F454724

General Info

Members Datasets Scaffolds Average Seq Length
495 276 494 290

Family's Representative Sequence

Representative Sequence 3300020075|Ga0206349_1440927|Ga0206349_14409272
Length 337
Sequence MATQTRYAPDRGLTVRMTATMFLLGLVFVIILVALIFGGGSAFVSLFYSDKIALAAAGAREVSPKEAPELHGIVDRLCALADMDKPRVAIAPAMMPNAFATGRNSKNSVLCVTDGLLYHSGLTQEELEGVLAHELSHVAHKDVQVMTIASLLAIVAGLLVRFAFYSELFGASAVVYAISFLLIRLLSRYRELAADRSGAMLTQNPSALISALTKVSKGMNRIPTQDLRAAEPLNAFYFAPAMKLSGGASLSAVFSTHPSLEKRIAQLSKIQRELGQPGADPRGIRYWASSTRSSPSLTTCSGSRRPRSSWRRRQASSPRAPCSPWTTASRAAACLSR

Samples

Sample ID Description Type Environment
1 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.28
Metatranscriptomes 11.52
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.65
Rhizosphere 91.52
Stem 0
Stem Tuber 0
Unclassified 3.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010913 3300001989 Bacteria 3360
2 JGI24739J22299_10033568 3300001989 Bacteria 1754
3 rootH2_10098903 3300003320 Bacteria 2100
4 JGI25404J52841_10001562 3300003659 Bacteria 4070
5 Ga0058859_11732587 3300004798 Bacteria 1563
6 Ga0058863_10129332 3300004799 Bacteria 2331
7 Ga0058860_12247198 3300004801 Bacteria 1544
8 Ga0070658_10000108 3300005327 Bacteria 73704
9 Ga0070658_10000342 3300005327 Bacteria 40341
10 Ga0070658_10004706 3300005327 Bacteria 11092
11 Ga0070658_10032228 3300005327 Bacteria 4213
12 Ga0070658_10196518 3300005327 Bacteria 1701
13 Ga0070683_100050455 3300005329 Bacteria 3852
14 Ga0070683_100153033 3300005329 Bacteria 2187
15 Ga0070683_100308692 3300005329 Bacteria 1505
16 Ga0070666_10028984 3300005335 Bacteria 3637
17 Ga0070680_100001460 3300005336 Bacteria 17136
18 Ga0070680_100043094 3300005336 Bacteria 3664
19 Ga0070680_100046675 3300005336 Bacteria 3525
20 Ga0070680_100109385 3300005336 Bacteria 2300
21 Ga0068868_100087677 3300005338 Bacteria 2503
22 Ga0070660_100044226 3300005339 Bacteria 3405
23 Ga0070660_100068016 3300005339 Bacteria 2776
24 Ga0070689_100065769 3300005340 Bacteria 2824
25 Ga0070687_100079025 3300005343 Bacteria 1789
26 Ga0070661_100080768 3300005344 Bacteria 2400
27 Ga0070661_100117256 3300005344 Bacteria 1992
28 Ga0070692_10051706 3300005345 Bacteria 2138
29 Ga0070668_100108777 3300005347 Bacteria 2205
30 Ga0070669_100162162 3300005353 Bacteria 1738
31 Ga0070675_100025930 3300005354 Bacteria 4701
32 Ga0070671_100092252 3300005355 Bacteria 2537
33 Ga0070674_100054858 3300005356 Bacteria 2758
34 Ga0070688_100071033 3300005365 Bacteria 2228
35 Ga0070667_100038678 3300005367 Bacteria 4000
36 Ga0070709_10000730 3300005434 Bacteria 18584
37 Ga0070709_10087093 3300005434 Bacteria 2051
38 Ga0070714_100001418 3300005435 Bacteria 17401
39 Ga0070714_100002728 3300005435 Bacteria 13016
40 Ga0070714_100017374 3300005435 Bacteria 5827
41 Ga0070714_100148542 3300005435 Bacteria 2110
42 Ga0070714_100235424 3300005435 Bacteria 1688
43 Ga0070714_100271945 3300005435 Bacteria 1571
44 Ga0070714_100502295 3300005435 Bacteria 1157
45 Ga0070713_100001109 3300005436 Bacteria 17148
46 Ga0070713_100117803 3300005436 Bacteria 2324
47 Ga0070713_100229113 3300005436 Bacteria 1688
48 Ga0070710_10000747 3300005437 Bacteria 15479
49 Ga0070710_10064946 3300005437 Bacteria 2089
50 Ga0070711_100000258 3300005439 Bacteria 27048
51 Ga0070711_100019173 3300005439 Bacteria 4384
52 Ga0070711_100058287 3300005439 Bacteria 2677
53 Ga0070705_100035576 3300005440 Bacteria 2793
54 Ga0070708_100000965 3300005445 Bacteria 21868
55 Ga0070708_100037646 3300005445 Bacteria 4222
56 Ga0070663_100060264 3300005455 Bacteria 2729
57 Ga0070678_100116393 3300005456 Bacteria 2100
58 Ga0070662_100065088 3300005457 Bacteria 2671
59 Ga0070681_10001628 3300005458 Bacteria 20013
60 Ga0070681_10040214 3300005458 Bacteria 4687
61 Ga0070681_10069226 3300005458 Bacteria 3496
62 Ga0070685_10021215 3300005466 Bacteria 3529
63 Ga0070706_100002011 3300005467 Bacteria 20876
64 Ga0070706_100009310 3300005467 Bacteria 9152
65 Ga0070706_100051618 3300005467 Bacteria 3796
66 Ga0070706_100116969 3300005467 Bacteria 2483
67 Ga0070706_100297305 3300005467 Bacteria 1506
68 Ga0070706_100537313 3300005467 Bacteria 1087
69 Ga0070707_100004535 3300005468 Bacteria 13002
70 Ga0070707_100078538 3300005468 Bacteria 3184
71 Ga0070707_100396357 3300005468 Bacteria 1340
72 Ga0070707_100551720 3300005468 Bacteria 1114
73 Ga0070698_100000873 3300005471 Bacteria 33116
74 Ga0070698_100001007 3300005471 Bacteria 30987
75 Ga0070698_100001377 3300005471 Bacteria 26968
76 Ga0070679_100002684 3300005530 Bacteria 16206
77 Ga0070679_100012806 3300005530 Bacteria 8025
78 Ga0070679_100029381 3300005530 Bacteria 5423
79 Ga0070679_100037400 3300005530 Bacteria 4821
80 Ga0070684_100053102 3300005535 Bacteria 3526
81 Ga0070672_100031823 3300005543 Bacteria 3975
82 Ga0070693_100062953 3300005547 Bacteria 2160
83 Ga0070665_100065650 3300005548 Bacteria 3640
84 Ga0070704_100034422 3300005549 Bacteria 3435
85 Ga0068855_100007431 3300005563 Bacteria 13267
86 Ga0068855_100017156 3300005563 Bacteria 8710
87 Ga0068855_100189540 3300005563 Bacteria 2321
88 Ga0068855_100627992 3300005563 Bacteria 1156
89 Ga0070664_100079660 3300005564 Bacteria 2820
90 Ga0068857_100518037 3300005577 Bacteria 1120
91 Ga0068854_100006361 3300005578 Bacteria 7512
92 Ga0068854_100178249 3300005578 Bacteria 1658
93 Ga0068856_100015342 3300005614 Bacteria 7404
94 Ga0068856_100176186 3300005614 Bacteria 2151
95 Ga0070702_100038952 3300005615 Bacteria 2650
96 Ga0068852_100007902 3300005616 Bacteria 7792
97 Ga0068859_100143263 3300005617 Bacteria 2463
98 Ga0068864_100014396 3300005618 Bacteria 6569
99 Ga0068864_100024739 3300005618 Bacteria 5052
100 Ga0068858_100029276 3300005842 Bacteria 5113
101 Ga0068860_100055661 3300005843 Bacteria 3761
102 Ga0068862_100059655 3300005844 Bacteria 3277
103 Ga0081540_1000134 3300005983 Bacteria 79126
104 Ga0070717_10005146 3300006028 Bacteria 9534
105 Ga0070717_10011131 3300006028 Bacteria 6817
106 Ga0070717_10050238 3300006028 Bacteria 3426
107 Ga0070717_10092936 3300006028 Bacteria 2549
108 Ga0070717_10474984 3300006028 Bacteria 1129
109 Ga0075432_10015854 3300006058 Bacteria 2572
110 Ga0070715_10054548 3300006163 Bacteria 1731
111 Ga0070716_100000222 3300006173 Bacteria 22754
112 Ga0070716_100006177 3300006173 Bacteria 5848
113 Ga0070716_100020861 3300006173 Bacteria 3445
114 Ga0070716_100027978 3300006173 Bacteria 3034
115 Ga0070716_100060605 3300006173 Bacteria 2186
116 Ga0070716_100102093 3300006173 Bacteria 1760
117 Ga0070712_100002878 3300006175 Bacteria 10665
118 Ga0070712_100034455 3300006175 Bacteria 3431
119 Ga0070712_100074824 3300006175 Bacteria 2434
120 Ga0097621_100035115 3300006237 Bacteria 4004
121 Ga0068871_100041750 3300006358 Bacteria 3679
122 Ga0068871_100167932 3300006358 Bacteria 1879
123 Ga0075428_100019148 3300006844 Bacteria 7571
124 Ga0075433_10004694 3300006852 Bacteria 10645
125 Ga0097620_100143244 3300006931 Bacteria 2463
126 Ga0075435_100044365 3300007076 Bacteria 3561
127 Ga0105244_10035853 3300009036 Bacteria 2603
