F454724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 495 | 276 | 494 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300020075|Ga0206349_1440927|Ga0206349_14409272 |
| Length | 337 |
| Sequence | MATQTRYAPDRGLTVRMTATMFLLGLVFVIILVALIFGGGSAFVSLFYSDKIALAAAGAREVSPKEAPELHGIVDRLCALADMDKPRVAIAPAMMPNAFATGRNSKNSVLCVTDGLLYHSGLTQEELEGVLAHELSHVAHKDVQVMTIASLLAIVAGLLVRFAFYSELFGASAVVYAISFLLIRLLSRYRELAADRSGAMLTQNPSALISALTKVSKGMNRIPTQDLRAAEPLNAFYFAPAMKLSGGASLSAVFSTHPSLEKRIAQLSKIQRELGQPGADPRGIRYWASSTRSSPSLTTCSGSRRPRSSWRRRQASSPRAPCSPWTTASRAAACLSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 97 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 174 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 176 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 201 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 202 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 203 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 204 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 205 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 252 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.28 |
| Metatranscriptomes | 11.52 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.65 |
| Rhizosphere | 91.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10010913 | 3300001989 | Bacteria | 3360 |
| 2 | JGI24739J22299_10033568 | 3300001989 | Bacteria | 1754 |
| 3 | rootH2_10098903 | 3300003320 | Bacteria | 2100 |
| 4 | JGI25404J52841_10001562 | 3300003659 | Bacteria | 4070 |
| 5 | Ga0058859_11732587 | 3300004798 | Bacteria | 1563 |
| 6 | Ga0058863_10129332 | 3300004799 | Bacteria | 2331 |
| 7 | Ga0058860_12247198 | 3300004801 | Bacteria | 1544 |
| 8 | Ga0070658_10000108 | 3300005327 | Bacteria | 73704 |
| 9 | Ga0070658_10000342 | 3300005327 | Bacteria | 40341 |
| 10 | Ga0070658_10004706 | 3300005327 | Bacteria | 11092 |
| 11 | Ga0070658_10032228 | 3300005327 | Bacteria | 4213 |
| 12 | Ga0070658_10196518 | 3300005327 | Bacteria | 1701 |
| 13 | Ga0070683_100050455 | 3300005329 | Bacteria | 3852 |
| 14 | Ga0070683_100153033 | 3300005329 | Bacteria | 2187 |
| 15 | Ga0070683_100308692 | 3300005329 | Bacteria | 1505 |
| 16 | Ga0070666_10028984 | 3300005335 | Bacteria | 3637 |
| 17 | Ga0070680_100001460 | 3300005336 | Bacteria | 17136 |
| 18 | Ga0070680_100043094 | 3300005336 | Bacteria | 3664 |
| 19 | Ga0070680_100046675 | 3300005336 | Bacteria | 3525 |
| 20 | Ga0070680_100109385 | 3300005336 | Bacteria | 2300 |
| 21 | Ga0068868_100087677 | 3300005338 | Bacteria | 2503 |
| 22 | Ga0070660_100044226 | 3300005339 | Bacteria | 3405 |
| 23 | Ga0070660_100068016 | 3300005339 | Bacteria | 2776 |
| 24 | Ga0070689_100065769 | 3300005340 | Bacteria | 2824 |
| 25 | Ga0070687_100079025 | 3300005343 | Bacteria | 1789 |
| 26 | Ga0070661_100080768 | 3300005344 | Bacteria | 2400 |
| 27 | Ga0070661_100117256 | 3300005344 | Bacteria | 1992 |
| 28 | Ga0070692_10051706 | 3300005345 | Bacteria | 2138 |
| 29 | Ga0070668_100108777 | 3300005347 | Bacteria | 2205 |
| 30 | Ga0070669_100162162 | 3300005353 | Bacteria | 1738 |
| 31 | Ga0070675_100025930 | 3300005354 | Bacteria | 4701 |
| 32 | Ga0070671_100092252 | 3300005355 | Bacteria | 2537 |
| 33 | Ga0070674_100054858 | 3300005356 | Bacteria | 2758 |
| 34 | Ga0070688_100071033 | 3300005365 | Bacteria | 2228 |
| 35 | Ga0070667_100038678 | 3300005367 | Bacteria | 4000 |
| 36 | Ga0070709_10000730 | 3300005434 | Bacteria | 18584 |
| 37 | Ga0070709_10087093 | 3300005434 | Bacteria | 2051 |
| 38 | Ga0070714_100001418 | 3300005435 | Bacteria | 17401 |
| 39 | Ga0070714_100002728 | 3300005435 | Bacteria | 13016 |
| 40 | Ga0070714_100017374 | 3300005435 | Bacteria | 5827 |
| 41 | Ga0070714_100148542 | 3300005435 | Bacteria | 2110 |
| 42 | Ga0070714_100235424 | 3300005435 | Bacteria | 1688 |
| 43 | Ga0070714_100271945 | 3300005435 | Bacteria | 1571 |
| 44 | Ga0070714_100502295 | 3300005435 | Bacteria | 1157 |
| 45 | Ga0070713_100001109 | 3300005436 | Bacteria | 17148 |
| 46 | Ga0070713_100117803 | 3300005436 | Bacteria | 2324 |
| 47 | Ga0070713_100229113 | 3300005436 | Bacteria | 1688 |
| 48 | Ga0070710_10000747 | 3300005437 | Bacteria | 15479 |
| 49 | Ga0070710_10064946 | 3300005437 | Bacteria | 2089 |
| 50 | Ga0070711_100000258 | 3300005439 | Bacteria | 27048 |
| 51 | Ga0070711_100019173 | 3300005439 | Bacteria | 4384 |
| 52 | Ga0070711_100058287 | 3300005439 | Bacteria | 2677 |
| 53 | Ga0070705_100035576 | 3300005440 | Bacteria | 2793 |
| 54 | Ga0070708_100000965 | 3300005445 | Bacteria | 21868 |
