10500773 3300009177 Bacteria 1369
63 Ga0105249_10672519 3300009553 Bacteria 1094
64 Ga0105246_10015633 3300011119 Bacteria 4794
65 Ga0157373_10008807 3300013100 Bacteria 7476
66 Ga0157371_10000014 3300013102 Bacteria 347490
67 Ga0157370_10002333 3300013104 Bacteria 22943
68 Ga0157370_10019546 3300013104 Bacteria 6789
69 Ga0157369_10793787 3300013105 Bacteria 973
70 Ga0157374_10108371 3300013296 Bacteria 2670
71 Ga0157378_10001962 3300013297 Bacteria 18444
72 Ga0163162_10206815 3300013306 Bacteria 2092
73 Ga0163162_10920814 3300013306 Bacteria 986
74 Ga0157372_10023689 3300013307 Bacteria 6659
75 Ga0157372_10374242 3300013307 Bacteria 1660
76 Ga0157375_10442881 3300013308 Bacteria 1465
77 Ga0157380_10790826 3300014326 Bacteria 965
78 Ga0157377_10208329 3300014745 Bacteria 1245
79 Ga0182006_1071917 3300015261 Bacteria 1280
80 Ga0182007_10004733 3300015262 Bacteria 6121
81 Ga0163161_10203332 3300017792 Bacteria 1527
82 Ga0209676_1002256 3300025292 Bacteria 14199
83 Ga0209676_1036814 3300025292 Bacteria 1419
84 Ga0209025_1000003 3300025294 Bacteria 1366495
85 Ga0209050_1000028 3300025298 Bacteria 477133
86 Ga0209050_1000373 3300025298 Bacteria 85474
87 Ga0209051_1000087 3300025303 Bacteria 181248
88 Ga0209051_1001606 3300025303 Bacteria 18440
89 Ga0209257_1014860 3300025304 Bacteria 3298
90 Ga0207696_1018163 3300025711 Bacteria 2314
91 Ga0207655_1000014 3300025728 Bacteria 607124
92 Ga0207655_1001346 3300025728 Bacteria 23087
93 Ga0207655_1005872 3300025728 Bacteria 8231
94 Ga0207655_1021340 3300025728 Bacteria 3290
95 Ga0207655_1027502 3300025728 Bacteria 2708
96 Ga0207655_1076821 3300025728 Bacteria 1220
97 Ga0207713_1001137 3300025735 Bacteria 22574
98 Ga0207713_1009804 3300025735 Bacteria 5363
99 Ga0207713_1127886 3300025735 Bacteria 844
100 Ga0207692_10006130 3300025898 Bacteria 4864
101 Ga0207699_10030814 3300025906 Bacteria 3005
102 Ga0207645_10131586 3300025907 Unclassified 1628
103 Ga0207645_10371327 3300025907 Bacteria 959
104 Ga0207643_10073690 3300025908 Bacteria 1968
105 Ga0207649_10398160 3300025920 Bacteria 1030
106 Ga0207650_10001420 3300025925 Bacteria 17258
107 Ga0207664_10008038 3300025929 Bacteria 7332
108 Ga0207644_10015337 3300025931 Bacteria 5140
109 Ga0207706_10402470 3300025933 Bacteria 1187
110 Ga0207686_10011971 3300025934 Bacteria 4761
111 Ga0207709_10568245 3300025935 Bacteria 894
112 Ga0207689_10354063 3300025942 Bacteria 1221
113 Ga0207651_10002181 3300025960 Bacteria 9267
114 Ga0207658_10048511 3300025986 Bacteria 3114
115 Ga0207677_10620841 3300026023 Bacteria 951
116 Ga0207641_10102736 3300026088 Bacteria 2521
117 Ga0207648_10020371 3300026089 Bacteria 5973
118 Ga0207648_10422649 3300026089 Bacteria 1210
119 Ga0207676_10098158 3300026095 Bacteria 2421
120 Ga0207683_10071160 3300026121 Bacteria 3074
121 Ga0207698_10609923 3300026142 Bacteria 1077
122 Ga0209281_1000026 3300027111 Bacteria 465877
123 Ga0207428_10034989 3300027907 Bacteria 4110
124 Ga0207428_10041110 3300027907 Bacteria 3745
125 Ga0207428_10230662 3300027907 Bacteria 1386
126 Ga0207428_10561749 3300027907 Bacteria 825
127 Ga0268266_10290380 3300028379 Bacteria 1523
128 Ga0268265_10134419 3300028380 Bacteria 2061
129 Ga0268264_10533794 3300028381 Bacteria 1149
130 Ga0265340_10058686 3300031247 Bacteria 1847
131 Ga0307509_10000080 3300031507 Bacteria 134551
132 Ga0307408_100000715 3300031548 Bacteria 26954
133 Ga0307408_100000724 3300031548 Bacteria 26734
134 Ga0307408_100025435 3300031548 Bacteria 4056
135 Ga0307405_10074385 3300031731 Bacteria 2197
136 Ga0307410_10000750 3300031852 Bacteria 13579
137 Ga0307410_10014507 3300031852 Bacteria 4639
138 Ga0307406_10002483 3300031901 Bacteria 10055
139 Ga0307406_10243421 3300031901 Bacteria 1350
140 Ga0307412_10001885 3300031911 Bacteria 11604
141 Ga0307412_10003880 3300031911 Bacteria 8321
142 Ga0307409_100040141 3300031995 Unclassified 3481
143 Ga0307409_100056952 3300031995 Bacteria 3025
144 Ga0307416_100009816 3300032002 Bacteria 6292
145 Ga0307416_100179652 3300032002 Bacteria 1982
146 Ga0307414_10009640 3300032004 Bacteria 5559
147 Ga0307414_10010392 3300032004 Bacteria 5397
148 Ga0307411_10006850 3300032005 Bacteria 5741
149 Ga0307411_10068718 3300032005 Bacteria 2389
150 Ga0307415_100046837 3300032126 Bacteria 2907
151 Ga0307415_100053780 3300032126 Bacteria 2745
152 Ga0395900_0114057 3300037418 Bacteria 2773
153 Ga0395898_0010681 3300037466 Bacteria 9594
154 Ga0395901_0119080 3300038443 Bacteria 2774
155 Ga0436361_0233233 3300039447 Bacteria 4840
156 Ga0436363_1684839 3300039450 Bacteria 886