128 Ga0105240_10005320 3300009093 Bacteria 19204
129 Ga0105240_10084936 3300009093 Bacteria 3880
130 Ga0111539_10194655 3300009094 Bacteria 2365
131 Ga0105245_10033622 3300009098 Bacteria 4546
132 Ga0114129_10005268 3300009147 Bacteria 18236
133 Ga0105243_10072682 3300009148 Bacteria 2785
134 Ga0105241_10013190 3300009174 Bacteria 6061
135 Ga0105241_10113546 3300009174 Bacteria 2172
136 Ga0105248_10025759 3300009177 Bacteria 6542
137 Ga0105237_10018224 3300009545 Bacteria 7264
138 Ga0105237_10294998 3300009545 Bacteria 1624
139 Ga0105238_10090280 3300009551 Bacteria 3051
140 Ga0105239_10008718 3300010375 Bacteria 11480
141 Ga0105239_10267009 3300010375 Bacteria 1924
142 Ga0157371_10043952 3300013102 Bacteria 3182
143 Ga0157369_10015418 3300013105 Bacteria 8613
144 Ga0157369_10065520 3300013105 Bacteria 3910
145 Ga0157369_10069779 3300013105 Bacteria 3775
146 Ga0157369_10425017 3300013105 Bacteria 1377
147 Ga0157374_10011887 3300013296 Bacteria 7553
148 Ga0163162_10015159 3300013306 Bacteria 7528
149 Ga0157372_10038454 3300013307 Bacteria 5280
150 Ga0157372_10307956 3300013307 Bacteria 1843
151 Ga0163163_10009484 3300014325 Bacteria 8692
152 Ga0163163_10239745 3300014325 Bacteria 1863
153 Ga0157380_10137701 3300014326 Bacteria 2092
154 Ga0157379_10001675 3300014968 Bacteria 18320
155 Ga0157376_10003702 3300014969 Bacteria 10561
156 Ga0163161_10079115 3300017792 Bacteria 2417
157 Ga0184601_125904 3300019183 Bacteria 1396
158 Ga0184603_125190 3300019192 Bacteria 3847
159 Ga0197907_11185792 3300020069 Bacteria 3934
160 Ga0197907_11323763 3300020069 Bacteria 5353
161 Ga0206356_10039243 3300020070 Bacteria 6025
162 Ga0206356_10155563 3300020070 Bacteria 3840
163 Ga0206356_10466239 3300020070 Bacteria 2097
164 Ga0206356_11766282 3300020070 Bacteria 1127
165 Ga0206349_1031490 3300020075 Bacteria 2590
166 Ga0206349_1196369 3300020075 Bacteria 2384
167 Ga0206349_1440927 3300020075 Bacteria 1709
168 Ga0206355_1154318 3300020076 Bacteria 3713
169 Ga0206351_10069119 3300020077 Bacteria 4689
170 Ga0206351_10677736 3300020077 Bacteria 2821
171 Ga0206351_10697985 3300020077 Bacteria 1220
172 Ga0206351_10852899 3300020077 Bacteria 4279
173 Ga0206352_10406707 3300020078 Bacteria 1445
174 Ga0206352_10883012 3300020078 Bacteria 2029
175 Ga0206350_10002456 3300020080 Bacteria 2105
176 Ga0206350_10244279 3300020080 Bacteria 1801
177 Ga0206350_11022604 3300020080 Bacteria 2563
178 Ga0206350_11036766 3300020080 Bacteria 4727
179 Ga0206350_11604676 3300020080 Bacteria 2611
180 Ga0206354_10960839 3300020081 Bacteria 4656
181 Ga0206354_11029550 3300020081 Bacteria 2274
182 Ga0206353_10836602 3300020082 Bacteria 20040
183 Ga0154015_1066679 3300020610 Bacteria 2915
184 Ga0213874_10042386 3300021377 Bacteria 1367
185 Ga0213875_10033071 3300021388 Bacteria 2442
186 Ga0213875_10039817 3300021388 Bacteria 2214
187 Ga0224712_10003796 3300022467 Bacteria 3985
188 Ga0224712_10006484 3300022467 Bacteria 3341
189 Ga0224712_10011651 3300022467 Bacteria 2736
190 Ga0224712_10013831 3300022467 Bacteria 2582
191 Ga0224712_10016527 3300022467 Bacteria 2427
192 Ga0224712_10018943 3300022467 Bacteria 2311
193 Ga0224712_10019956 3300022467 Bacteria 2268
194 Ga0224712_10022654 3300022467 Bacteria 2168
195 Ga0224712_10026621 3300022467 Bacteria 2047
196 Ga0224712_10053006 3300022467 Bacteria 1586
197 Ga0224712_10103175 3300022467 Bacteria 1213
198 Ga0224572_1016075 3300024225 Bacteria 1434
199 Ga0207653_10012142 3300025885 Bacteria 2689
200 Ga0207692_10001841 3300025898 Bacteria 8055
201 Ga0207692_10001938 3300025898 Bacteria 7885
202 Ga0207688_10012880 3300025901 Bacteria 4546
203 Ga0207647_10013505 3300025904 Bacteria 5656
204 Ga0207647_10013702 3300025904 Bacteria 5614
205 Ga0207647_10035051 3300025904 Bacteria 3200
206 Ga0207647_10088176 3300025904 Bacteria 1853
207 Ga0207685_10011476 3300025905 Bacteria 2665
208 Ga0207699_10000105 3300025906 Bacteria 59026
209 Ga0207699_10005069 3300025906 Bacteria 6302
210 Ga0207699_10083896 3300025906 Bacteria 1983
211 Ga0207699_10116594 3300025906 Bacteria 1720
212 Ga0207643_10016854 3300025908 Bacteria 3985
213 Ga0207705_10000394 3300025909 Bacteria 38574
214 Ga0207705_10000597 3300025909 Bacteria 30220
215 Ga0207705_10001806 3300025909 Bacteria 16878
216 Ga0207705_10086942 3300025909 Bacteria 2285
217 Ga0207705_10098270 3300025909 Bacteria 2151
218 Ga0207705_10198408 3300025909 Bacteria 1520
219 Ga0207684_10003525 3300025910 Bacteria 15250
220 Ga0207684_10037605 3300025910 Bacteria 4107
221 Ga0207684_10042959 3300025910 Bacteria 3832
222 Ga0207654_10013416 3300025911 Bacteria 4216
223 Ga0207707_10000983 3300025912 Bacteria 27372
224 Ga0207707_10033803 3300025912 Bacteria 4475
225 Ga0207707_10079568 3300025912 Bacteria 2862
226 Ga0207707_10213989 3300025912 Bacteria 1678
227 Ga0207695_10001690 3300025913 Bacteria 35457
228 Ga0207671_10000619 3300025914 Bacteria 46850
229 Ga0207671_10174289 3300025914 Bacteria 1671
230 Ga0207693_10001586 3300025915 Bacteria 20116
231 Ga0207693_10006056 3300025915 Bacteria 10018
232 Ga0207693_10104250 3300025915 Bacteria 2224
233 Ga0207693_10370683 3300025915 Bacteria 1120
234 Ga0207663_10046843 3300025916 Bacteria 2666
235 Ga0207663_10071671 3300025916 Bacteria 2237
236 Ga0207663_10229975 3300025916 Bacteria 1354
237 Ga0207660_10000164 3300025917 Bacteria 41667
238 Ga0207660_10030998 3300025917 Bacteria 3679
239 Ga0207662_10019958 3300025918 Bacteria 3819
240 Ga0207657_10015156 3300025919 Bacteria 7486
241 Ga0207657_10043479 3300025919 Bacteria 3956
242 Ga0207657_10095542 3300025919 Bacteria 2473
243 Ga0207657_10125928 3300025919 Bacteria 2104
244 Ga0207649_10026680 3300025920 Bacteria 3381
245 Ga0207652_10000702 3300025921 Bacteria 32441
246 Ga0207652_10011619 3300025921 Bacteria 7104
247 Ga0207652_10034465 3300025921 Bacteria 4266
248 Ga0207652_10061120 3300025921 Bacteria 3252
249 Ga0207646_10002744 3300025922 Bacteria 20579
250 Ga0207646_10119222 3300025922 Bacteria 2370
251 Ga0207646_10458932 3300025922 Bacteria 1149
252 Ga0207694_10002705 3300025924 Bacteria 14351
253 Ga0207659_10127182 3300025926 Bacteria 1961
254 Ga0207687_10094207 3300025927 Bacteria 2191
255 Ga0207700_10000050 3300025928 Bacteria 79672
256 Ga0207700_10011699 3300025928 Bacteria 5611
257 Ga0207700_10013214 3300025928 Bacteria 5362
258 Ga0207700_10050343 3300025928 Bacteria 3104
259 Ga0207700_10210551 3300025928 Bacteria 1643
260 Ga0207664_10000101 3300025929 Bacteria 79541
261 Ga0207664_10000914 3300025929 Bacteria 19899
262 Ga0207664_10001623 3300025929 Bacteria 14799
263 Ga0207664_10005715 3300025929 Bacteria 8502
264 Ga0207664_10040805 3300025929 Bacteria 3612
265 Ga0207664_10044397 3300025929 Bacteria 3480
266 Ga0207664_10139150 3300025929 Bacteria 2051
267 Ga0207664_10179605 3300025929 Bacteria 1816
268 Ga0207664_10441137 3300025929 Bacteria 1161
269 Ga0207690_10224890 3300025932 Bacteria 1438
270 Ga0207706_10045392 3300025933 Bacteria 3893
271 Ga0207709_10088663 3300025935 Bacteria 2015
272 Ga0207669_10048334 3300025937 Bacteria 2527