| 55 | Ga0070708_100037646 | 3300005445 | Bacteria | 4222 |
| 56 | Ga0070663_100060264 | 3300005455 | Bacteria | 2729 |
| 57 | Ga0070678_100116393 | 3300005456 | Bacteria | 2100 |
| 58 | Ga0070662_100065088 | 3300005457 | Bacteria | 2671 |
| 59 | Ga0070681_10001628 | 3300005458 | Bacteria | 20013 |
| 60 | Ga0070681_10040214 | 3300005458 | Bacteria | 4687 |
| 61 | Ga0070681_10069226 | 3300005458 | Bacteria | 3496 |
| 62 | Ga0070685_10021215 | 3300005466 | Bacteria | 3529 |
| 63 | Ga0070706_100002011 | 3300005467 | Bacteria | 20876 |
| 64 | Ga0070706_100009310 | 3300005467 | Bacteria | 9152 |
| 65 | Ga0070706_100051618 | 3300005467 | Bacteria | 3796 |
| 66 | Ga0070706_100116969 | 3300005467 | Bacteria | 2483 |
| 67 | Ga0070706_100297305 | 3300005467 | Bacteria | 1506 |
| 68 | Ga0070706_100537313 | 3300005467 | Bacteria | 1087 |
| 69 | Ga0070707_100004535 | 3300005468 | Bacteria | 13002 |
| 70 | Ga0070707_100078538 | 3300005468 | Bacteria | 3184 |
| 71 | Ga0070707_100396357 | 3300005468 | Bacteria | 1340 |
| 72 | Ga0070707_100551720 | 3300005468 | Bacteria | 1114 |
| 73 | Ga0070698_100000873 | 3300005471 | Bacteria | 33116 |
| 74 | Ga0070698_100001007 | 3300005471 | Bacteria | 30987 |
| 75 | Ga0070698_100001377 | 3300005471 | Bacteria | 26968 |
| 76 | Ga0070679_100002684 | 3300005530 | Bacteria | 16206 |
| 77 | Ga0070679_100012806 | 3300005530 | Bacteria | 8025 |
| 78 | Ga0070679_100029381 | 3300005530 | Bacteria | 5423 |
| 79 | Ga0070679_100037400 | 3300005530 | Bacteria | 4821 |
| 80 | Ga0070684_100053102 | 3300005535 | Bacteria | 3526 |
| 81 | Ga0070672_100031823 | 3300005543 | Bacteria | 3975 |
| 82 | Ga0070693_100062953 | 3300005547 | Bacteria | 2160 |
| 83 | Ga0070665_100065650 | 3300005548 | Bacteria | 3640 |
| 84 | Ga0070704_100034422 | 3300005549 | Bacteria | 3435 |
| 85 | Ga0068855_100007431 | 3300005563 | Bacteria | 13267 |
| 86 | Ga0068855_100017156 | 3300005563 | Bacteria | 8710 |
| 87 | Ga0068855_100189540 | 3300005563 | Bacteria | 2321 |
| 88 | Ga0068855_100627992 | 3300005563 | Bacteria | 1156 |
| 89 | Ga0070664_100079660 | 3300005564 | Bacteria | 2820 |
| 90 | Ga0068857_100518037 | 3300005577 | Bacteria | 1120 |
| 91 | Ga0068854_100006361 | 3300005578 | Bacteria | 7512 |
| 92 | Ga0068854_100178249 | 3300005578 | Bacteria | 1658 |
| 93 | Ga0068856_100015342 | 3300005614 | Bacteria | 7404 |
| 94 | Ga0068856_100176186 | 3300005614 | Bacteria | 2151 |
| 95 | Ga0070702_100038952 | 3300005615 | Bacteria | 2650 |
| 96 | Ga0068852_100007902 | 3300005616 | Bacteria | 7792 |
| 97 | Ga0068859_100143263 | 3300005617 | Bacteria | 2463 |
| 98 | Ga0068864_100014396 | 3300005618 | Bacteria | 6569 |
| 99 | Ga0068864_100024739 | 3300005618 | Bacteria | 5052 |
| 100 | Ga0068858_100029276 | 3300005842 | Bacteria | 5113 |
| 101 | Ga0068860_100055661 | 3300005843 | Bacteria | 3761 |
| 102 | Ga0068862_100059655 | 3300005844 | Bacteria | 3277 |
| 103 | Ga0081540_1000134 | 3300005983 | Bacteria | 79126 |
| 104 | Ga0070717_10005146 | 3300006028 | Bacteria | 9534 |
| 105 | Ga0070717_10011131 | 3300006028 | Bacteria | 6817 |
| 106 | Ga0070717_10050238 | 3300006028 | Bacteria | 3426 |
| 107 | Ga0070717_10092936 | 3300006028 | Bacteria | 2549 |
| 108 | Ga0070717_10474984 | 3300006028 | Bacteria | 1129 |
| 109 | Ga0075432_10015854 | 3300006058 | Bacteria | 2572 |
| 110 | Ga0070715_10054548 | 3300006163 | Bacteria | 1731 |
| 111 | Ga0070716_100000222 | 3300006173 | Bacteria | 22754 |
| 112 | Ga0070716_100006177 | 3300006173 | Bacteria | 5848 |
| 113 | Ga0070716_100020861 | 3300006173 | Bacteria | 3445 |
| 114 | Ga0070716_100027978 | 3300006173 | Bacteria | 3034 |
| 115 | Ga0070716_100060605 | 3300006173 | Bacteria | 2186 |
| 116 | Ga0070716_100102093 | 3300006173 | Bacteria | 1760 |
| 117 | Ga0070712_100002878 | 3300006175 | Bacteria | 10665 |
| 118 | Ga0070712_100034455 | 3300006175 | Bacteria | 3431 |
| 119 | Ga0070712_100074824 | 3300006175 | Bacteria | 2434 |
| 120 | Ga0097621_100035115 | 3300006237 | Bacteria | 4004 |
| 121 | Ga0068871_100041750 | 3300006358 | Bacteria | 3679 |
| 122 | Ga0068871_100167932 | 3300006358 | Bacteria | 1879 |
| 123 | Ga0075428_100019148 | 3300006844 | Bacteria | 7571 |
| 124 | Ga0075433_10004694 | 3300006852 | Bacteria | 10645 |
| 125 | Ga0097620_100143244 | 3300006931 | Bacteria | 2463 |
| 126 | Ga0075435_100044365 | 3300007076 | Bacteria | 3561 |
| 127 | Ga0105244_10035853 | 3300009036 | Bacteria | 2603 |
| 128 | Ga0105240_10005320 | 3300009093 | Bacteria | 19204 |
| 129 | Ga0105240_10084936 | 3300009093 | Bacteria | 3880 |