157 Ga0439438_003148 3300041405 Bacteria 6770
158 Ga0439438_004497 3300041405 Bacteria 5328
159 Ga0439438_006173 3300041405 Bacteria 4268
160 Ga0439438_029326 3300041405 Bacteria 1473
161 Ga0439438_047119 3300041405 Bacteria 1105
162 Ga0439447_004163 3300041407 Bacteria 5027
163 Ga0439447_025347 3300041407 Bacteria 1528
164 Ga0439466_0005116 3300041411 Bacteria 5027
165 Ga0439466_0009631 3300041411 Bacteria 3611
166 Ga0439466_0029474 3300041411 Bacteria 1887
167 Ga0439466_0043100 3300041411 Bacteria 1500
168 Ga0439432_005198 3300042006 Bacteria 4704
169 Ga0439432_045672 3300042006 Bacteria 1377
170 Ga0439451_000751 3300042009 Bacteria 6154
171 Ga0439451_003223 3300042009 Bacteria 3314
172 Ga0439451_003524 3300042009 Bacteria 3172
173 Ga0439451_016444 3300042009 Bacteria 1490
174 Ga0439451_025466 3300042009 Bacteria 1192
175 Ga0439451_029579 3300042009 Bacteria 1102
176 Ga0439452_000422 3300042010 Bacteria 24685
177 Ga0439452_000912 3300042010 Bacteria 13463
178 Ga0439452_003576 3300042010 Bacteria 5415
179 Ga0439452_003597 3300042010 Bacteria 5402
180 Ga0439456_003259 3300042013 Bacteria 3283
181 Ga0439456_003556 3300042013 Bacteria 3159
182 Ga0439456_010296 3300042013 Bacteria 1932
183 Ga0439456_013921 3300042013 Bacteria 1675
184 Ga0439456_027245 3300042013 Bacteria 1217
185 Ga0439456_078742 3300042013 Bacteria 734
186 Ga0439463_008005 3300042016 Bacteria 2608
187 Ga0439463_027106 3300042016 Bacteria 1441
188 Ga0450911_000766 3300042115 Bacteria 9162
189 Ga0450920_001207 3300042122 Bacteria 4235
190 Ga0450922_000211 3300042124 Bacteria 6224
191 Ga0450903_001695 3300042138 Bacteria 4063
192 Ga0450903_002862 3300042138 Bacteria 3016
193 Ga0450905_038378 3300042142 Bacteria 756
194 Ga0450906_003282 3300042145 Bacteria 3494
195 Ga0450907_000931 3300042146 Bacteria 6946
196 Ga0450907_007226 3300042146 Bacteria 1854
197 Ga0450910_000142 3300042147 Bacteria 7771
198 Ga0439460_0000371 3300042461 Bacteria 9510
199 Ga0450901_000943 3300042533 Bacteria 3407
200 Ga0451577_0108674 3300042876 Bacteria 2479
201 Ga0453683_0148293 3300044673 Bacteria 1482
202 Ga0466966_0001374 3300044684 Bacteria 15651
203 Ga0466963_0044011 3300044694 Bacteria 2937
204 Ga0466971_0009872 3300044719 Bacteria 4169
205 Ga0466957_0219314 3300044842 Bacteria 1255
206 Ga0451576_0694087 3300045051 Bacteria 1069
207 Ga0495617_006792 3300046452 Bacteria 3998
208 Ga0495617_064294 3300046452 Bacteria 1210
209 Ga0495603_0001850 3300046455 Bacteria 12491
210 Ga0495603_0010898 3300046455 Bacteria 5515
211 Ga0495590_0000070 3300046457 Bacteria 71704
212 Ga0495590_0004840 3300046457 Bacteria 5391
213 Ga0495590_0024088 3300046457 Bacteria 2146
214 Ga0495590_0121020 3300046457 Bacteria 938
215 Ga0495591_000814 3300046458 Bacteria 22076
216 Ga0495591_008269 3300046458 Bacteria 4285
217 Ga0495591_066291 3300046458 Bacteria 947
218 Ga0495591_068113 3300046458 Bacteria 930
219 Ga0495591_069084 3300046458 Bacteria 921
220 Ga0495629_0009341 3300046459 Bacteria 7175
221 Ga0495629_0403156 3300046459 Bacteria 929
222 Ga0495638_0003773 3300046460 Bacteria 11774
223 Ga0495638_0225729 3300046460 Bacteria 1044
224 Ga0495638_0335315 3300046460 Bacteria 803
225 Ga0495638_0342702 3300046460 Bacteria 791
226 Ga0495653_0115274 3300046463 Bacteria 1923
227 Ga0495653_0120246 3300046463 Bacteria 1873
228 Ga0495650_0021683 3300046471 Bacteria 3095
229 Ga0495582_0015167 3300046473 Bacteria 4238
230 Ga0495605_0004973 3300046474 Bacteria 7765
231 Ga0495605_0012597 3300046474 Bacteria 4683
232 Ga0495605_0021547 3300046474 Bacteria 3412
233 Ga0495605_0038537 3300046474 Bacteria 2397
234 Ga0495605_0066312 3300046474 Bacteria 1715
235 Ga0495639_0027728 3300046475 Bacteria 2507
236 Ga0495584_0001992 3300046491 Bacteria 11750
237 Ga0495584_0002774 3300046491 Bacteria 9788
238 Ga0495584_0003471 3300046491 Bacteria 8668
239 Ga0495584_0057300 3300046491 Bacteria 1960
240 Ga0495585_0002252 3300046492 Bacteria 13946
241 Ga0495585_0002655 3300046492 Bacteria 12557
242 Ga0495585_0007186 3300046492 Bacteria 6839
243 Ga0495585_0014217 3300046492 Bacteria 4643
244 Ga0495585_0018035 3300046492 Bacteria 4072
245 Ga0495585_0035479 3300046492 Bacteria 2817
246 Ga0495585_0295091 3300046492 Bacteria 798
247 Ga0495594_0039700 3300046499 Bacteria 2574
248 Ga0495596_0022838 3300046500 Bacteria 2543
249 Ga0495607_0010319 3300046501 Bacteria 6282
250 Ga0495607_0017594 3300046501 Bacteria 4582
251 Ga0495607_0045178 3300046501 Bacteria 2592
252 Ga0495607_0051325 3300046501 Bacteria 2396
253 Ga0495607_0066114 3300046501 Bacteria 2036