273 Ga0207704_10162396 3300025938 Bacteria 1591
274 Ga0207665_10000438 3300025939 Bacteria 28608
275 Ga0207665_10004634 3300025939 Bacteria 9130
276 Ga0207665_10004822 3300025939 Bacteria 8976
277 Ga0207665_10005172 3300025939 Bacteria 8712
278 Ga0207665_10083238 3300025939 Bacteria 2206
279 Ga0207665_10120555 3300025939 Bacteria 1852
280 Ga0207691_10010556 3300025940 Bacteria 8861
281 Ga0207689_10005438 3300025942 Bacteria 11399
282 Ga0207661_10228934 3300025944 Bacteria 1645
283 Ga0207667_10011183 3300025949 Bacteria 10447
284 Ga0207667_10117428 3300025949 Bacteria 2742
285 Ga0207667_10283875 3300025949 Bacteria 1691
286 Ga0207667_10554711 3300025949 Bacteria 1162
287 Ga0207712_10205816 3300025961 Bacteria 1564
288 Ga0207668_10042538 3300025972 Bacteria 3078
289 Ga0207640_10003813 3300025981 Bacteria 8128
290 Ga0207658_10251881 3300025986 Bacteria 1501
291 Ga0207703_10018498 3300026035 Bacteria 5440
292 Ga0207703_10051994 3300026035 Bacteria 3324
293 Ga0207639_10045770 3300026041 Bacteria 3298
294 Ga0207678_10003714 3300026067 Bacteria 13726
295 Ga0207678_10012193 3300026067 Bacteria 7549
296 Ga0207708_10006954 3300026075 Bacteria 8369
297 Ga0207702_10022216 3300026078 Bacteria 5259
298 Ga0207702_10073873 3300026078 Bacteria 2941
299 Ga0207676_10080475 3300026095 Bacteria 2644
300 Ga0207674_10010202 3300026116 Bacteria 10668
301 Ga0207674_10056090 3300026116 Bacteria 4002
302 Ga0207675_100027441 3300026118 Bacteria 5303
303 Ga0207683_10010628 3300026121 Bacteria 7850
304 Ga0207698_10061370 3300026142 Bacteria 2929
305 Ga0207698_10114194 3300026142 Bacteria 2271
306 Ga0207428_10013659 3300027907 Bacteria 7084
307 Ga0268266_10050358 3300028379 Bacteria 3574
308 Ga0268266_10125797 3300028379 Bacteria 2287
309 Ga0268266_10300569 3300028379 Bacteria 1497
310 Ga0268265_10238836 3300028380 Bacteria 1602
311 Ga0268264_10067372 3300028381 Bacteria 3022
312 Ga0265337_1000373 3300028556 Bacteria 24057
313 Ga0265336_10023060 3300028666 Bacteria 1977
314 Ga0307517_10213195 3300028786 Bacteria 1186
315 Ga0265338_10000551 3300028800 Bacteria 65599
316 Ga0265338_10005567 3300028800 Bacteria 16386
317 Ga0265338_10006545 3300028800 Bacteria 14804
318 Ga0265338_10228510 3300028800 Bacteria 1385
319 Ga0265763_1000078 3300030763 Bacteria 4230
320 Ga0265766_1000756 3300030863 Bacteria 1465
321 Ga0265764_100145 3300030882 Bacteria 2235
322 Ga0265769_100062 3300030888 Bacteria 2886
323 Ga0265779_100587 3300031043 Bacteria 1405
324 Ga0265325_10043778 3300031241 Bacteria 2334
325 Ga0265340_10005572 3300031247 Bacteria 6984
326 Ga0307513_10396744 3300031456 Bacteria 1115
327 Ga0316212_1003717 3300033547 Bacteria 2209
328 Ga0373938_0007985 3300034957 Bacteria 1879
329 Ga0373926_0000521 3300035083 Bacteria 10259
330 Ga0373926_0009765 3300035083 Bacteria 3207
331 Ga0373928_0014196 3300035084 Bacteria 1607
332 Ga0373934_0121123 3300035086 Bacteria 1064
333 Ga0373944_0001030 3300035089 Bacteria 6892
334 Ga0373944_0015391 3300035089 Bacteria 2146
335 Ga0373951_0008653 3300035091 Bacteria 2294
336 Ga0373923_0165885 3300035111 Bacteria 1009
337 Ga0373936_0002035 3300035113 Bacteria 7483
338 Ga0373945_0000661 3300035116 Bacteria 9973
339 Ga0373953_0041645 3300035117 Bacteria 1828
340 Ga0373954_0082891 3300035118 Bacteria 1534
341 Ga0373943_0000196 3300035170 Bacteria 24602
342 Ga0373946_0000087 3300035171 Bacteria 25768
343 Ga0373946_0072371 3300035171 Bacteria 1492
344 Ga0373955_0076376 3300035172 Bacteria 1884
345 Ga0316574_0004885 3300035398 Bacteria 7099
346 Ga0373935_0000156 3300035692 Bacteria 31615
347 Ga0373935_0001541 3300035692 Bacteria 12830
348 Ga0373927_0000769 3300035695 Bacteria 24551
349 Ga0373927_0052896 3300035695 Bacteria 2626
350 Ga0373927_0220970 3300035695 Bacteria 1244
351 Ga0373947_0000002 3300035725 Bacteria 383924
352 Ga0373947_0003276 3300035725 Bacteria 9602
353 Ga0373947_0145505 3300035725 Bacteria 1523
354 Ga0373937_0121546 3300036401 Bacteria 2433
355 Ga0373937_0245837 3300036401 Bacteria 1686
356 Ga0265778_000468 3300036457 Bacteria 3163
357 Ga0265778_008040 3300036457 Bacteria 1167
358 Ga0373925_0000157 3300037068 Bacteria 72993
359 Ga0373925_0016247 3300037068 Bacteria 5387
360 Ga0373925_0113885 3300037068 Bacteria 2092
361 Ga0395900_0089555 3300037418 Bacteria 3163
362 Ga0395898_0060914 3300037466 Bacteria 3667
363 Ga0436364_0398528 3300037853 Bacteria 3500
364 Ga0436364_0765310 3300037853 Bacteria 4891
365 Ga0436364_1412967 3300037853 Bacteria 4254
366 Ga0395901_0183782 3300038443 Bacteria 2193
367 Ga0436365_1064228 3300039437 Bacteria 1165
368 Ga0436365_1085450 3300039437 Bacteria 1624
369 Ga0436361_0396973 3300039447 Bacteria 2091
370 Ga0436363_1387926 3300039450 Bacteria 1205
371 Ga0436363_1397682 3300039450 Bacteria 1503
372 Ga0466969_0048136 3300044656 Bacteria 2108
373 Ga0466966_0056957 3300044684 Bacteria 2471
374 Ga0466966_0062756 3300044684 Bacteria 2342
375 Ga0466966_0067090 3300044684 Bacteria 2254
376 Ga0466961_0011630 3300044693 Bacteria 5625
377 Ga0466961_0025159 3300044693 Bacteria 3830
378 Ga0466961_0029022 3300044693 Bacteria 3557
379 Ga0466961_0053152 3300044693 Bacteria 2585
380 Ga0466970_0024887 3300044765 Bacteria 3131
381 Ga0466959_0043568 3300045049 Bacteria 3308
382 Ga0466959_0091953 3300045049 Bacteria 2178
383 Ga0466967_0071658 3300045976 Bacteria 3104
384 Ga0466967_0295678 3300045976 Bacteria 1557
385 Ga0495627_039445 3300046453 Bacteria 1457
386 Ga0495592_0009319 3300046454 Bacteria 7384
387 Ga0495629_0017371 3300046459 Bacteria 5156
388 Ga0495629_0164241 3300046459 Bacteria 1542
389 Ga0495641_0019491 3300046461 Bacteria 3468
390 Ga0495651_0028321 3300046462 Bacteria 4366
391 Ga0495653_0036149 3300046463 Bacteria 3892
392 Ga0495582_0015398 3300046473 Bacteria 4201
393 Ga0495662_0016489 3300046476 Bacteria 3577
394 Ga0495662_0071917 3300046476 Bacteria 1676
395 Ga0495664_0001258 3300046477 Bacteria 13274
396 Ga0495664_0060507 3300046477 Bacteria 2254
397 Ga0495664_0101527 3300046477 Bacteria 1733
398 Ga0495594_0101794 3300046499 Bacteria 1616
399 Ga0495618_0031817 3300046514 Bacteria 3303
400 Ga0495630_0146762 3300046517 Bacteria 1794
401 Ga0495630_0169011 3300046517 Bacteria 1665
402 Ga0495630_0388216 3300046517 Bacteria 1069
403 Ga0495652_0121486 3300046529 Bacteria 2082
404 Ga0495652_0130947 3300046529 Bacteria 1986
405 Ga0495665_0026429 3300046531 Bacteria 3117
406 Ga0495665_0062716 3300046531 Bacteria 1962
407 Ga0495640_0043411 3300046533 Bacteria 3131
408 Ga0495587_0002850 3300046536 Bacteria 11583
409 Ga0495587_0130722 3300046536 Bacteria 1435
410 Ga0495645_0083199 3300046543 Bacteria 2294
411 Ga0495645_0120957 3300046543 Bacteria 1843
412 Ga0495667_0043387 3300046559 Bacteria 2980
413 Ga0495635_0017678 3300046663 Bacteria 4979
414 Ga0495635_0080946 3300046663 Bacteria 2222
415 Ga0495657_0024109 3300046675 Bacteria 4338
416 Ga0495657_0034081 3300046675 Bacteria 3539
417 Ga0495599_0130122 3300046678 Bacteria 1563
418 Ga0495646_0114876 3300046680 Bacteria 1529
419 Ga0495646_0144311 3300046680 Bacteria 1328