| 130 | Ga0111539_10194655 | 3300009094 | Bacteria | 2365 |
| 131 | Ga0105245_10033622 | 3300009098 | Bacteria | 4546 |
| 132 | Ga0114129_10005268 | 3300009147 | Bacteria | 18236 |
| 133 | Ga0105243_10072682 | 3300009148 | Bacteria | 2785 |
| 134 | Ga0105241_10013190 | 3300009174 | Bacteria | 6061 |
| 135 | Ga0105241_10113546 | 3300009174 | Bacteria | 2172 |
| 136 | Ga0105248_10025759 | 3300009177 | Bacteria | 6542 |
| 137 | Ga0105237_10018224 | 3300009545 | Bacteria | 7264 |
| 138 | Ga0105237_10294998 | 3300009545 | Bacteria | 1624 |
| 139 | Ga0105238_10090280 | 3300009551 | Bacteria | 3051 |
| 140 | Ga0105239_10008718 | 3300010375 | Bacteria | 11480 |
| 141 | Ga0105239_10267009 | 3300010375 | Bacteria | 1924 |
| 142 | Ga0157371_10043952 | 3300013102 | Bacteria | 3182 |
| 143 | Ga0157369_10015418 | 3300013105 | Bacteria | 8613 |
| 144 | Ga0157369_10065520 | 3300013105 | Bacteria | 3910 |
| 145 | Ga0157369_10069779 | 3300013105 | Bacteria | 3775 |
| 146 | Ga0157369_10425017 | 3300013105 | Bacteria | 1377 |
| 147 | Ga0157374_10011887 | 3300013296 | Bacteria | 7553 |
| 148 | Ga0163162_10015159 | 3300013306 | Bacteria | 7528 |
| 149 | Ga0157372_10038454 | 3300013307 | Bacteria | 5280 |
| 150 | Ga0157372_10307956 | 3300013307 | Bacteria | 1843 |
| 151 | Ga0163163_10009484 | 3300014325 | Bacteria | 8692 |
| 152 | Ga0163163_10239745 | 3300014325 | Bacteria | 1863 |
| 153 | Ga0157380_10137701 | 3300014326 | Bacteria | 2092 |
| 154 | Ga0157379_10001675 | 3300014968 | Bacteria | 18320 |
| 155 | Ga0157376_10003702 | 3300014969 | Bacteria | 10561 |
| 156 | Ga0163161_10079115 | 3300017792 | Bacteria | 2417 |
| 157 | Ga0184601_125904 | 3300019183 | Bacteria | 1396 |
| 158 | Ga0184603_125190 | 3300019192 | Bacteria | 3847 |
| 159 | Ga0197907_11185792 | 3300020069 | Bacteria | 3934 |
| 160 | Ga0197907_11323763 | 3300020069 | Bacteria | 5353 |
| 161 | Ga0206356_10039243 | 3300020070 | Bacteria | 6025 |
| 162 | Ga0206356_10155563 | 3300020070 | Bacteria | 3840 |
| 163 | Ga0206356_10466239 | 3300020070 | Bacteria | 2097 |
| 164 | Ga0206356_11766282 | 3300020070 | Bacteria | 1127 |
| 165 | Ga0206349_1031490 | 3300020075 | Bacteria | 2590 |
| 166 | Ga0206349_1196369 | 3300020075 | Bacteria | 2384 |
| 167 | Ga0206349_1440927 | 3300020075 | Bacteria | 1709 |
| 168 | Ga0206355_1154318 | 3300020076 | Bacteria | 3713 |
| 169 | Ga0206351_10069119 | 3300020077 | Bacteria | 4689 |
| 170 | Ga0206351_10677736 | 3300020077 | Bacteria | 2821 |
| 171 | Ga0206351_10697985 | 3300020077 | Bacteria | 1220 |
| 172 | Ga0206351_10852899 | 3300020077 | Bacteria | 4279 |
| 173 | Ga0206352_10406707 | 3300020078 | Bacteria | 1445 |
| 174 | Ga0206352_10883012 | 3300020078 | Bacteria | 2029 |
| 175 | Ga0206350_10002456 | 3300020080 | Bacteria | 2105 |
| 176 | Ga0206350_10244279 | 3300020080 | Bacteria | 1801 |
| 177 | Ga0206350_11022604 | 3300020080 | Bacteria | 2563 |
| 178 | Ga0206350_11036766 | 3300020080 | Bacteria | 4727 |
| 179 | Ga0206350_11604676 | 3300020080 | Bacteria | 2611 |
| 180 | Ga0206354_10960839 | 3300020081 | Bacteria | 4656 |
| 181 | Ga0206354_11029550 | 3300020081 | Bacteria | 2274 |
| 182 | Ga0206353_10836602 | 3300020082 | Bacteria | 20040 |
| 183 | Ga0154015_1066679 | 3300020610 | Bacteria | 2915 |
| 184 | Ga0213874_10042386 | 3300021377 | Bacteria | 1367 |
| 185 | Ga0213875_10033071 | 3300021388 | Bacteria | 2442 |
| 186 | Ga0213875_10039817 | 3300021388 | Bacteria | 2214 |
| 187 | Ga0224712_10003796 | 3300022467 | Bacteria | 3985 |
| 188 | Ga0224712_10006484 | 3300022467 | Bacteria | 3341 |
| 189 | Ga0224712_10011651 | 3300022467 | Bacteria | 2736 |
| 190 | Ga0224712_10013831 | 3300022467 | Bacteria | 2582 |
| 191 | Ga0224712_10016527 | 3300022467 | Bacteria | 2427 |
| 192 | Ga0224712_10018943 | 3300022467 | Bacteria | 2311 |
| 193 | Ga0224712_10019956 | 3300022467 | Bacteria | 2268 |
| 194 | Ga0224712_10022654 | 3300022467 | Bacteria | 2168 |
| 195 | Ga0224712_10026621 | 3300022467 | Bacteria | 2047 |
| 196 | Ga0224712_10053006 | 3300022467 | Bacteria | 1586 |
| 197 | Ga0224712_10103175 | 3300022467 | Bacteria | 1213 |
| 198 | Ga0224572_1016075 | 3300024225 | Bacteria | 1434 |
| 199 | Ga0207653_10012142 | 3300025885 | Bacteria | 2689 |
| 200 | Ga0207692_10001841 | 3300025898 | Bacteria | 8055 |
| 201 | Ga0207692_10001938 | 3300025898 | Bacteria | 7885 |
| 202 | Ga0207688_10012880 | 3300025901 | Bacteria | 4546 |
| 203 | Ga0207647_10013505 | 3300025904 | Bacteria | 5656 |
| 204 | Ga0207647_10013702 | 3300025904 | Bacteria | 5614 |