254 Ga0495607_0223172 3300046501 Bacteria 920
255 Ga0495607_0302588 3300046501 Bacteria 752
256 Ga0495583_0000097 3300046506 Bacteria 149533
257 Ga0495583_0000191 3300046506 Bacteria 102390
258 Ga0495583_0002041 3300046506 Bacteria 18382
259 Ga0495583_0016880 3300046506 Bacteria 3900
260 Ga0495583_0018230 3300046506 Bacteria 3699
261 Ga0495583_0074081 3300046506 Bacteria 1491
262 Ga0495606_0001913 3300046507 Bacteria 25940
263 Ga0495606_0041291 3300046507 Bacteria 3094
264 Ga0495606_0048674 3300046507 Bacteria 2786
265 Ga0495610_0000274 3300046512 Bacteria 53842
266 Ga0495610_0008960 3300046512 Bacteria 6399
267 Ga0495610_0009767 3300046512 Bacteria 6028
268 Ga0495610_0021111 3300046512 Bacteria 3589
269 Ga0495610_0027303 3300046512 Bacteria 3036
270 Ga0495616_0008430 3300046513 Bacteria 6107
271 Ga0495616_0009729 3300046513 Bacteria 5603
272 Ga0495616_0051291 3300046513 Bacteria 2058
273 Ga0495616_0053523 3300046513 Bacteria 2005
274 Ga0495620_0018295 3300046515 Bacteria 3472
275 Ga0495630_0052013 3300046517 Bacteria 3066
276 Ga0495630_0140327 3300046517 Bacteria 1837
277 Ga0495631_0000211 3300046518 Bacteria 40060
278 Ga0495631_0002161 3300046518 Bacteria 11354
279 Ga0495631_0007179 3300046518 Bacteria 5682
280 Ga0495631_0010448 3300046518 Bacteria 4591
281 Ga0495631_0011881 3300046518 Bacteria 4269
282 Ga0495632_0009195 3300046519 Bacteria 5973
283 Ga0495632_0017835 3300046519 Bacteria 3907
284 Ga0495632_0068325 3300046519 Bacteria 1712
285 Ga0495632_0087073 3300046519 Bacteria 1485
286 Ga0495632_0170358 3300046519 Bacteria 1000
287 Ga0495637_0000536 3300046520 Bacteria 27298
288 Ga0495637_0005647 3300046520 Bacteria 6350
289 Ga0495637_0028312 3300046520 Bacteria 2503
290 Ga0495637_0066972 3300046520 Bacteria 1458
291 Ga0495637_0113836 3300046520 Bacteria 1046
292 Ga0495643_0010659 3300046522 Bacteria 5647
293 Ga0495643_0080012 3300046522 Bacteria 1702
294 Ga0495643_0228892 3300046522 Bacteria 877
295 Ga0495644_0006205 3300046523 Bacteria 4646
296 Ga0495644_0161553 3300046523 Bacteria 859
297 Ga0495648_0001202 3300046524 Bacteria 25931
298 Ga0495648_0002140 3300046524 Bacteria 18596
299 Ga0495648_0005909 3300046524 Bacteria 10070
300 Ga0495648_0010477 3300046524 Bacteria 7058
301 Ga0495648_0025120 3300046524 Bacteria 4038
302 Ga0495648_0047928 3300046524 Bacteria 2635
303 Ga0495648_0054064 3300046524 Bacteria 2428
304 Ga0495648_0100339 3300046524 Bacteria 1599
305 Ga0495666_0010128 3300046526 Bacteria 4703
306 Ga0495666_0015563 3300046526 Bacteria 3786
307 Ga0495642_0000168 3300046528 Bacteria 38257
308 Ga0495642_0005337 3300046528 Bacteria 4929
309 Ga0495654_0006937 3300046530 Bacteria 6383
310 Ga0495654_0010011 3300046530 Bacteria 5178
311 Ga0495654_0012700 3300046530 Bacteria 4521
312 Ga0495654_0094227 3300046530 Bacteria 1386
313 Ga0495654_0107190 3300046530 Bacteria 1278
314 Ga0495654_0156568 3300046530 Bacteria 1003
315 Ga0495586_0020201 3300046535 Bacteria 3547
316 Ga0495609_0000057 3300046538 Bacteria 143793
317 Ga0495609_0001418 3300046538 Bacteria 15997
318 Ga0495609_0025748 3300046538 Bacteria 2695
319 Ga0495609_0151954 3300046538 Bacteria 984
320 Ga0495597_0000108 3300046542 Bacteria 73202
321 Ga0495597_0007935 3300046542 Bacteria 5349
322 Ga0495597_0034230 3300046542 Bacteria 2296
323 Ga0495597_0068225 3300046542 Bacteria 1537
324 Ga0495597_0086366 3300046542 Bacteria 1336
325 Ga0495645_0138396 3300046543 Bacteria 1701
326 Ga0495622_0001718 3300046557 Bacteria 10827
327 Ga0495622_0009105 3300046557 Bacteria 4597
328 Ga0495622_0156421 3300046557 Bacteria 1029
329 Ga0495622_0279334 3300046557 Bacteria 730
330 Ga0495633_0000038 3300046558 Bacteria 182144
331 Ga0495633_0002023 3300046558 Bacteria 14644
332 Ga0495633_0002103 3300046558 Bacteria 14311
333 Ga0495633_0070563 3300046558 Bacteria 1630
334 Ga0495633_0077207 3300046558 Bacteria 1551
335 Ga0495656_0047265 3300046615 Bacteria 1824
336 Ga0495668_0018996 3300046616 Bacteria 3967
337 Ga0495668_0067180 3300046616 Bacteria 1972
338 Ga0495634_0185973 3300046642 Bacteria 1298
339 Ga0495611_0000597 3300046648 Bacteria 20827
340 Ga0495611_0006442 3300046648 Bacteria 5005
341 Ga0495611_0007119 3300046648 Bacteria 4751
342 Ga0495625_0003606 3300046660 Bacteria 15209
343 Ga0495625_0060274 3300046660 Bacteria 2689
344 Ga0495625_0146538 3300046660 Bacteria 1589
345 Ga0495635_0001539 3300046663 Bacteria 15461
346 Ga0495661_0000079 3300046665 Bacteria 117662
347 Ga0495661_0015447 3300046665 Bacteria 5096
348 Ga0495661_0018214 3300046665 Bacteria 4622