420 Ga0495613_0167578 3300046689 Bacteria 1560
421 Ga0495624_0006705 3300046690 Bacteria 8135
422 Ga0495624_0021741 3300046690 Bacteria 4250
423 Ga0495604_0037228 3300047317 Bacteria 3832
424 Ga0495674_0008702 3300047319 Bacteria 9654
425 Ga0495674_0041734 3300047319 Bacteria 4096
426 Ga0495676_0023855 3300047321 Bacteria 5301
427 Ga0495680_0036485 3300047322 Bacteria 3945
428 Ga0495684_0052045 3300047471 Bacteria 3124
429 Ga0495684_0142020 3300047471 Bacteria 1800
430 Ga0495684_0171839 3300047471 Bacteria 1611
431 Ga0495602_0066372 3300048088 Bacteria 3109
432 Ga0495602_0100156 3300048088 Bacteria 2380
433 Ga0495602_0123242 3300048088 Bacteria 2081
434 Ga0496100_0177114 3300048903 Bacteria 1540
435 Ga0496101_0086585 3300048904 Bacteria 2324
436 Ga0496104_0003397 3300048907 Bacteria 13747
437 Ga0496105_0003685 3300048908 Bacteria 11404
438 Ga0496105_0005144 3300048908 Bacteria 9920
439 Ga0496106_0079158 3300048909 Bacteria 2523
440 Ga0496106_0266549 3300048909 Bacteria 1371
441 Ga0496108_0011471 3300048911 Bacteria 7203
442 Ga0496108_0057256 3300048911 Bacteria 3275
443 Ga0496109_0015830 3300048912 Bacteria 6584
444 Ga0496109_0029692 3300048912 Bacteria 4898
445 Ga0496109_0256657 3300048912 Bacteria 1646
446 Ga0496109_0532442 3300048912 Bacteria 1108
447 Ga0496110_0027420 3300048913 Bacteria 4883
448 Ga0496110_0043235 3300048913 Bacteria 3933
449 Ga0496111_0043869 3300048914 Bacteria 3215
450 Ga0496112_0002182 3300048915 Bacteria 15574
451 Ga0496112_0057654 3300048915 Bacteria 3824
452 Ga0496112_0163551 3300048915 Bacteria 2191
453 Ga0496113_0015259 3300048916 Bacteria 5274
454 Ga0496113_0139725 3300048916 Bacteria 1905
455 Ga0496114_0049174 3300048917 Bacteria 3508
456 Ga0496115_0112278 3300048918 Bacteria 2239
457 Ga0496120_0185470 3300048923 Bacteria 1018
458 Ga0496126_0019004 3300048929 Bacteria 6786
459 Ga0501032_0061960 3300049569 Bacteria 2507
460 Ga0501034_0637812 3300049571 Bacteria 968
461 Ga0501037_0093935 3300049573 Bacteria 2169
462 Ga0501069_0002523 3300049585 Bacteria 9349
463 Ga0501069_0038616 3300049585 Bacteria 2636
464 Ga0501070_0002063 3300049586 Bacteria 17661
465 Ga0501070_0013674 3300049586 Bacteria 6837
466 Ga0501070_0081591 3300049586 Bacteria 2676
467 Ga0501070_0213973 3300049586 Bacteria 1581
468 Ga0501074_0305166 3300049590 Bacteria 1131
469 Ga0501080_0012819 3300049742 Bacteria 7689
470 Ga0501080_0022894 3300049742 Bacteria 5791
471 Ga0501044_0094513 3300049823 Bacteria 3014
472 nmdc:mga05p37_273697_c1 3300050507 Bacteria 2017
473 nmdc:mga08y16_140681_c1 3300050511 Bacteria 2509
474 nmdc:mga0n895_42406_c1 3300050512 Bacteria 4427
475 nmdc:mga08x19_336396_c1 3300050514 Bacteria 1053
476 nmdc:mga0a205_35041_c1 3300050515 Bacteria 4819
477 Ga0495601_0021489 3300053077 Bacteria 3953
478 Ga0495601_0097968 3300053077 Bacteria 1892
479 Ga0495612_0011274 3300053078 Bacteria 3604
480 Ga0495612_0105578 3300053078 Bacteria 1202
481 Ga0495595_0045032 3300053084 Bacteria 2028
482 Ga0495595_0048133 3300053084 Bacteria 1968
483 Ga0495619_0007509 3300053085 Bacteria 6905
484 Ga0495619_0130742 3300053085 Bacteria 1725
485 Ga0495619_0169268 3300053085 Bacteria 1510
486 Ga0587077_010288 3300059493 Bacteria 1443
487 Ga0587077_013252 3300059493 Bacteria 1334
488 Ga0587080_014515 3300059503 Bacteria 1219
489 Ga0587092_011728 3300059512 Bacteria 1224
490 Ga0587122_002013 3300059628 Bacteria 1412
491 Ga0587107_005414 3300059652 Bacteria 1349
492 Ga0587114_004468 3300059655 Bacteria 1460
493 Ga0587071_008214 3300060344 Bacteria 1687
494 Ga0587071_015606 3300060344 Bacteria 1334

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0101794 Ga0495594_0101794_661_1578 237
2 3300048088 Ga0495602_0123242 Ga0495602_0123242_41_958 237
3 3300005535 Ga0070684_100053102 Ga0070684_1000531022 238
4 3300020078 Ga0206352_10406707 Ga0206352_104067072 238
5 3300048914 Ga0496111_0043869 Ga0496111_0043869_2270_3187 238
6 3300053085 Ga0495619_0169268 Ga0495619_0169268_45_962 238
7 3300037068 Ga0373925_0000157 Ga0373925_0000157_47400_48353 243
8 3300035695 Ga0373927_0052896 Ga0373927_0052896_589_1509 247
9 3300035725 Ga0373947_0145505 Ga0373947_0145505_269_1189 247
10 3300037068 Ga0373925_0113885 Ga0373925_0113885_937_1857 247
11 3300037853 Ga0436364_1412967 Ga0436364_1412967_3165_4124 247
12 3300046533 Ga0495640_0043411 Ga0495640_0043411_498_1418 247
13 3300046543 Ga0495645_0083199 Ga0495645_0083199_789_1709 247
14 3300046680 Ga0495646_0144311 Ga0495646_0144311_343_1263 247
15 3300047319 Ga0495674_0041734 Ga0495674_0041734_1736_2656 247
16 3300053077 Ga0495601_0097968 Ga0495601_0097968_481_1401 247
17 3300053078 Ga0495612_0105578 Ga0495612_0105578_56_976 247
18 3300014325 Ga0163163_10239745 Ga0163163_102397452 250
19 3300005440 Ga0070705_100035576 Ga0070705_1000355763 251
20 3300005563 Ga0068855_100189540 Ga0068855_1001895402 251
21 3300005618 Ga0068864_100014396 Ga0068864_1000143968 251
22 3300005842 Ga0068858_100029276 Ga0068858_1000292765 251
23 3300005843 Ga0068860_100055661 Ga0068860_1000556614 251
24 3300006163 Ga0070715_10054548 Ga0070715_100545483 251
25 3300006173 Ga0070716_100102093 Ga0070716_1001020932 251
26 3300006237 Ga0097621_100035115 Ga0097621_1000351152 251
27 3300009098 Ga0105245_10033622 Ga0105245_100336223 251
28 3300009177 Ga0105248_10025759 Ga0105248_100257594 251
29 3300013296 Ga0157374_10011887 Ga0157374_100118872 251
30 3300013306 Ga0163162_10015159 Ga0163162_100151594 251
31 3300014325 Ga0163163_10009484 Ga0163163_100094845 251
32 3300014968 Ga0157379_10001675 Ga0157379_100016754 251
33 3300014969 Ga0157376_10003702 Ga0157376_100037027 251
34 3300025915 Ga0207693_10370683 Ga0207693_103706831 251
35 3300025916 Ga0207663_10229975 Ga0207663_102299752 251
36 3300025927 Ga0207687_10094207 Ga0207687_100942072 251
37 3300025939 Ga0207665_10120555 Ga0207665_101205552 251
38 3300026035 Ga0207703_10018498 Ga0207703_100184985 251
39 3300028379 Ga0268266_10300569 Ga0268266_103005692 251
40 3300028381 Ga0268264_10067372 Ga0268264_100673723 251
41 3300035089 Ga0373944_0015391 Ga0373944_0015391_458_1420 251
42 3300035111 Ga0373923_0165885 Ga0373923_0165885_36_998 251
43 3300035117 Ga0373953_0041645 Ga0373953_0041645_261_1223 251
44 3300035695 Ga0373927_0220970 Ga0373927_0220970_245_1207 251
45 3300046459 Ga0495629_0017371 Ga0495629_0017371_3677_4639 251
46 3300046476 Ga0495662_0016489 Ga0495662_0016489_1755_2717 251
47 3300046517 Ga0495630_0169011 Ga0495630_0169011_435_1397 251
48 3300046680 Ga0495646_0114876 Ga0495646_0114876_331_1293 251
49 3300046689 Ga0495613_0167578 Ga0495613_0167578_586_1548 251
50 3300046690 Ga0495624_0021741 Ga0495624_0021741_3220_4182 251
51 3300047322 Ga0495680_0036485 Ga0495680_0036485_23_985 251
52 3300048908 Ga0496105_0003685 Ga0496105_0003685_4105_5067 251
53 3300048911 Ga0496108_0057256 Ga0496108_0057256_876_1838 251
54 3300048912 Ga0496109_0015830 Ga0496109_0015830_3309_4271 251
55 3300048913 Ga0496110_0027420 Ga0496110_0027420_2433_3395 251
56 3300048915 Ga0496112_0057654 Ga0496112_0057654_1757_2719 251