| 205 | Ga0207647_10035051 | 3300025904 | Bacteria | 3200 |
| 206 | Ga0207647_10088176 | 3300025904 | Bacteria | 1853 |
| 207 | Ga0207685_10011476 | 3300025905 | Bacteria | 2665 |
| 208 | Ga0207699_10000105 | 3300025906 | Bacteria | 59026 |
| 209 | Ga0207699_10005069 | 3300025906 | Bacteria | 6302 |
| 210 | Ga0207699_10083896 | 3300025906 | Bacteria | 1983 |
| 211 | Ga0207699_10116594 | 3300025906 | Bacteria | 1720 |
| 212 | Ga0207643_10016854 | 3300025908 | Bacteria | 3985 |
| 213 | Ga0207705_10000394 | 3300025909 | Bacteria | 38574 |
| 214 | Ga0207705_10000597 | 3300025909 | Bacteria | 30220 |
| 215 | Ga0207705_10001806 | 3300025909 | Bacteria | 16878 |
| 216 | Ga0207705_10086942 | 3300025909 | Bacteria | 2285 |
| 217 | Ga0207705_10098270 | 3300025909 | Bacteria | 2151 |
| 218 | Ga0207705_10198408 | 3300025909 | Bacteria | 1520 |
| 219 | Ga0207684_10003525 | 3300025910 | Bacteria | 15250 |
| 220 | Ga0207684_10037605 | 3300025910 | Bacteria | 4107 |
| 221 | Ga0207684_10042959 | 3300025910 | Bacteria | 3832 |
| 222 | Ga0207654_10013416 | 3300025911 | Bacteria | 4216 |
| 223 | Ga0207707_10000983 | 3300025912 | Bacteria | 27372 |
| 224 | Ga0207707_10033803 | 3300025912 | Bacteria | 4475 |
| 225 | Ga0207707_10079568 | 3300025912 | Bacteria | 2862 |
| 226 | Ga0207707_10213989 | 3300025912 | Bacteria | 1678 |
| 227 | Ga0207695_10001690 | 3300025913 | Bacteria | 35457 |
| 228 | Ga0207671_10000619 | 3300025914 | Bacteria | 46850 |
| 229 | Ga0207671_10174289 | 3300025914 | Bacteria | 1671 |
| 230 | Ga0207693_10001586 | 3300025915 | Bacteria | 20116 |
| 231 | Ga0207693_10006056 | 3300025915 | Bacteria | 10018 |
| 232 | Ga0207693_10104250 | 3300025915 | Bacteria | 2224 |
| 233 | Ga0207693_10370683 | 3300025915 | Bacteria | 1120 |
| 234 | Ga0207663_10046843 | 3300025916 | Bacteria | 2666 |
| 235 | Ga0207663_10071671 | 3300025916 | Bacteria | 2237 |
| 236 | Ga0207663_10229975 | 3300025916 | Bacteria | 1354 |
| 237 | Ga0207660_10000164 | 3300025917 | Bacteria | 41667 |
| 238 | Ga0207660_10030998 | 3300025917 | Bacteria | 3679 |
| 239 | Ga0207662_10019958 | 3300025918 | Bacteria | 3819 |
| 240 | Ga0207657_10015156 | 3300025919 | Bacteria | 7486 |
| 241 | Ga0207657_10043479 | 3300025919 | Bacteria | 3956 |
| 242 | Ga0207657_10095542 | 3300025919 | Bacteria | 2473 |
| 243 | Ga0207657_10125928 | 3300025919 | Bacteria | 2104 |
| 244 | Ga0207649_10026680 | 3300025920 | Bacteria | 3381 |
| 245 | Ga0207652_10000702 | 3300025921 | Bacteria | 32441 |
| 246 | Ga0207652_10011619 | 3300025921 | Bacteria | 7104 |
| 247 | Ga0207652_10034465 | 3300025921 | Bacteria | 4266 |
| 248 | Ga0207652_10061120 | 3300025921 | Bacteria | 3252 |
| 249 | Ga0207646_10002744 | 3300025922 | Bacteria | 20579 |
| 250 | Ga0207646_10119222 | 3300025922 | Bacteria | 2370 |
| 251 | Ga0207646_10458932 | 3300025922 | Bacteria | 1149 |
| 252 | Ga0207694_10002705 | 3300025924 | Bacteria | 14351 |
| 253 | Ga0207659_10127182 | 3300025926 | Bacteria | 1961 |
| 254 | Ga0207687_10094207 | 3300025927 | Bacteria | 2191 |
| 255 | Ga0207700_10000050 | 3300025928 | Bacteria | 79672 |
| 256 | Ga0207700_10011699 | 3300025928 | Bacteria | 5611 |
| 257 | Ga0207700_10013214 | 3300025928 | Bacteria | 5362 |
| 258 | Ga0207700_10050343 | 3300025928 | Bacteria | 3104 |
| 259 | Ga0207700_10210551 | 3300025928 | Bacteria | 1643 |
| 260 | Ga0207664_10000101 | 3300025929 | Bacteria | 79541 |
| 261 | Ga0207664_10000914 | 3300025929 | Bacteria | 19899 |
| 262 | Ga0207664_10001623 | 3300025929 | Bacteria | 14799 |
| 263 | Ga0207664_10005715 | 3300025929 | Bacteria | 8502 |
| 264 | Ga0207664_10040805 | 3300025929 | Bacteria | 3612 |
| 265 | Ga0207664_10044397 | 3300025929 | Bacteria | 3480 |
| 266 | Ga0207664_10139150 | 3300025929 | Bacteria | 2051 |
| 267 | Ga0207664_10179605 | 3300025929 | Bacteria | 1816 |
| 268 | Ga0207664_10441137 | 3300025929 | Bacteria | 1161 |
| 269 | Ga0207690_10224890 | 3300025932 | Bacteria | 1438 |
| 270 | Ga0207706_10045392 | 3300025933 | Bacteria | 3893 |
| 271 | Ga0207709_10088663 | 3300025935 | Bacteria | 2015 |
| 272 | Ga0207669_10048334 | 3300025937 | Bacteria | 2527 |
| 273 | Ga0207704_10162396 | 3300025938 | Bacteria | 1591 |
| 274 | Ga0207665_10000438 | 3300025939 | Bacteria | 28608 |
| 275 | Ga0207665_10004634 | 3300025939 | Bacteria | 9130 |
| 276 | Ga0207665_10004822 | 3300025939 | Bacteria | 8976 |
| 277 | Ga0207665_10005172 | 3300025939 | Bacteria | 8712 |
| 278 | Ga0207665_10083238 | 3300025939 | Bacteria | 2206 |
| 279 | Ga0207665_10120555 | 3300025939 | Bacteria | 1852 |