349 Ga0495661_0159463 3300046665 Bacteria 1212
350 Ga0495588_0060383 3300046674 Bacteria 1962
351 Ga0495588_0076237 3300046674 Bacteria 1747
352 Ga0495588_0114285 3300046674 Bacteria 1422
353 Ga0495588_0213692 3300046674 Bacteria 1018
354 Ga0495657_0040924 3300046675 Bacteria 3175
355 Ga0495623_0004030 3300046679 Bacteria 9670
356 Ga0495646_0030560 3300046680 Bacteria 3363
357 Ga0495669_0013251 3300046684 Bacteria 3512
358 Ga0495669_0026285 3300046684 Bacteria 2543
359 Ga0495613_0028280 3300046689 Bacteria 4169
360 Ga0495670_0004229 3300046691 Bacteria 7034
361 Ga0495670_0026625 3300046691 Bacteria 2862
362 Ga0495670_0084009 3300046691 Bacteria 1624
363 Ga0495671_0030864 3300046692 Bacteria 2742
364 Ga0495671_0034513 3300046692 Bacteria 2571
365 Ga0495671_0100223 3300046692 Bacteria 1416
366 Ga0495671_0109258 3300046692 Bacteria 1350
367 Ga0495671_0110458 3300046692 Bacteria 1343
368 Ga0495649_0000093 3300046694 Bacteria 77036
369 Ga0495649_0002108 3300046694 Bacteria 14270
370 Ga0495649_0006614 3300046694 Bacteria 7202
371 Ga0495649_0010505 3300046694 Bacteria 5458
372 Ga0495649_0030073 3300046694 Bacteria 3000
373 Ga0495649_0094392 3300046694 Bacteria 1592
374 Ga0495649_0229910 3300046694 Bacteria 957
375 Ga0495589_0001765 3300046794 Bacteria 12315
376 Ga0495589_0002828 3300046794 Bacteria 9605
377 Ga0495589_0003855 3300046794 Bacteria 8063
378 Ga0495589_0011980 3300046794 Bacteria 4495
379 Ga0495589_0036125 3300046794 Bacteria 2477
380 Ga0495600_0046754 3300046809 Bacteria 2822
381 Ga0495660_0001792 3300046810 Bacteria 14180
382 Ga0495660_0005320 3300046810 Bacteria 7709
383 Ga0495660_0021370 3300046810 Bacteria 3706
384 Ga0495660_0030423 3300046810 Bacteria 3041
385 Ga0495660_0056044 3300046810 Bacteria 2131
386 Ga0495660_0057250 3300046810 Bacteria 2103
387 Ga0495660_0119852 3300046810 Bacteria 1332
388 Ga0495581_0039744 3300047315 Bacteria 2723
389 Ga0495604_0026574 3300047317 Bacteria 4607
390 Ga0495604_0069101 3300047317 Bacteria 2678
391 Ga0495672_0000217 3300047320 Bacteria 82349
392 Ga0495672_0004202 3300047320 Bacteria 11926
393 Ga0495672_0008545 3300047320 Bacteria 7536
394 Ga0495672_0014534 3300047320 Bacteria 5386
395 Ga0495672_0147425 3300047320 Bacteria 1223
396 Ga0495680_0003309 3300047322 Bacteria 15961
397 Ga0495680_0206011 3300047322 Bacteria 1409
398 Ga0495683_0000032 3300047323 Bacteria 149612
399 Ga0495683_0000662 3300047323 Bacteria 25479
400 Ga0495683_0001378 3300047323 Bacteria 16137
401 Ga0495683_0127750 3300047323 Bacteria 1201
402 Ga0495687_000468 3300047443 Bacteria 48911
403 Ga0495687_002332 3300047443 Bacteria 15437
404 Ga0495675_0000933 3300047444 Bacteria 17751
405 Ga0495677_0000211 3300047445 Bacteria 26799
406 Ga0495677_0000772 3300047445 Bacteria 12890
407 Ga0495677_0007786 3300047445 Bacteria 3992
408 Ga0495679_001335 3300047446 Bacteria 14250
409 Ga0495679_003191 3300047446 Bacteria 7985
410 Ga0495679_008539 3300047446 Bacteria 4155
411 Ga0495679_074569 3300047446 Bacteria 971
412 Ga0495685_055863 3300047447 Bacteria 1335
413 Ga0495673_0000975 3300047469 Bacteria 25729
414 Ga0495673_0006595 3300047469 Bacteria 6806
415 Ga0495673_0022922 3300047469 Bacteria 3050
416 Ga0495673_0034498 3300047469 Bacteria 2338
417 Ga0495681_0006548 3300047470 Bacteria 7631
418 Ga0495681_0007492 3300047470 Bacteria 6961
419 Ga0495681_0014079 3300047470 Bacteria 4607
420 Ga0495681_0020473 3300047470 Bacteria 3589
421 Ga0495681_0039984 3300047470 Bacteria 2286
422 Ga0495681_0206769 3300047470 Bacteria 793
423 Ga0495684_0045614 3300047471 Bacteria 3354
424 Ga0495686_0000142 3300047472 Bacteria 143655
425 Ga0495686_0003700 3300047472 Bacteria 13057
426 Ga0495686_0016273 3300047472 Bacteria 5047
427 Ga0495686_0171739 3300047472 Bacteria 1260
428 Ga0495686_0246179 3300047472 Bacteria 1006
429 Ga0495593_0032936 3300047673 Bacteria 2823
430 Ga0495593_0050409 3300047673 Bacteria 2205
431 Ga0495593_0322623 3300047673 Bacteria 772
432 Ga0495602_0044983 3300048088 Bacteria 3999
433 Ga0495602_0636111 3300048088 Bacteria 730
434 Ga0495626_0000926 3300048091 Bacteria 25722
435 Ga0495626_0012303 3300048091 Bacteria 4490
436 Ga0495626_0012686 3300048091 Bacteria 4408
437 Ga0495626_0033244 3300048091 Bacteria 2473
438 Ga0495626_0044961 3300048091 Bacteria 2063
439 Ga0495626_0070706 3300048091 Bacteria 1569
440 Ga0496111_0605180 3300048914 Bacteria 802
441 Ga0496115_0313893 3300048918 Bacteria 1283
442 Ga0496115_0611820 3300048918 Bacteria 865
443 Ga0496117_0159330 3300048920 Bacteria 1324
444 Ga0496118_0119980 3300048921 Bacteria 1717