57 3300048916 Ga0496113_0139725 Ga0496113_0139725_750_1712 251
58 3300053084 Ga0495595_0045032 Ga0495595_0045032_315_1277 251
59 3300006358 Ga0068871_100041750 Ga0068871_1000417502 252
60 3300022467 Ga0224712_10006484 Ga0224712_100064841 252
61 3300025922 Ga0207646_10119222 Ga0207646_101192221 252
62 3300036457 Ga0265778_000468 Ga0265778_000468_741_1700 252
63 3300046454 Ga0495592_0009319 Ga0495592_0009319_5236_6198 252
64 3300046462 Ga0495651_0028321 Ga0495651_0028321_268_1230 252
65 3300046514 Ga0495618_0031817 Ga0495618_0031817_1721_2683 252
66 3300046536 Ga0495587_0002850 Ga0495587_0002850_8789_9751 252
67 3300046663 Ga0495635_0080946 Ga0495635_0080946_800_1762 252
68 3300047317 Ga0495604_0037228 Ga0495604_0037228_2166_3128 252
69 3300025929 Ga0207664_10139150 Ga0207664_101391502 253
70 3300046531 Ga0495665_0062716 Ga0495665_0062716_592_1554 253
71 3300013102 Ga0157371_10043952 Ga0157371_100439523 255
72 3300013105 Ga0157369_10425017 Ga0157369_104250172 255
73 3300049742 Ga0501080_0012819 Ga0501080_0012819_1702_2589 255
74 3300049585 Ga0501069_0002523 Ga0501069_0002523_8225_9106 257
75 3300049742 Ga0501080_0022894 Ga0501080_0022894_2064_2945 257
76 3300005563 Ga0068855_100017156 Ga0068855_1000171567 258
77 3300025949 Ga0207667_10011183 Ga0207667_100111835 258
78 3300009094 Ga0111539_10194655 Ga0111539_101946553 259
79 3300020080 Ga0206350_10244279 Ga0206350_102442792 259
80 3300049569 Ga0501032_0061960 Ga0501032_0061960_92_973 259
81 3300049571 Ga0501034_0637812 Ga0501034_0637812_11_892 259
82 3300049573 Ga0501037_0093935 Ga0501037_0093935_95_976 259
83 3300049586 Ga0501070_0002063 Ga0501070_0002063_11002_11883 259
84 3300049823 Ga0501044_0094513 Ga0501044_0094513_105_986 259
85 3300050507 nmdc:mga05p37_273697_c1 nmdc:mga05p37_273697_c1_181_1092 259
86 3300050511 nmdc:mga08y16_140681_c1 nmdc:mga08y16_140681_c1_1346_2257 259
87 3300050512 nmdc:mga0n895_42406_c1 nmdc:mga0n895_42406_c1_53_964 259
88 3300050514 nmdc:mga08x19_336396_c1 nmdc:mga08x19_336396_c1_90_1001 259
89 3300050515 nmdc:mga0a205_35041_c1 nmdc:mga0a205_35041_c1_687_1598 259
90 3300005329 Ga0070683_100308692 Ga0070683_1003086923 260
91 3300005339 Ga0070660_100068016 Ga0070660_1000680163 260
92 3300005458 Ga0070681_10069226 Ga0070681_100692262 260
93 3300005530 Ga0070679_100037400 Ga0070679_1000374003 260
94 3300005563 Ga0068855_100627992 Ga0068855_1006279922 260
95 3300009174 Ga0105241_10113546 Ga0105241_101135463 260
96 3300022467 Ga0224712_10019956 Ga0224712_100199563 260
97 3300025912 Ga0207707_10079568 Ga0207707_100795685 260
98 3300025919 Ga0207657_10043479 Ga0207657_100434793 260
99 3300025921 Ga0207652_10061120 Ga0207652_100611205 260
100 3300025928 Ga0207700_10210551 Ga0207700_102105512 260
101 3300025929 Ga0207664_10179605 Ga0207664_101796052 260
102 3300025949 Ga0207667_10554711 Ga0207667_105547112 260
103 3300035083 Ga0373926_0009765 Ga0373926_0009765_1841_2830 260
104 3300035089 Ga0373944_0001030 Ga0373944_0001030_3097_4086 260
105 3300035113 Ga0373936_0002035 Ga0373936_0002035_68_1045 260
106 3300035116 Ga0373945_0000661 Ga0373945_0000661_5886_6875 260
107 3300035118 Ga0373954_0082891 Ga0373954_0082891_85_1002 260
108 3300035170 Ga0373943_0000196 Ga0373943_0000196_13432_14421 260
109 3300035171 Ga0373946_0000087 Ga0373946_0000087_7147_8136 260
110 3300035172 Ga0373955_0076376 Ga0373955_0076376_672_1661 260
111 3300035692 Ga0373935_0000156 Ga0373935_0000156_10133_11122 260
112 3300035695 Ga0373927_0000769 Ga0373927_0000769_17783_18772 260
113 3300035725 Ga0373947_0003276 Ga0373947_0003276_1235_2224 260
114 3300037068 Ga0373925_0016247 Ga0373925_0016247_3195_4184 260
115 3300046459 Ga0495629_0164241 Ga0495629_0164241_105_1094 260
116 3300046461 Ga0495641_0019491 Ga0495641_0019491_1572_2561 260
117 3300046463 Ga0495653_0036149 Ga0495653_0036149_726_1715 260
118 3300046473 Ga0495582_0015398 Ga0495582_0015398_2418_3407 260
119 3300046476 Ga0495662_0071917 Ga0495662_0071917_43_1020 260
120 3300046477 Ga0495664_0001258 Ga0495664_0001258_4861_5850 260
121 3300046517 Ga0495630_0146762 Ga0495630_0146762_90_1079 260
122 3300046663 Ga0495635_0017678 Ga0495635_0017678_2780_3769 260
123 3300046690 Ga0495624_0006705 Ga0495624_0006705_831_1820 260
124 3300047319 Ga0495674_0008702 Ga0495674_0008702_1415_2404 260
125 3300047321 Ga0495676_0023855 Ga0495676_0023855_3537_4526 260
126 3300047471 Ga0495684_0052045 Ga0495684_0052045_1200_2189 260
127 3300048912 Ga0496109_0256657 Ga0496109_0256657_470_1447 260
128 3300046531 Ga0495665_0026429 Ga0495665_0026429_1328_2317 261
129 3300046675 Ga0495657_0024109 Ga0495657_0024109_26_1015 261
130 3300005329 Ga0070683_100153033 Ga0070683_1001530332 262
131 3300046678 Ga0495599_0130122 Ga0495599_0130122_374_1294 263
132 3300025929 Ga0207664_10005715 Ga0207664_100057153 264
133 3300030763 Ga0265763_1000078 Ga0265763_10000786 265
134 3300030863 Ga0265766_1000756 Ga0265766_10007562 265
135 3300037418 Ga0395900_0089555 Ga0395900_0089555_1643_2569 265
136 3300037466 Ga0395898_0060914 Ga0395898_0060914_1018_1944 265
137 3300038443 Ga0395901_0183782 Ga0395901_0183782_1133_2059 265
138 3300039437 Ga0436365_1085450 Ga0436365_1085450_101_1084 265
139 3300044693 Ga0466961_0011630 Ga0466961_0011630_4163_5053 265
140 3300024225 Ga0224572_1016075 Ga0224572_10160752 267
141 3300046543 Ga0495645_0120957 Ga0495645_0120957_929_1828 267
142 3300059503 Ga0587080_014515 Ga0587080_014515_75_1031 267
143 3300060344 Ga0587071_015606 Ga0587071_015606_121_1077 267
144 3300005434 Ga0070709_10087093 Ga0070709_100870932 268
145 3300005435 Ga0070714_100235424 Ga0070714_1002354242 268
146 3300005436 Ga0070713_100229113 Ga0070713_1002291132 268
147 3300005437 Ga0070710_10064946 Ga0070710_100649462 268
148 3300005439 Ga0070711_100019173 Ga0070711_1000191733 268
149 3300005445 Ga0070708_100000965 Ga0070708_10000096514 268
150 3300005467 Ga0070706_100002011 Ga0070706_1000020119 268
151 3300005468 Ga0070707_100078538 Ga0070707_1000785385 268
152 3300005471 Ga0070698_100001377 Ga0070698_10000137721 268
153 3300005614 Ga0068856_100015342 Ga0068856_1000153425 268
154 3300006028 Ga0070717_10011131 Ga0070717_100111316 268
155 3300006173 Ga0070716_100006177 Ga0070716_1000061777 268
156 3300006175 Ga0070712_100074824 Ga0070712_1000748243 268
157 3300006358 Ga0068871_100167932 Ga0068871_1001679322 268
158 3300022467 Ga0224712_10013831 Ga0224712_100138312 268
159 3300025898 Ga0207692_10001841 Ga0207692_100018417 268
160 3300025905 Ga0207685_10011476 Ga0207685_100114763 268
161 3300025906 Ga0207699_10005069 Ga0207699_100050697 268
162 3300025910 Ga0207684_10003525 Ga0207684_1000352514 268
163 3300025915 Ga0207693_10006056 Ga0207693_100060569 268
164 3300025916 Ga0207663_10046843 Ga0207663_100468432 268
165 3300025922 Ga0207646_10002744 Ga0207646_100027444 268
166 3300025928 Ga0207700_10011699 Ga0207700_100116994 268
167 3300025929 Ga0207664_10001623 Ga0207664_100016236 268
168 3300025939 Ga0207665_10004634 Ga0207665_100046346 268
169 3300026078 Ga0207702_10022216 Ga0207702_100222165 268