| 280 | Ga0207691_10010556 | 3300025940 | Bacteria | 8861 |
| 281 | Ga0207689_10005438 | 3300025942 | Bacteria | 11399 |
| 282 | Ga0207661_10228934 | 3300025944 | Bacteria | 1645 |
| 283 | Ga0207667_10011183 | 3300025949 | Bacteria | 10447 |
| 284 | Ga0207667_10117428 | 3300025949 | Bacteria | 2742 |
| 285 | Ga0207667_10283875 | 3300025949 | Bacteria | 1691 |
| 286 | Ga0207667_10554711 | 3300025949 | Bacteria | 1162 |
| 287 | Ga0207712_10205816 | 3300025961 | Bacteria | 1564 |
| 288 | Ga0207668_10042538 | 3300025972 | Bacteria | 3078 |
| 289 | Ga0207640_10003813 | 3300025981 | Bacteria | 8128 |
| 290 | Ga0207658_10251881 | 3300025986 | Bacteria | 1501 |
| 291 | Ga0207703_10018498 | 3300026035 | Bacteria | 5440 |
| 292 | Ga0207703_10051994 | 3300026035 | Bacteria | 3324 |
| 293 | Ga0207639_10045770 | 3300026041 | Bacteria | 3298 |
| 294 | Ga0207678_10003714 | 3300026067 | Bacteria | 13726 |
| 295 | Ga0207678_10012193 | 3300026067 | Bacteria | 7549 |
| 296 | Ga0207708_10006954 | 3300026075 | Bacteria | 8369 |
| 297 | Ga0207702_10022216 | 3300026078 | Bacteria | 5259 |
| 298 | Ga0207702_10073873 | 3300026078 | Bacteria | 2941 |
| 299 | Ga0207676_10080475 | 3300026095 | Bacteria | 2644 |
| 300 | Ga0207674_10010202 | 3300026116 | Bacteria | 10668 |
| 301 | Ga0207674_10056090 | 3300026116 | Bacteria | 4002 |
| 302 | Ga0207675_100027441 | 3300026118 | Bacteria | 5303 |
| 303 | Ga0207683_10010628 | 3300026121 | Bacteria | 7850 |
| 304 | Ga0207698_10061370 | 3300026142 | Bacteria | 2929 |
| 305 | Ga0207698_10114194 | 3300026142 | Bacteria | 2271 |
| 306 | Ga0207428_10013659 | 3300027907 | Bacteria | 7084 |
| 307 | Ga0268266_10050358 | 3300028379 | Bacteria | 3574 |
| 308 | Ga0268266_10125797 | 3300028379 | Bacteria | 2287 |
| 309 | Ga0268266_10300569 | 3300028379 | Bacteria | 1497 |
| 310 | Ga0268265_10238836 | 3300028380 | Bacteria | 1602 |
| 311 | Ga0268264_10067372 | 3300028381 | Bacteria | 3022 |
| 312 | Ga0265337_1000373 | 3300028556 | Bacteria | 24057 |
| 313 | Ga0265336_10023060 | 3300028666 | Bacteria | 1977 |
| 314 | Ga0307517_10213195 | 3300028786 | Bacteria | 1186 |
| 315 | Ga0265338_10000551 | 3300028800 | Bacteria | 65599 |
| 316 | Ga0265338_10005567 | 3300028800 | Bacteria | 16386 |
| 317 | Ga0265338_10006545 | 3300028800 | Bacteria | 14804 |
| 318 | Ga0265338_10228510 | 3300028800 | Bacteria | 1385 |
| 319 | Ga0265763_1000078 | 3300030763 | Bacteria | 4230 |
| 320 | Ga0265766_1000756 | 3300030863 | Bacteria | 1465 |
| 321 | Ga0265764_100145 | 3300030882 | Bacteria | 2235 |
| 322 | Ga0265769_100062 | 3300030888 | Bacteria | 2886 |
| 323 | Ga0265779_100587 | 3300031043 | Bacteria | 1405 |
| 324 | Ga0265325_10043778 | 3300031241 | Bacteria | 2334 |
| 325 | Ga0265340_10005572 | 3300031247 | Bacteria | 6984 |
| 326 | Ga0307513_10396744 | 3300031456 | Bacteria | 1115 |
| 327 | Ga0316212_1003717 | 3300033547 | Bacteria | 2209 |
| 328 | Ga0373938_0007985 | 3300034957 | Bacteria | 1879 |
| 329 | Ga0373926_0000521 | 3300035083 | Bacteria | 10259 |
| 330 | Ga0373926_0009765 | 3300035083 | Bacteria | 3207 |
| 331 | Ga0373928_0014196 | 3300035084 | Bacteria | 1607 |
| 332 | Ga0373934_0121123 | 3300035086 | Bacteria | 1064 |
| 333 | Ga0373944_0001030 | 3300035089 | Bacteria | 6892 |
| 334 | Ga0373944_0015391 | 3300035089 | Bacteria | 2146 |
| 335 | Ga0373951_0008653 | 3300035091 | Bacteria | 2294 |
| 336 | Ga0373923_0165885 | 3300035111 | Bacteria | 1009 |
| 337 | Ga0373936_0002035 | 3300035113 | Bacteria | 7483 |
| 338 | Ga0373945_0000661 | 3300035116 | Bacteria | 9973 |
| 339 | Ga0373953_0041645 | 3300035117 | Bacteria | 1828 |
| 340 | Ga0373954_0082891 | 3300035118 | Bacteria | 1534 |
| 341 | Ga0373943_0000196 | 3300035170 | Bacteria | 24602 |
| 342 | Ga0373946_0000087 | 3300035171 | Bacteria | 25768 |
| 343 | Ga0373946_0072371 | 3300035171 | Bacteria | 1492 |
| 344 | Ga0373955_0076376 | 3300035172 | Bacteria | 1884 |
| 345 | Ga0316574_0004885 | 3300035398 | Bacteria | 7099 |
| 346 | Ga0373935_0000156 | 3300035692 | Bacteria | 31615 |
| 347 | Ga0373935_0001541 | 3300035692 | Bacteria | 12830 |
| 348 | Ga0373927_0000769 | 3300035695 | Bacteria | 24551 |
| 349 | Ga0373927_0052896 | 3300035695 | Bacteria | 2626 |
| 350 | Ga0373927_0220970 | 3300035695 | Bacteria | 1244 |
| 351 | Ga0373947_0000002 | 3300035725 | Bacteria | 383924 |
| 352 | Ga0373947_0003276 | 3300035725 | Bacteria | 9602 |
| 353 | Ga0373947_0145505 | 3300035725 | Bacteria | 1523 |
| 354 | Ga0373937_0121546 | 3300036401 | Bacteria | 2433 |