445 Ga0496121_0010810 3300048924 Bacteria 10222
446 Ga0496121_0036203 3300048924 Bacteria 4402
447 Ga0496124_0001925 3300048927 Bacteria 28421
448 Ga0496124_0037743 3300048927 Bacteria 4199
449 Ga0496124_0079587 3300048927 Bacteria 2698
450 Ga0496124_0094995 3300048927 Bacteria 2424
451 Ga0496124_0168081 3300048927 Bacteria 1702
452 Ga0496125_0012503 3300048928 Bacteria 8421
453 Ga0496125_0018741 3300048928 Bacteria 6560
454 Ga0495678_000163 3300049459 Bacteria 78292
455 Ga0495678_008016 3300049459 Bacteria 5394
456 Ga0495682_0011711 3300049460 Bacteria 3370
457 Ga0495682_0016431 3300049460 Bacteria 2801
458 Ga0495682_0018734 3300049460 Bacteria 2607
459 Ga0495682_0060369 3300049460 Bacteria 1369
460 Ga0495682_0066687 3300049460 Bacteria 1297
461 Ga0501298_006264 3300049521 Bacteria 1942
462 Ga0501209_051711 3300049656 Unclassified 1123
463 Ga0501223_035671 3300049663 Unclassified 967
464 Ga0501235_011995 3300049669 Bacteria 1905
465 Ga0501225_0004952 3300049705 Bacteria 3935
466 Ga0501083_0573300 3300049744 Bacteria 734
467 Ga0501269_019829 3300049766 Bacteria 836
468 Ga0501226_001463 3300049853 Bacteria 3019
469 nmdc:mga03683_122573_c1 3300050489 Bacteria 1157
470 nmdc:mga03683_22678_c1 3300050489 Bacteria 2436
471 nmdc:mga03683_87125_c1 3300050489 Bacteria 1357
472 nmdc:mga00v17_136651_c1 3300050491 Bacteria 1570
473 nmdc:mga00v17_160810_c1 3300050491 Bacteria 1446
474 nmdc:mga00v17_65687_c1 3300050491 Bacteria 2239
475 nmdc:mga07m45_262675_c1 3300050496 Bacteria 1004
476 nmdc:mga05p37_6901_c1 3300050507 Bacteria 13387
477 nmdc:mga09592_4077_c1 3300050508 Bacteria 11795
478 nmdc:mga06r32_134084_c1 3300050510 Bacteria 2451
479 nmdc:mga06r32_84134_c1 3300050510 Bacteria 3100
480 nmdc:mga0n895_109739_c1 3300050512 Bacteria 2427
481 nmdc:mga0rr50_115959_c1 3300050513 Bacteria 2126
482 nmdc:mga08x19_122274_c1 3300050514 Bacteria 1746
483 nmdc:mga08x19_233117_c1 3300050514 Bacteria 1267
484 nmdc:mga0a205_271991_c1 3300050515 Bacteria 1248
485 nmdc:mga0a205_285592_c1 3300050515 Bacteria 1525
486 nmdc:mga0a205_51700_c1 3300050515 Bacteria 3966
487 2599888430 2599185289 Bacteria 6778765
488 2599900324 2599185291 Bacteria 6775623
489 2599961664 2599185305 Bacteria 6748700
490 2600004637 2599185313 Bacteria 6658188
491 2600018864 2599185315 Bacteria 6771107
492 2600055120 2599185321 Bacteria 6764560
493 2600071543 2599185324 Bacteria 6590677
494 2644189676 2643221633 Bacteria 6733554
495 2671092554 2667528170 Bacteria 6786960
496 Ga0182008_10052749
497 SwRhRL2b_contig_2552633
498 JGI25151J46595_10000357
499 Ga0055530_10000670
500 Ga0055540_1000101
501 Ga0065714_10000376
502 Ga0065704_10070593
503 Ga0065712_10101999
504 Ga0070670_100001832
505 Ga0070680_100208705
506 Ga0070689_100607638
507 Ga0070673_100031954
508 Ga0070673_100044518
509 Ga0070667_100243789
510 Ga0070667_100314096
511 Ga0070714_100191960
512 Ga0070713_100016014
513 Ga0070710_10024035
514 Ga0070711_100085185
515 Ga0070663_100186984
516 Ga0070678_100075198
517 Ga0070662_100473825
518 Ga0070706_100626388
519 Ga0070698_100538186
520 Ga0070679_100159348
521 Ga0070672_100019137
522 Ga0070665_101095668
523 Ga0070704_100000334
524 Ga0068855_100860458
525 Ga0068852_100797180
526 Ga0068870_10082991
527 Ga0068863_100054397
528 Ga0068862_100035457
529 Ga0075364_10081244
530 Ga0075432_10117078
531 Ga0075362_10012865
532 Ga0075362_10013390
533 Ga0075369_10026613
534 Ga0075369_10147248
535 Ga0075370_10137461
536 Ga0075428_100326440
537 Ga0075431_100005078
538 Ga0075431_100024317
539 Ga0075433_10317376
540 Ga0075429_100002970
541 Ga0075436_100194557
542 Ga0075436_100236297
543 Ga0075436_100358740
544 Ga0079104_1000104
545 Ga0075435_100051083
546 Ga0105251_10009327
547 Ga0105244_10020297
548 Ga0105244_10074515
549 Ga0105244_10190239
550 Ga0105240_10006057
551 Ga0105245_10360048
552 Ga0105247_10507630
553 Ga0114129_10007699
554 Ga0105243_10001643
555 Ga0105243_10014739
556 Ga0105242_10026625
557 Ga0105248_10500773
558 Ga0105249_10672519
559 Ga0105246_10015633
560 Ga0157373_10008807
561 Ga0157371_10000014
562 Ga0157370_10002333
563 Ga0157370_10019546
564 Ga0157369_10793787
565 Ga0157374_10108371
566 Ga0157378_10001962
567 Ga0163162_10206815
568 Ga0163162_10920814
569 Ga0157372_10023689
570 Ga0157372_10374242
571 Ga0157375_10442881
572 Ga0157380_10790826
573 Ga0157377_10208329
574 Ga0182006_1071917
575 Ga0182007_10004733
576 Ga0163161_10203332
577 Ga0209676_1002256
578 Ga0209676_1036814
579 Ga0209025_1000003
580 Ga0209050_1000028
581 Ga0209050_1000373
582 Ga0209051_1000087
583 Ga0209051_1001606
584 Ga0209257_1014860