170 3300048903 Ga0496100_0177114 Ga0496100_0177114_296_1264 268
171 3300048904 Ga0496101_0086585 Ga0496101_0086585_1174_2142 268
172 3300048907 Ga0496104_0003397 Ga0496104_0003397_10713_11681 268
173 3300048908 Ga0496105_0005144 Ga0496105_0005144_2230_3198 268
174 3300048909 Ga0496106_0079158 Ga0496106_0079158_1022_1990 268
175 3300048911 Ga0496108_0011471 Ga0496108_0011471_3725_4693 268
176 3300048912 Ga0496109_0029692 Ga0496109_0029692_97_1065 268
177 3300048915 Ga0496112_0002182 Ga0496112_0002182_6486_7454 268
178 3300048916 Ga0496113_0015259 Ga0496113_0015259_2931_3899 268
179 3300048917 Ga0496114_0049174 Ga0496114_0049174_2307_3275 268
180 3300048918 Ga0496115_0112278 Ga0496115_0112278_1039_2007 268
181 3300005344 Ga0070661_100080768 Ga0070661_1000807682 269
182 3300019192 Ga0184603_125190 Ga0184603_1251904 269
183 3300020070 Ga0206356_10466239 Ga0206356_104662393 269
184 3300020075 Ga0206349_1440927 Ga0206349_14409272 269
185 3300020076 Ga0206355_1154318 Ga0206355_11543183 269
186 3300022467 Ga0224712_10011651 Ga0224712_100116513 269
187 3300025920 Ga0207649_10026680 Ga0207649_100266804 269
188 3300026078 Ga0207702_10073873 Ga0207702_100738733 269
189 3300048912 Ga0496109_0532442 Ga0496109_0532442_21_935 269
190 3300005327 Ga0070658_10004706 Ga0070658_100047068 270
191 3300020077 Ga0206351_10677736 Ga0206351_106777363 270
192 3300036457 Ga0265778_008040 Ga0265778_008040_62_1042 270
193 3300005327 Ga0070658_10000342 Ga0070658_1000034227 271
194 3300005336 Ga0070680_100001460 Ga0070680_1000014607 271
195 3300005434 Ga0070709_10000730 Ga0070709_100007305 271
196 3300005435 Ga0070714_100001418 Ga0070714_1000014189 271
197 3300005436 Ga0070713_100001109 Ga0070713_10000110911 271
198 3300005437 Ga0070710_10000747 Ga0070710_100007473 271
199 3300005439 Ga0070711_100000258 Ga0070711_10000025824 271
200 3300005458 Ga0070681_10001628 Ga0070681_100016289 271
201 3300005467 Ga0070706_100009310 Ga0070706_1000093102 271
202 3300005471 Ga0070698_100000873 Ga0070698_10000087313 271
203 3300005530 Ga0070679_100002684 Ga0070679_1000026848 271
204 3300006028 Ga0070717_10005146 Ga0070717_1000514610 271
205 3300006173 Ga0070716_100000222 Ga0070716_1000002228 271
206 3300006175 Ga0070712_100002878 Ga0070712_1000028784 271
207 3300013105 Ga0157369_10065520 Ga0157369_100655204 271
208 3300025898 Ga0207692_10001938 Ga0207692_100019389 271
209 3300025906 Ga0207699_10000105 Ga0207699_1000010516 271
210 3300025910 Ga0207684_10037605 Ga0207684_100376052 271
211 3300025915 Ga0207693_10001586 Ga0207693_100015864 271
212 3300025928 Ga0207700_10000050 Ga0207700_1000005045 271
213 3300025929 Ga0207664_10000101 Ga0207664_1000010145 271
214 3300025939 Ga0207665_10000438 Ga0207665_1000043812 271
215 3300049585 Ga0501069_0038616 Ga0501069_0038616_82_1005 271
216 3300049586 Ga0501070_0013674 Ga0501070_0013674_553_1476 271
217 3300005530 Ga0070679_100029381 Ga0070679_1000293814 272
218 3300006058 Ga0075432_10015854 Ga0075432_100158543 272
219 3300006844 Ga0075428_100019148 Ga0075428_1000191485 272
220 3300006852 Ga0075433_10004694 Ga0075433_100046949 272
221 3300007076 Ga0075435_100044365 Ga0075435_1000443654 272
222 3300009147 Ga0114129_10005268 Ga0114129_1000526813 272
223 3300025921 Ga0207652_10011619 Ga0207652_100116195 272
224 3300025949 Ga0207667_10117428 Ga0207667_101174282 272
225 3300027907 Ga0207428_10013659 Ga0207428_100136593 272
226 3300005336 Ga0070680_100043094 Ga0070680_1000430945 273
227 3300005339 Ga0070660_100044226 Ga0070660_1000442262 273
228 3300005458 Ga0070681_10040214 Ga0070681_100402143 273
229 3300005530 Ga0070679_100012806 Ga0070679_1000128065 273
230 3300021377 Ga0213874_10042386 Ga0213874_100423862 273
231 3300025912 Ga0207707_10033803 Ga0207707_100338032 273
232 3300025919 Ga0207657_10125928 Ga0207657_101259283 273
233 3300039437 Ga0436365_1064228 Ga0436365_1064228_25_981 273
234 3300039450 Ga0436363_1397682 Ga0436363_1397682_248_1165 273
235 3300005336 Ga0070680_100109385 Ga0070680_1001093853 274
236 3300005345 Ga0070692_10051706 Ga0070692_100517062 274
237 3300005445 Ga0070708_100037646 Ga0070708_1000376463 274
238 3300005468 Ga0070707_100551720 Ga0070707_1005517202 274
239 3300025919 Ga0207657_10095542 Ga0207657_100955423 274
240 3300025932 Ga0207690_10224890 Ga0207690_102248902 274
241 3300039450 Ga0436363_1387926 Ga0436363_1387926_221_1180 274
242 3300045976 Ga0466967_0071658 Ga0466967_0071658_1831_2766 274
243 3300046517 Ga0495630_0388216 Ga0495630_0388216_82_1023 274
244 3300047471 Ga0495684_0142020 Ga0495684_0142020_842_1783 274
245 3300053084 Ga0495595_0048133 Ga0495595_0048133_158_1099 274
246 3300053085 Ga0495619_0007509 Ga0495619_0007509_845_1786 274
247 3300059652 Ga0587107_005414 Ga0587107_005414_119_1075 274
248 3300005467 Ga0070706_100116969 Ga0070706_1001169693 275
249 3300005467 Ga0070706_100537313 Ga0070706_1005373131 275
250 3300005471 Ga0070698_100001007 Ga0070698_10000100722 275
251 3300019183 Ga0184601_125904 Ga0184601_1259041 275
252 3300021388 Ga0213875_10033071 Ga0213875_100330712 275
253 3300025922 Ga0207646_10458932 Ga0207646_104589322 275
254 3300028666 Ga0265336_10023060 Ga0265336_100230603 275
255 3300028800 Ga0265338_10000551 Ga0265338_1000055143 275
256 3300028800 Ga0265338_10006545 Ga0265338_1000654510 275
257 3300030882 Ga0265764_100145 Ga0265764_1001454 275
258 3300030888 Ga0265769_100062 Ga0265769_1000623 275
259 3300031043 Ga0265779_100587 Ga0265779_1005872 275
260 3300037853 Ga0436364_0765310 Ga0436364_0765310_801_1790 275
261 3300049586 Ga0501070_0213973 Ga0501070_0213973_156_1079 275
262 3300005327 Ga0070658_10196518 Ga0070658_101965183 276
263 3300005338 Ga0068868_100087677 Ga0068868_1000876774 276
264 3300005435 Ga0070714_100002728 Ga0070714_1000027286 276
265 3300022467 Ga0224712_10018943 Ga0224712_100189432 276
266 3300025909 Ga0207705_10198408 Ga0207705_101984083 276
267 3300025929 Ga0207664_10000914 Ga0207664_1000091413 276
268 3300025949 Ga0207667_10283875 Ga0207667_102838752 276
269 3300031241 Ga0265325_10043778 Ga0265325_100437782 276
270 3300031247 Ga0265340_10005572 Ga0265340_100055727 276
271 3300039447 Ga0436361_0396973 Ga0436361_0396973_515_1531 276
272 3300048909 Ga0496106_0266549 Ga0496106_0266549_258_1262 276
273 3300006028 Ga0070717_10050238 Ga0070717_100502381 277
274 3300009545 Ga0105237_10294998 Ga0105237_102949982 277
275 3300013105 Ga0157369_10069779 Ga0157369_100697794 277
276 3300025914 Ga0207671_10174289 Ga0207671_101742892 277
277 3300035083 Ga0373926_0000521 Ga0373926_0000521_1903_2868 277
278 3300035171 Ga0373946_0072371 Ga0373946_0072371_488_1453 277
279 3300035692 Ga0373935_0001541 Ga0373935_0001541_11815_12780 277
280 3300035725 Ga0373947_0000002 Ga0373947_0000002_347029_347994 277
281 3300036401 Ga0373937_0121546 Ga0373937_0121546_384_1349 277
282 3300046536 Ga0495587_0130722 Ga0495587_0130722_203_1168 277
283 3300048088 Ga0495602_0066372 Ga0495602_0066372_296_1261 277
284 3300005435 Ga0070714_100017374 Ga0070714_1000173743 278
285 3300025909 Ga0207705_10098270 Ga0207705_100982703 278