| 355 | Ga0373937_0245837 | 3300036401 | Bacteria | 1686 |
| 356 | Ga0265778_000468 | 3300036457 | Bacteria | 3163 |
| 357 | Ga0265778_008040 | 3300036457 | Bacteria | 1167 |
| 358 | Ga0373925_0000157 | 3300037068 | Bacteria | 72993 |
| 359 | Ga0373925_0016247 | 3300037068 | Bacteria | 5387 |
| 360 | Ga0373925_0113885 | 3300037068 | Bacteria | 2092 |
| 361 | Ga0395900_0089555 | 3300037418 | Bacteria | 3163 |
| 362 | Ga0395898_0060914 | 3300037466 | Bacteria | 3667 |
| 363 | Ga0436364_0398528 | 3300037853 | Bacteria | 3500 |
| 364 | Ga0436364_0765310 | 3300037853 | Bacteria | 4891 |
| 365 | Ga0436364_1412967 | 3300037853 | Bacteria | 4254 |
| 366 | Ga0395901_0183782 | 3300038443 | Bacteria | 2193 |
| 367 | Ga0436365_1064228 | 3300039437 | Bacteria | 1165 |
| 368 | Ga0436365_1085450 | 3300039437 | Bacteria | 1624 |
| 369 | Ga0436361_0396973 | 3300039447 | Bacteria | 2091 |
| 370 | Ga0436363_1387926 | 3300039450 | Bacteria | 1205 |
| 371 | Ga0436363_1397682 | 3300039450 | Bacteria | 1503 |
| 372 | Ga0466969_0048136 | 3300044656 | Bacteria | 2108 |
| 373 | Ga0466966_0056957 | 3300044684 | Bacteria | 2471 |
| 374 | Ga0466966_0062756 | 3300044684 | Bacteria | 2342 |
| 375 | Ga0466966_0067090 | 3300044684 | Bacteria | 2254 |
| 376 | Ga0466961_0011630 | 3300044693 | Bacteria | 5625 |
| 377 | Ga0466961_0025159 | 3300044693 | Bacteria | 3830 |
| 378 | Ga0466961_0029022 | 3300044693 | Bacteria | 3557 |
| 379 | Ga0466961_0053152 | 3300044693 | Bacteria | 2585 |
| 380 | Ga0466970_0024887 | 3300044765 | Bacteria | 3131 |
| 381 | Ga0466959_0043568 | 3300045049 | Bacteria | 3308 |
| 382 | Ga0466959_0091953 | 3300045049 | Bacteria | 2178 |
| 383 | Ga0466967_0071658 | 3300045976 | Bacteria | 3104 |
| 384 | Ga0466967_0295678 | 3300045976 | Bacteria | 1557 |
| 385 | Ga0495627_039445 | 3300046453 | Bacteria | 1457 |
| 386 | Ga0495592_0009319 | 3300046454 | Bacteria | 7384 |
| 387 | Ga0495629_0017371 | 3300046459 | Bacteria | 5156 |
| 388 | Ga0495629_0164241 | 3300046459 | Bacteria | 1542 |
| 389 | Ga0495641_0019491 | 3300046461 | Bacteria | 3468 |
| 390 | Ga0495651_0028321 | 3300046462 | Bacteria | 4366 |
| 391 | Ga0495653_0036149 | 3300046463 | Bacteria | 3892 |
| 392 | Ga0495582_0015398 | 3300046473 | Bacteria | 4201 |
| 393 | Ga0495662_0016489 | 3300046476 | Bacteria | 3577 |
| 394 | Ga0495662_0071917 | 3300046476 | Bacteria | 1676 |
| 395 | Ga0495664_0001258 | 3300046477 | Bacteria | 13274 |
| 396 | Ga0495664_0060507 | 3300046477 | Bacteria | 2254 |
| 397 | Ga0495664_0101527 | 3300046477 | Bacteria | 1733 |
| 398 | Ga0495594_0101794 | 3300046499 | Bacteria | 1616 |
| 399 | Ga0495618_0031817 | 3300046514 | Bacteria | 3303 |
| 400 | Ga0495630_0146762 | 3300046517 | Bacteria | 1794 |
| 401 | Ga0495630_0169011 | 3300046517 | Bacteria | 1665 |
| 402 | Ga0495630_0388216 | 3300046517 | Bacteria | 1069 |
| 403 | Ga0495652_0121486 | 3300046529 | Bacteria | 2082 |
| 404 | Ga0495652_0130947 | 3300046529 | Bacteria | 1986 |
| 405 | Ga0495665_0026429 | 3300046531 | Bacteria | 3117 |
| 406 | Ga0495665_0062716 | 3300046531 | Bacteria | 1962 |
| 407 | Ga0495640_0043411 | 3300046533 | Bacteria | 3131 |
| 408 | Ga0495587_0002850 | 3300046536 | Bacteria | 11583 |
| 409 | Ga0495587_0130722 | 3300046536 | Bacteria | 1435 |
| 410 | Ga0495645_0083199 | 3300046543 | Bacteria | 2294 |
| 411 | Ga0495645_0120957 | 3300046543 | Bacteria | 1843 |
| 412 | Ga0495667_0043387 | 3300046559 | Bacteria | 2980 |
| 413 | Ga0495635_0017678 | 3300046663 | Bacteria | 4979 |
| 414 | Ga0495635_0080946 | 3300046663 | Bacteria | 2222 |
| 415 | Ga0495657_0024109 | 3300046675 | Bacteria | 4338 |
| 416 | Ga0495657_0034081 | 3300046675 | Bacteria | 3539 |
| 417 | Ga0495599_0130122 | 3300046678 | Bacteria | 1563 |
| 418 | Ga0495646_0114876 | 3300046680 | Bacteria | 1529 |
| 419 | Ga0495646_0144311 | 3300046680 | Bacteria | 1328 |
| 420 | Ga0495613_0167578 | 3300046689 | Bacteria | 1560 |
| 421 | Ga0495624_0006705 | 3300046690 | Bacteria | 8135 |
| 422 | Ga0495624_0021741 | 3300046690 | Bacteria | 4250 |
| 423 | Ga0495604_0037228 | 3300047317 | Bacteria | 3832 |
| 424 | Ga0495674_0008702 | 3300047319 | Bacteria | 9654 |
| 425 | Ga0495674_0041734 | 3300047319 | Bacteria | 4096 |
| 426 | Ga0495676_0023855 | 3300047321 | Bacteria | 5301 |
| 427 | Ga0495680_0036485 | 3300047322 | Bacteria | 3945 |
| 428 | Ga0495684_0052045 | 3300047471 | Bacteria | 3124 |
| 429 | Ga0495684_0142020 | 3300047471 | Bacteria | 1800 |
| 430 | Ga0495684_0171839 | 3300047471 | Bacteria | 1611 |
| 431 | Ga0495602_0066372 | 3300048088 | Bacteria | 3109 |