585 Ga0207696_1018163
586 Ga0207655_1000014
587 Ga0207655_1001346
588 Ga0207655_1005872
589 Ga0207655_1021340
590 Ga0207655_1027502
591 Ga0207655_1076821
592 Ga0207713_1001137
593 Ga0207713_1009804
594 Ga0207713_1127886
595 Ga0207692_10006130
596 Ga0207699_10030814
597 Ga0207645_10131586
598 Ga0207645_10371327
599 Ga0207643_10073690
600 Ga0207649_10398160
601 Ga0207650_10001420
602 Ga0207664_10008038
603 Ga0207644_10015337
604 Ga0207706_10402470
605 Ga0207686_10011971
606 Ga0207709_10568245
607 Ga0207689_10354063
608 Ga0207651_10002181
609 Ga0207658_10048511
610 Ga0207677_10620841
611 Ga0207641_10102736
612 Ga0207648_10020371
613 Ga0207648_10422649
614 Ga0207676_10098158
615 Ga0207683_10071160
616 Ga0207698_10609923
617 Ga0209281_1000026
618 Ga0207428_10034989
619 Ga0207428_10041110
620 Ga0207428_10230662
621 Ga0207428_10561749
622 Ga0268266_10290380
623 Ga0268265_10134419
624 Ga0268264_10533794
625 Ga0265340_10058686
626 Ga0307509_10000080
627 Ga0307408_100000715
628 Ga0307408_100000724
629 Ga0307408_100025435
630 Ga0307405_10074385
631 Ga0307410_10000750
632 Ga0307410_10014507
633 Ga0307406_10002483
634 Ga0307406_10243421
635 Ga0307412_10001885
636 Ga0307412_10003880
637 Ga0307409_100040141
638 Ga0307409_100056952
639 Ga0307416_100009816
640 Ga0307416_100179652
641 Ga0307414_10009640
642 Ga0307414_10010392
643 Ga0307411_10006850
644 Ga0307411_10068718
645 Ga0307415_100046837
646 Ga0307415_100053780
647 Ga0395900_0114057
648 Ga0395898_0010681
649 Ga0395901_0119080
650 Ga0436361_0233233
651 Ga0436363_1684839
652 Ga0439438_003148
653 Ga0439438_004497
654 Ga0439438_006173
655 Ga0439438_029326
656 Ga0439438_047119
657 Ga0439447_004163
658 Ga0439447_025347
659 Ga0439466_0005116
660 Ga0439466_0009631
661 Ga0439466_0029474
662 Ga0439466_0043100
663 Ga0439432_005198
664 Ga0439432_045672
665 Ga0439451_000751
666 Ga0439451_003223
667 Ga0439451_003524
668 Ga0439451_016444
669 Ga0439451_025466
670 Ga0439451_029579
671 Ga0439452_000422
672 Ga0439452_000912
673 Ga0439452_003576
674 Ga0439452_003597
675 Ga0439456_003259
676 Ga0439456_003556
677 Ga0439456_010296
678 Ga0439456_013921
679 Ga0439456_027245
680 Ga0439456_078742
681 Ga0439463_008005
682 Ga0439463_027106
683 Ga0450911_000766
684 Ga0450920_001207
685 Ga0450922_000211
686 Ga0450903_001695
687 Ga0450903_002862
688 Ga0450905_038378
689 Ga0450906_003282
690 Ga0450907_000931
691 Ga0450907_007226
692 Ga0450910_000142
693 Ga0439460_0000371
694 Ga0450901_000943
695 Ga0451577_0108674
696 Ga0453683_0148293
697 Ga0466966_0001374
698 Ga0466963_0044011
699 Ga0466971_0009872
700 Ga0466957_0219314
701 Ga0451576_0694087
702 Ga0495617_006792
703 Ga0495617_064294
704 Ga0495603_0001850
705 Ga0495603_0010898
706 Ga0495590_0000070
707 Ga0495590_0004840
708 Ga0495590_0024088
709 Ga0495590_0121020
710 Ga0495591_000814
711 Ga0495591_008269
712 Ga0495591_066291
713 Ga0495591_068113
714 Ga0495591_069084
715 Ga0495629_0009341
716 Ga0495629_0403156
717 Ga0495638_0003773
718 Ga0495638_0225729
719 Ga0495638_0335315
720 Ga0495638_0342702
721 Ga0495653_0115274
722 Ga0495653_0120246
723 Ga0495650_0021683
724 Ga0495582_0015167
725 Ga0495605_0004973
726 Ga0495605_0012597
727 Ga0495605_0021547
728 Ga0495605_0038537
729 Ga0495605_0066312
730 Ga0495639_0027728
731 Ga0495584_0001992
732 Ga0495584_0002774
733 Ga0495584_0003471
734 Ga0495584_0057300
735 Ga0495585_0002252
736 Ga0495585_0002655
737 Ga0495585_0007186
738 Ga0495585_0014217
739 Ga0495585_0018035
740 Ga0495585_0035479
741 Ga0495585_0295091
742 Ga0495594_0039700
743 Ga0495596_0022838
744 Ga0495607_0010319
745 Ga0495607_0017594
746 Ga0495607_0045178
747 Ga0495607_0051325
748 Ga0495607_0066114
749 Ga0495607_0223172
750 Ga0495607_0302588
751 Ga0495583_0000097
752 Ga0495583_0000191
753 Ga0495583_0002041
754 Ga0495583_0016880
755 Ga0495583_0018230
756 Ga0495583_0074081
757 Ga0495606_0001913
758 Ga0495606_0041291
759 Ga0495606_0048674
760 Ga0495610_0000274
761 Ga0495610_0008960
762 Ga0495610_0009767
763 Ga0495610_0021111
764 Ga0495610_0027303
765 Ga0495616_0008430
766 Ga0495616_0009729
767 Ga0495616_0051291
768 Ga0495616_0053523
769 Ga0495620_0018295
770 Ga0495630_0052013
771 Ga0495630_0140327
772 Ga0495631_0000211
773 Ga0495631_0002161
774 Ga0495631_0007179
775 Ga0495631_0010448
776 Ga0495631_0011881
777 Ga0495632_0009195
778 Ga0495632_0017835
779 Ga0495632_0068325
780 Ga0495632_0087073
781 Ga0495632_0170358
782 Ga0495637_0000536
783 Ga0495637_0005647
784 Ga0495637_0028312
785 Ga0495637_0066972
786 Ga0495637_0113836
787 Ga0495643_0010659
788 Ga0495643_0080012