286 3300025928 Ga0207700_10050343 Ga0207700_100503434 278
287 3300025929 Ga0207664_10044397 Ga0207664_100443973 278
288 3300044684 Ga0466966_0062756 Ga0466966_0062756_471_1400 278
289 3300044693 Ga0466961_0025159 Ga0466961_0025159_1297_2226 278
290 3300045049 Ga0466959_0043568 Ga0466959_0043568_604_1533 278
291 3300048929 Ga0496126_0019004 Ga0496126_0019004_4484_5464 278
292 3300059493 Ga0587077_010288 Ga0587077_010288_247_1203 279
293 3300005435 Ga0070714_100271945 Ga0070714_1002719451 280
294 3300005436 Ga0070713_100117803 Ga0070713_1001178032 280
295 3300009093 Ga0105240_10005320 Ga0105240_1000532011 280
296 3300009174 Ga0105241_10013190 Ga0105241_100131903 280
297 3300009545 Ga0105237_10018224 Ga0105237_100182247 280
298 3300009551 Ga0105238_10090280 Ga0105238_100902803 280
299 3300010375 Ga0105239_10008718 Ga0105239_100087186 280
300 3300044656 Ga0466969_0048136 Ga0466969_0048136_722_1609 280
301 3300044693 Ga0466961_0053152 Ga0466961_0053152_1185_2072 280
302 3300044765 Ga0466970_0024887 Ga0466970_0024887_224_1111 280
303 3300045049 Ga0466959_0091953 Ga0466959_0091953_760_1647 280
304 3300005327 Ga0070658_10000108 Ga0070658_1000010812 281
305 3300005336 Ga0070680_100046675 Ga0070680_1000466752 281
306 3300005455 Ga0070663_100060264 Ga0070663_1000602641 281
307 3300006028 Ga0070717_10092936 Ga0070717_100929362 281
308 3300020077 Ga0206351_10697985 Ga0206351_106979851 281
309 3300022467 Ga0224712_10026621 Ga0224712_100266211 281
310 3300025909 Ga0207705_10000394 Ga0207705_1000039434 281
311 3300025917 Ga0207660_10030998 Ga0207660_100309985 281
312 3300026067 Ga0207678_10003714 Ga0207678_100037147 281
313 3300033547 Ga0316212_1003717 Ga0316212_10037173 281
314 3300044684 Ga0466966_0067090 Ga0466966_0067090_96_1025 281
315 3300044693 Ga0466961_0029022 Ga0466961_0029022_638_1567 281
316 3300006173 Ga0070716_100027978 Ga0070716_1000279783 282
317 3300021388 Ga0213875_10039817 Ga0213875_100398172 282
318 3300025939 Ga0207665_10004822 Ga0207665_100048223 282
319 3300037853 Ga0436364_0398528 Ga0436364_0398528_1847_2914 282
320 3300048923 Ga0496120_0185470 Ga0496120_0185470_43_954 282
321 3300003659 JGI25404J52841_10001562 JGI25404J52841_100015624 283
322 3300004798 Ga0058859_11732587 Ga0058859_117325872 283
323 3300004799 Ga0058863_10129332 Ga0058863_101293322 283
324 3300004801 Ga0058860_12247198 Ga0058860_122471982 283
325 3300005327 Ga0070658_10032228 Ga0070658_100322284 283
326 3300005329 Ga0070683_100050455 Ga0070683_1000504554 283
327 3300005335 Ga0070666_10028984 Ga0070666_100289844 283
328 3300005340 Ga0070689_100065769 Ga0070689_1000657694 283
329 3300005343 Ga0070687_100079025 Ga0070687_1000790252 283
330 3300005344 Ga0070661_100117256 Ga0070661_1001172563 283
331 3300005347 Ga0070668_100108777 Ga0070668_1001087772 283
332 3300005353 Ga0070669_100162162 Ga0070669_1001621622 283
333 3300005354 Ga0070675_100025930 Ga0070675_1000259306 283
334 3300005355 Ga0070671_100092252 Ga0070671_1000922521 283
335 3300005356 Ga0070674_100054858 Ga0070674_1000548583 283
336 3300005365 Ga0070688_100071033 Ga0070688_1000710332 283
337 3300005456 Ga0070678_100116393 Ga0070678_1001163932 283
338 3300005457 Ga0070662_100065088 Ga0070662_1000650882 283
339 3300005466 Ga0070685_10021215 Ga0070685_100212154 283
340 3300005467 Ga0070706_100297305 Ga0070706_1002973052 283
341 3300005468 Ga0070707_100396357 Ga0070707_1003963571 283
342 3300005543 Ga0070672_100031823 Ga0070672_1000318234 283
343 3300005547 Ga0070693_100062953 Ga0070693_1000629533 283
344 3300005549 Ga0070704_100034422 Ga0070704_1000344224 283
345 3300005564 Ga0070664_100079660 Ga0070664_1000796602 283
346 3300005578 Ga0068854_100178249 Ga0068854_1001782492 283
347 3300005615 Ga0070702_100038952 Ga0070702_1000389523 283
348 3300005617 Ga0068859_100143263 Ga0068859_1001432633 283
349 3300005618 Ga0068864_100024739 Ga0068864_1000247397 283
350 3300005844 Ga0068862_100059655 Ga0068862_1000596554 283
351 3300005983 Ga0081540_1000134 Ga0081540_100013456 283
352 3300006931 Ga0097620_100143244 Ga0097620_1001432443 283
353 3300009036 Ga0105244_10035853 Ga0105244_100358532 283
354 3300009093 Ga0105240_10084936 Ga0105240_100849363 283
355 3300009148 Ga0105243_10072682 Ga0105243_100726822 283
356 3300013307 Ga0157372_10038454 Ga0157372_100384543 283
357 3300014326 Ga0157380_10137701 Ga0157380_101377013 283
358 3300017792 Ga0163161_10079115 Ga0163161_100791152 283
359 3300020081 Ga0206354_11029550 Ga0206354_110295503 283
360 3300025885 Ga0207653_10012142 Ga0207653_100121424 283
361 3300025901 Ga0207688_10012880 Ga0207688_100128802 283
362 3300025904 Ga0207647_10013505 Ga0207647_100135056 283
363 3300025906 Ga0207699_10116594 Ga0207699_101165942 283
364 3300025908 Ga0207643_10016854 Ga0207643_100168543 283
365 3300025909 Ga0207705_10086942 Ga0207705_100869422 283
366 3300025912 Ga0207707_10213989 Ga0207707_102139892 283
367 3300025918 Ga0207662_10019958 Ga0207662_100199585 283
368 3300025919 Ga0207657_10015156 Ga0207657_100151566 283
369 3300025921 Ga0207652_10034465 Ga0207652_100344653 283
370 3300025926 Ga0207659_10127182 Ga0207659_101271823 283
371 3300025928 Ga0207700_10013214 Ga0207700_100132144 283
372 3300025929 Ga0207664_10040805 Ga0207664_100408053 283
373 3300025933 Ga0207706_10045392 Ga0207706_100453922 283
374 3300025935 Ga0207709_10088663 Ga0207709_100886632 283
375 3300025937 Ga0207669_10048334 Ga0207669_100483342 283
376 3300025938 Ga0207704_10162396 Ga0207704_101623963 283
377 3300025940 Ga0207691_10010556 Ga0207691_100105569 283
378 3300025942 Ga0207689_10005438 Ga0207689_100054387 283
379 3300025944 Ga0207661_10228934 Ga0207661_102289342 283
380 3300025961 Ga0207712_10205816 Ga0207712_102058161 283
381 3300025972 Ga0207668_10042538 Ga0207668_100425383 283
382 3300026035 Ga0207703_10051994 Ga0207703_100519942 283
383 3300026067 Ga0207678_10012193 Ga0207678_100121936 283
384 3300026075 Ga0207708_10006954 Ga0207708_100069548 283
385 3300026095 Ga0207676_10080475 Ga0207676_100804753 283
386 3300026116 Ga0207674_10010202 Ga0207674_100102029 283
387 3300026118 Ga0207675_100027441 Ga0207675_1000274414 283
388 3300026121 Ga0207683_10010628 Ga0207683_100106289 283
389 3300026142 Ga0207698_10114194 Ga0207698_101141942 283
390 3300028380 Ga0268265_10238836 Ga0268265_102388362 283
391 3300034957 Ga0373938_0007985 Ga0373938_0007985_665_1627 283
392 3300035084 Ga0373928_0014196 Ga0373928_0014196_348_1310 283
393 3300035091 Ga0373951_0008653 Ga0373951_0008653_896_1858 283
394 3300045976 Ga0466967_0295678 Ga0466967_0295678_514_1389 283
395 3300046453 Ga0495627_039445 Ga0495627_039445_432_1292 283
396 3300046477 Ga0495664_0101527 Ga0495664_0101527_644_1603 283
397 3300048913 Ga0496110_0043235 Ga0496110_0043235_2519_3481 283
398 3300048915 Ga0496112_0163551 Ga0496112_0163551_651_1613 283
399 3300049590 Ga0501074_0305166 Ga0501074_0305166_84_1004 283
400 3300059493 Ga0587077_013252 Ga0587077_013252_349_1311 283
401 3300059512 Ga0587092_011728 Ga0587092_011728_195_1157 283