| 432 | Ga0495602_0100156 | 3300048088 | Bacteria | 2380 |
| 433 | Ga0495602_0123242 | 3300048088 | Bacteria | 2081 |
| 434 | Ga0496100_0177114 | 3300048903 | Bacteria | 1540 |
| 435 | Ga0496101_0086585 | 3300048904 | Bacteria | 2324 |
| 436 | Ga0496104_0003397 | 3300048907 | Bacteria | 13747 |
| 437 | Ga0496105_0003685 | 3300048908 | Bacteria | 11404 |
| 438 | Ga0496105_0005144 | 3300048908 | Bacteria | 9920 |
| 439 | Ga0496106_0079158 | 3300048909 | Bacteria | 2523 |
| 440 | Ga0496106_0266549 | 3300048909 | Bacteria | 1371 |
| 441 | Ga0496108_0011471 | 3300048911 | Bacteria | 7203 |
| 442 | Ga0496108_0057256 | 3300048911 | Bacteria | 3275 |
| 443 | Ga0496109_0015830 | 3300048912 | Bacteria | 6584 |
| 444 | Ga0496109_0029692 | 3300048912 | Bacteria | 4898 |
| 445 | Ga0496109_0256657 | 3300048912 | Bacteria | 1646 |
| 446 | Ga0496109_0532442 | 3300048912 | Bacteria | 1108 |
| 447 | Ga0496110_0027420 | 3300048913 | Bacteria | 4883 |
| 448 | Ga0496110_0043235 | 3300048913 | Bacteria | 3933 |
| 449 | Ga0496111_0043869 | 3300048914 | Bacteria | 3215 |
| 450 | Ga0496112_0002182 | 3300048915 | Bacteria | 15574 |
| 451 | Ga0496112_0057654 | 3300048915 | Bacteria | 3824 |
| 452 | Ga0496112_0163551 | 3300048915 | Bacteria | 2191 |
| 453 | Ga0496113_0015259 | 3300048916 | Bacteria | 5274 |
| 454 | Ga0496113_0139725 | 3300048916 | Bacteria | 1905 |
| 455 | Ga0496114_0049174 | 3300048917 | Bacteria | 3508 |
| 456 | Ga0496115_0112278 | 3300048918 | Bacteria | 2239 |
| 457 | Ga0496120_0185470 | 3300048923 | Bacteria | 1018 |
| 458 | Ga0496126_0019004 | 3300048929 | Bacteria | 6786 |
| 459 | Ga0501032_0061960 | 3300049569 | Bacteria | 2507 |
| 460 | Ga0501034_0637812 | 3300049571 | Bacteria | 968 |
| 461 | Ga0501037_0093935 | 3300049573 | Bacteria | 2169 |
| 462 | Ga0501069_0002523 | 3300049585 | Bacteria | 9349 |
| 463 | Ga0501069_0038616 | 3300049585 | Bacteria | 2636 |
| 464 | Ga0501070_0002063 | 3300049586 | Bacteria | 17661 |
| 465 | Ga0501070_0013674 | 3300049586 | Bacteria | 6837 |
| 466 | Ga0501070_0081591 | 3300049586 | Bacteria | 2676 |
| 467 | Ga0501070_0213973 | 3300049586 | Bacteria | 1581 |
| 468 | Ga0501074_0305166 | 3300049590 | Bacteria | 1131 |
| 469 | Ga0501080_0012819 | 3300049742 | Bacteria | 7689 |
| 470 | Ga0501080_0022894 | 3300049742 | Bacteria | 5791 |
| 471 | Ga0501044_0094513 | 3300049823 | Bacteria | 3014 |
| 472 | nmdc:mga05p37_273697_c1 | 3300050507 | Bacteria | 2017 |
| 473 | nmdc:mga08y16_140681_c1 | 3300050511 | Bacteria | 2509 |
| 474 | nmdc:mga0n895_42406_c1 | 3300050512 | Bacteria | 4427 |
| 475 | nmdc:mga08x19_336396_c1 | 3300050514 | Bacteria | 1053 |
| 476 | nmdc:mga0a205_35041_c1 | 3300050515 | Bacteria | 4819 |
| 477 | Ga0495601_0021489 | 3300053077 | Bacteria | 3953 |
| 478 | Ga0495601_0097968 | 3300053077 | Bacteria | 1892 |
| 479 | Ga0495612_0011274 | 3300053078 | Bacteria | 3604 |
| 480 | Ga0495612_0105578 | 3300053078 | Bacteria | 1202 |
| 481 | Ga0495595_0045032 | 3300053084 | Bacteria | 2028 |
| 482 | Ga0495595_0048133 | 3300053084 | Bacteria | 1968 |
| 483 | Ga0495619_0007509 | 3300053085 | Bacteria | 6905 |
| 484 | Ga0495619_0130742 | 3300053085 | Bacteria | 1725 |
| 485 | Ga0495619_0169268 | 3300053085 | Bacteria | 1510 |
| 486 | Ga0587077_010288 | 3300059493 | Bacteria | 1443 |
| 487 | Ga0587077_013252 | 3300059493 | Bacteria | 1334 |
| 488 | Ga0587080_014515 | 3300059503 | Bacteria | 1219 |
| 489 | Ga0587092_011728 | 3300059512 | Bacteria | 1224 |
| 490 | Ga0587122_002013 | 3300059628 | Bacteria | 1412 |
| 491 | Ga0587107_005414 | 3300059652 | Bacteria | 1349 |
| 492 | Ga0587114_004468 | 3300059655 | Bacteria | 1460 |
| 493 | Ga0587071_008214 | 3300060344 | Bacteria | 1687 |
| 494 | Ga0587071_015606 | 3300060344 | Bacteria | 1334 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046499 | Ga0495594_0101794 | Ga0495594_0101794_661_1578 | 237 |
| 2 | 3300048088 | Ga0495602_0123242 | Ga0495602_0123242_41_958 | 237 |
| 3 | 3300005535 | Ga0070684_100053102 | Ga0070684_1000531022 | 238 |
| 4 | 3300020078 | Ga0206352_10406707 | Ga0206352_104067072 | 238 |
| 5 | 3300048914 | Ga0496111_0043869 | Ga0496111_0043869_2270_3187 | 238 |
| 6 | 3300053085 | Ga0495619_0169268 | Ga0495619_0169268_45_962 | 238 |
| 7 | 3300037068 | Ga0373925_0000157 | Ga0373925_0000157_47400_48353 | 243 |
| 8 | 3300035695 | Ga0373927_0052896 | Ga0373927_0052896_589_1509 | 247 |
| 9 | 3300035725 | Ga0373947_0145505 | Ga0373947_0145505_269_1189 | 247 |
| 10 | 3300037068 | Ga0373925_0113885 | Ga0373925_0113885_937_1857 | 247 |