789 Ga0495643_0228892
790 Ga0495644_0006205
791 Ga0495644_0161553
792 Ga0495648_0001202
793 Ga0495648_0002140
794 Ga0495648_0005909
795 Ga0495648_0010477
796 Ga0495648_0025120
797 Ga0495648_0047928
798 Ga0495648_0054064
799 Ga0495648_0100339
800 Ga0495666_0010128
801 Ga0495666_0015563
802 Ga0495642_0000168
803 Ga0495642_0005337
804 Ga0495654_0006937
805 Ga0495654_0010011
806 Ga0495654_0012700
807 Ga0495654_0094227
808 Ga0495654_0107190
809 Ga0495654_0156568
810 Ga0495586_0020201
811 Ga0495609_0000057
812 Ga0495609_0001418
813 Ga0495609_0025748
814 Ga0495609_0151954
815 Ga0495597_0000108
816 Ga0495597_0007935
817 Ga0495597_0034230
818 Ga0495597_0068225
819 Ga0495597_0086366
820 Ga0495645_0138396
821 Ga0495622_0001718
822 Ga0495622_0009105
823 Ga0495622_0156421
824 Ga0495622_0279334
825 Ga0495633_0000038
826 Ga0495633_0002023
827 Ga0495633_0002103
828 Ga0495633_0070563
829 Ga0495633_0077207
830 Ga0495656_0047265
831 Ga0495668_0018996
832 Ga0495668_0067180
833 Ga0495634_0185973
834 Ga0495611_0000597
835 Ga0495611_0006442
836 Ga0495611_0007119
837 Ga0495625_0003606
838 Ga0495625_0060274
839 Ga0495625_0146538
840 Ga0495635_0001539
841 Ga0495661_0000079
842 Ga0495661_0015447
843 Ga0495661_0018214
844 Ga0495661_0159463
845 Ga0495588_0060383
846 Ga0495588_0076237
847 Ga0495588_0114285
848 Ga0495588_0213692
849 Ga0495657_0040924
850 Ga0495623_0004030
851 Ga0495646_0030560
852 Ga0495669_0013251
853 Ga0495669_0026285
854 Ga0495613_0028280
855 Ga0495670_0004229
856 Ga0495670_0026625
857 Ga0495670_0084009
858 Ga0495671_0030864
859 Ga0495671_0034513
860 Ga0495671_0100223
861 Ga0495671_0109258
862 Ga0495671_0110458
863 Ga0495649_0000093
864 Ga0495649_0002108
865 Ga0495649_0006614
866 Ga0495649_0010505
867 Ga0495649_0030073
868 Ga0495649_0094392
869 Ga0495649_0229910
870 Ga0495589_0001765
871 Ga0495589_0002828
872 Ga0495589_0003855
873 Ga0495589_0011980
874 Ga0495589_0036125
875 Ga0495600_0046754
876 Ga0495660_0001792
877 Ga0495660_0005320
878 Ga0495660_0021370
879 Ga0495660_0030423
880 Ga0495660_0056044
881 Ga0495660_0057250
882 Ga0495660_0119852
883 Ga0495581_0039744
884 Ga0495604_0026574
885 Ga0495604_0069101
886 Ga0495672_0000217
887 Ga0495672_0004202
888 Ga0495672_0008545
889 Ga0495672_0014534
890 Ga0495672_0147425
891 Ga0495680_0003309
892 Ga0495680_0206011
893 Ga0495683_0000032
894 Ga0495683_0000662
895 Ga0495683_0001378
896 Ga0495683_0127750
897 Ga0495687_000468
898 Ga0495687_002332
899 Ga0495675_0000933
900 Ga0495677_0000211
901 Ga0495677_0000772
902 Ga0495677_0007786
903 Ga0495679_001335
904 Ga0495679_003191
905 Ga0495679_008539
906 Ga0495679_074569
907 Ga0495685_055863
908 Ga0495673_0000975
909 Ga0495673_0006595
910 Ga0495673_0022922
911 Ga0495673_0034498
912 Ga0495681_0006548
913 Ga0495681_0007492
914 Ga0495681_0014079
915 Ga0495681_0020473
916 Ga0495681_0039984
917 Ga0495681_0206769
918 Ga0495684_0045614
919 Ga0495686_0000142
920 Ga0495686_0003700
921 Ga0495686_0016273
922 Ga0495686_0171739
923 Ga0495686_0246179
924 Ga0495593_0032936
925 Ga0495593_0050409
926 Ga0495593_0322623
927 Ga0495602_0044983
928 Ga0495602_0636111
929 Ga0495626_0000926
930 Ga0495626_0012303
931 Ga0495626_0012686
932 Ga0495626_0033244
933 Ga0495626_0044961
934 Ga0495626_0070706
935 Ga0496111_0605180
936 Ga0496115_0313893
937 Ga0496115_0611820
938 Ga0496117_0159330
939 Ga0496118_0119980
940 Ga0496121_0010810
941 Ga0496121_0036203
942 Ga0496124_0001925
943 Ga0496124_0037743
944 Ga0496124_0079587
945 Ga0496124_0094995
946 Ga0496124_0168081
947 Ga0496125_0012503
948 Ga0496125_0018741
949 Ga0495678_000163
950 Ga0495678_008016
951 Ga0495682_0011711
952 Ga0495682_0016431
953 Ga0495682_0018734
954 Ga0495682_0060369
955 Ga0495682_0066687
956 Ga0501298_006264
957 Ga0501209_051711
958 Ga0501223_035671
959 Ga0501235_011995
960 Ga0501225_0004952
961 Ga0501083_0573300
962 Ga0501269_019829
963 Ga0501226_001463
964 nmdc:mga03683_122573_c1
965 nmdc:mga03683_22678_c1
966 nmdc:mga03683_87125_c1
967 nmdc:mga00v17_136651_c1
968 nmdc:mga00v17_160810_c1
969 nmdc:mga00v17_65687_c1
970 nmdc:mga07m45_262675_c1
971 nmdc:mga05p37_6901_c1
972 nmdc:mga09592_4077_c1
973 nmdc:mga06r32_134084_c1
974 nmdc:mga06r32_84134_c1
975 nmdc:mga0n895_109739_c1
976 nmdc:mga0rr50_115959_c1
977 nmdc:mga08x19_122274_c1
978 nmdc:mga08x19_233117_c1
979 nmdc:mga0a205_271991_c1
980 nmdc:mga0a205_285592_c1
981 nmdc:mga0a205_51700_c1
982 2599888430
983 2599900324
984 2599961664
985 2600004637
986 2600018864
987 2600055120
988 2600071543
989 2644189676
990 2671092554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