402 3300059628 Ga0587122_002013 Ga0587122_002013_244_1206 283
403 3300059655 Ga0587114_004468 Ga0587114_004468_161_1123 283
404 3300060344 Ga0587071_008214 Ga0587071_008214_392_1354 283
405 3300013105 Ga0157369_10015418 Ga0157369_100154187 284
406 3300020069 Ga0197907_11323763 Ga0197907_113237634 284
407 3300020070 Ga0206356_10155563 Ga0206356_101555635 284
408 3300020075 Ga0206349_1031490 Ga0206349_10314902 284
409 3300020075 Ga0206349_1196369 Ga0206349_11963693 284
410 3300020077 Ga0206351_10069119 Ga0206351_100691193 284
411 3300020080 Ga0206350_11022604 Ga0206350_110226043 284
412 3300020080 Ga0206350_11036766 Ga0206350_110367663 284
413 3300020610 Ga0154015_1066679 Ga0154015_10666793 284
414 3300022467 Ga0224712_10003796 Ga0224712_100037962 284
415 3300025909 Ga0207705_10001806 Ga0207705_100018068 284
416 3300020069 Ga0197907_11185792 Ga0197907_111857923 285
417 3300020070 Ga0206356_10039243 Ga0206356_100392433 285
418 3300020077 Ga0206351_10852899 Ga0206351_108528993 285
419 3300020078 Ga0206352_10883012 Ga0206352_108830121 285
420 3300020080 Ga0206350_10002456 Ga0206350_100024562 285
421 3300020081 Ga0206354_10960839 Ga0206354_109608395 285
422 3300020082 Ga0206353_10836602 Ga0206353_1083660215 285
423 3300022467 Ga0224712_10016527 Ga0224712_100165272 285
424 3300025909 Ga0207705_10000597 Ga0207705_100005978 285
425 3300025912 Ga0207707_10000983 Ga0207707_1000098311 285
426 3300025917 Ga0207660_10000164 Ga0207660_1000016412 285
427 3300025921 Ga0207652_10000702 Ga0207652_100007029 285
428 3300035086 Ga0373934_0121123 Ga0373934_0121123_14_973 285
429 3300046477 Ga0495664_0060507 Ga0495664_0060507_420_1379 285
430 3300046529 Ga0495652_0121486 Ga0495652_0121486_273_1232 285
431 3300046559 Ga0495667_0043387 Ga0495667_0043387_71_1030 285
432 3300046675 Ga0495657_0034081 Ga0495657_0034081_2547_3506 285
433 3300047471 Ga0495684_0171839 Ga0495684_0171839_129_1088 285
434 3300048088 Ga0495602_0100156 Ga0495602_0100156_162_1121 285
435 3300053085 Ga0495619_0130742 Ga0495619_0130742_188_1147 285
436 3300003320 rootH2_10098903 rootH2_100989033 286
437 3300006173 Ga0070716_100020861 Ga0070716_1000208614 286
438 3300025906 Ga0207699_10083896 Ga0207699_100838962 286
439 3300025939 Ga0207665_10005172 Ga0207665_100051723 286
440 3300028800 Ga0265338_10005567 Ga0265338_1000556715 286
441 3300028800 Ga0265338_10228510 Ga0265338_102285102 286
442 3300006028 Ga0070717_10474984 Ga0070717_104749841 289
443 3300005467 Ga0070706_100051618 Ga0070706_1000516183 290
444 3300020080 Ga0206350_11604676 Ga0206350_116046763 290
445 3300022467 Ga0224712_10022654 Ga0224712_100226542 290
446 3300025910 Ga0207684_10042959 Ga0207684_100429593 290
447 3300025915 Ga0207693_10104250 Ga0207693_101042502 290
448 3300005468 Ga0070707_100004535 Ga0070707_10000453512 293
449 3300005563 Ga0068855_100007431 Ga0068855_10000743110 294
450 3300005578 Ga0068854_100006361 Ga0068854_1000063613 294
451 3300005614 Ga0068856_100176186 Ga0068856_1001761863 294
452 3300005616 Ga0068852_100007902 Ga0068852_1000079027 294
453 3300020070 Ga0206356_11766282 Ga0206356_117662821 294
454 3300025904 Ga0207647_10013702 Ga0207647_100137024 294
455 3300025911 Ga0207654_10013416 Ga0207654_100134164 294
456 3300025913 Ga0207695_10001690 Ga0207695_100016907 294
457 3300025914 Ga0207671_10000619 Ga0207671_100006199 294
458 3300025924 Ga0207694_10002705 Ga0207694_100027059 294
459 3300025981 Ga0207640_10003813 Ga0207640_100038133 294
460 3300026041 Ga0207639_10045770 Ga0207639_100457702 294
461 3300026142 Ga0207698_10061370 Ga0207698_100613703 294
462 3300028379 Ga0268266_10125797 Ga0268266_101257971 294
463 3300005435 Ga0070714_100148542 Ga0070714_1001485423 296
464 3300005435 Ga0070714_100502295 Ga0070714_1005022951 296
465 3300005439 Ga0070711_100058287 Ga0070711_1000582873 296
466 3300006173 Ga0070716_100060605 Ga0070716_1000606053 296
467 3300006175 Ga0070712_100034455 Ga0070712_1000344553 296
468 3300022467 Ga0224712_10103175 Ga0224712_101031751 296
469 3300025916 Ga0207663_10071671 Ga0207663_100716713 296
470 3300025929 Ga0207664_10441137 Ga0207664_104411371 296
471 3300025939 Ga0207665_10083238 Ga0207665_100832383 296
472 3300035398 Ga0316574_0004885 Ga0316574_0004885_4117_5013 296
473 3300036401 Ga0373937_0245837 Ga0373937_0245837_119_1075 296
474 3300001989 JGI24739J22299_10010913 JGI24739J22299_100109132 297
475 3300001989 JGI24739J22299_10033568 JGI24739J22299_100335682 297
476 3300005367 Ga0070667_100038678 Ga0070667_1000386784 297
477 3300005548 Ga0070665_100065650 Ga0070665_1000656503 297
478 3300005577 Ga0068857_100518037 Ga0068857_1005180371 297
479 3300010375 Ga0105239_10267009 Ga0105239_102670093 297
480 3300013307 Ga0157372_10307956 Ga0157372_103079562 297
481 3300022467 Ga0224712_10053006 Ga0224712_100530062 297
482 3300025904 Ga0207647_10035051 Ga0207647_100350513 297
483 3300025904 Ga0207647_10088176 Ga0207647_100881763 297
484 3300025986 Ga0207658_10251881 Ga0207658_102518811 297
485 3300026116 Ga0207674_10056090 Ga0207674_100560904 297
486 3300028379 Ga0268266_10050358 Ga0268266_100503583 297
487 3300028556 Ga0265337_1000373 Ga0265337_100037313 297
488 3300028786 Ga0307517_10213195 Ga0307517_102131952 297
489 3300031456 Ga0307513_10396744 Ga0307513_103967442 297
490 3300044684 Ga0466966_0056957 Ga0466966_0056957_533_1456 297
491 3300046529 Ga0495652_0130947 Ga0495652_0130947_427_1389 297
492 3300049586 Ga0501070_0081591 Ga0501070_0081591_470_1390 297
493 3300053077 Ga0495601_0021489 Ga0495601_0021489_496_1458 297
494 3300053078 Ga0495612_0011274 Ga0495612_0011274_1315_2277 297
495 iso_pu_bacteria 2895880812 2895883704 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

64

271

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8905 69 149
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8719 62 146
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7356 62 146
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7027 69 149
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.6935 77 148
ID Description Score Start End Superfamily
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9745 67 156 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9623 69 155 3.30.2010.10
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9537 67 156 3.30.2010.10
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9422 77 155 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9211 69 155 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A6B3I2P7-F1-model_v4 M48 family metalloprotease 0.9902 61 150 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A528D7J6-F1-model_v4 Protease HtpX 0.9774 68 145 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9178 45 155
AF-A0A7C2FZA4-F1-model_v4 Protease HtpX homolog (EC 3.4.24.-) 0.9155 4 292 GO:0004222
GO:0005886
GO:0006508
GO:0008270
AF-A0A0W1R2Z5-F1-model_v4 Heat-shock protein HtpX 0.9125 6 294 GO:0004222
GO:0005886
GO:0006508
GO:0046872

Feature Viewer

pLDDT pTM Quality
77.61 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map