103

195

0.96

PF13649

Methyltransf_25

Methyltransferase domain

102

191

0.96

PF08242

Methyltransf_12

Methyltransferase domain

103

193

0.91

PF13847

Methyltransf_31

Methyltransferase domain

98

222

0.9

PF13489

Methyltransf_23

Methyltransferase domain

75

234

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e23-assembly1.cif.gz_A crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299 0.8637 13 208
2ex4-assembly1.cif.gz_B crystal structure of human methyltransferase ad-003 in complex with s-adenosyl-l-homocysteine 0.8449 6 206
1tpy-assembly1.cif.gz_A structure of the cyclopropane synthase mmaa2 from mycobacterium tuberculosis 0.8367 36 188
3sm3-assembly1.cif.gz_A-2 crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262. 0.8364 43 208
3e23-assembly1.cif.gz_A crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299 0.8346 13 208
ID Description Score Start End Superfamily
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8678 52 160 3.40.50.150
af_A0A144A060_258_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8639 52 115 3.40.50.150
3e23A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.859 13 208 3.40.50.150
af_D3ZQ63_181_335_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.859 54 178 3.40.50.150
af_A0A1D6HKL4_97_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8579 39 155 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1B5DT66-F1-model_v4 Trans-aconitate 2-methyltransferase 1.001 1 207 GO:0008168
GO:0032259
AF-A0A3M6I8Y5-F1-model_v4 Ubiquinone/menaquinone biosynthesis methyltransferase ubie 1.001 44 207 GO:0008168
GO:0032259
AF-A0A7W8TYD7-F1-model_v4 deleted 0.9988 1 209
AF-A0A6I1VMB8-F1-model_v4 Methyltransferase domain-containing protein 0.9987 1 209 GO:0008168
GO:0032259
AF-A0A1J5C5P9-F1-model_v4 SAM-dependent methyltransferase 0.9971 1 209 GO:0008168
GO:0032259

Map