| 11 | 3300037853 | Ga0436364_1412967 | Ga0436364_1412967_3165_4124 | 247 |
| 12 | 3300046533 | Ga0495640_0043411 | Ga0495640_0043411_498_1418 | 247 |
| 13 | 3300046543 | Ga0495645_0083199 | Ga0495645_0083199_789_1709 | 247 |
| 14 | 3300046680 | Ga0495646_0144311 | Ga0495646_0144311_343_1263 | 247 |
| 15 | 3300047319 | Ga0495674_0041734 | Ga0495674_0041734_1736_2656 | 247 |
| 16 | 3300053077 | Ga0495601_0097968 | Ga0495601_0097968_481_1401 | 247 |
| 17 | 3300053078 | Ga0495612_0105578 | Ga0495612_0105578_56_976 | 247 |
| 18 | 3300014325 | Ga0163163_10239745 | Ga0163163_102397452 | 250 |
| 19 | 3300005440 | Ga0070705_100035576 | Ga0070705_1000355763 | 251 |
| 20 | 3300005563 | Ga0068855_100189540 | Ga0068855_1001895402 | 251 |
| 21 | 3300005618 | Ga0068864_100014396 | Ga0068864_1000143968 | 251 |
| 22 | 3300005842 | Ga0068858_100029276 | Ga0068858_1000292765 | 251 |
| 23 | 3300005843 | Ga0068860_100055661 | Ga0068860_1000556614 | 251 |
| 24 | 3300006163 | Ga0070715_10054548 | Ga0070715_100545483 | 251 |
| 25 | 3300006173 | Ga0070716_100102093 | Ga0070716_1001020932 | 251 |
| 26 | 3300006237 | Ga0097621_100035115 | Ga0097621_1000351152 | 251 |
| 27 | 3300009098 | Ga0105245_10033622 | Ga0105245_100336223 | 251 |
| 28 | 3300009177 | Ga0105248_10025759 | Ga0105248_100257594 | 251 |
| 29 | 3300013296 | Ga0157374_10011887 | Ga0157374_100118872 | 251 |
| 30 | 3300013306 | Ga0163162_10015159 | Ga0163162_100151594 | 251 |
| 31 | 3300014325 | Ga0163163_10009484 | Ga0163163_100094845 | 251 |
| 32 | 3300014968 | Ga0157379_10001675 | Ga0157379_100016754 | 251 |
| 33 | 3300014969 | Ga0157376_10003702 | Ga0157376_100037027 | 251 |
| 34 | 3300025915 | Ga0207693_10370683 | Ga0207693_103706831 | 251 |
| 35 | 3300025916 | Ga0207663_10229975 | Ga0207663_102299752 | 251 |
| 36 | 3300025927 | Ga0207687_10094207 | Ga0207687_100942072 | 251 |
| 37 | 3300025939 | Ga0207665_10120555 | Ga0207665_101205552 | 251 |
| 38 | 3300026035 | Ga0207703_10018498 | Ga0207703_100184985 | 251 |
| 39 | 3300028379 | Ga0268266_10300569 | Ga0268266_103005692 | 251 |
| 40 | 3300028381 | Ga0268264_10067372 | Ga0268264_100673723 | 251 |
| 41 | 3300035089 | Ga0373944_0015391 | Ga0373944_0015391_458_1420 | 251 |
| 42 | 3300035111 | Ga0373923_0165885 | Ga0373923_0165885_36_998 | 251 |
| 43 | 3300035117 | Ga0373953_0041645 | Ga0373953_0041645_261_1223 | 251 |
| 44 | 3300035695 | Ga0373927_0220970 | Ga0373927_0220970_245_1207 | 251 |
| 45 | 3300046459 | Ga0495629_0017371 | Ga0495629_0017371_3677_4639 | 251 |
| 46 | 3300046476 | Ga0495662_0016489 | Ga0495662_0016489_1755_2717 | 251 |
| 47 | 3300046517 | Ga0495630_0169011 | Ga0495630_0169011_435_1397 | 251 |
| 48 | 3300046680 | Ga0495646_0114876 | Ga0495646_0114876_331_1293 | 251 |
| 49 | 3300046689 | Ga0495613_0167578 | Ga0495613_0167578_586_1548 | 251 |
| 50 | 3300046690 | Ga0495624_0021741 | Ga0495624_0021741_3220_4182 | 251 |
| 51 | 3300047322 | Ga0495680_0036485 | Ga0495680_0036485_23_985 | 251 |
| 52 | 3300048908 | Ga0496105_0003685 | Ga0496105_0003685_4105_5067 | 251 |
| 53 | 3300048911 | Ga0496108_0057256 | Ga0496108_0057256_876_1838 | 251 |
| 54 | 3300048912 | Ga0496109_0015830 | Ga0496109_0015830_3309_4271 | 251 |
| 55 | 3300048913 | Ga0496110_0027420 | Ga0496110_0027420_2433_3395 | 251 |
| 56 | 3300048915 | Ga0496112_0057654 | Ga0496112_0057654_1757_2719 | 251 |
| 57 | 3300048916 | Ga0496113_0139725 | Ga0496113_0139725_750_1712 | 251 |
| 58 | 3300053084 | Ga0495595_0045032 | Ga0495595_0045032_315_1277 | 251 |
| 59 | 3300006358 | Ga0068871_100041750 | Ga0068871_1000417502 | 252 |
| 60 | 3300022467 | Ga0224712_10006484 | Ga0224712_100064841 | 252 |
| 61 | 3300025922 | Ga0207646_10119222 | Ga0207646_101192221 | 252 |
| 62 | 3300036457 | Ga0265778_000468 | Ga0265778_000468_741_1700 | 252 |
| 63 | 3300046454 | Ga0495592_0009319 | Ga0495592_0009319_5236_6198 | 252 |
| 64 | 3300046462 | Ga0495651_0028321 | Ga0495651_0028321_268_1230 | 252 |
| 65 | 3300046514 | Ga0495618_0031817 | Ga0495618_0031817_1721_2683 | 252 |
| 66 | 3300046536 | Ga0495587_0002850 | Ga0495587_0002850_8789_9751 | 252 |
| 67 | 3300046663 | Ga0495635_0080946 | Ga0495635_0080946_800_1762 | 252 |
| 68 | 3300047317 | Ga0495604_0037228 | Ga0495604_0037228_2166_3128 | 252 |
| 69 | 3300025929 | Ga0207664_10139150 | Ga0207664_101391502 | 253 |
| 70 | 3300046531 | Ga0495665_0062716 | Ga0495665_0062716_592_1554 | 253 |
| 71 | 3300013102 | Ga0157371_10043952 | Ga0157371_100439523 | 255 |
| 72 | 3300013105 | Ga0157369_10425017 | Ga0157369_104250172 | 255 |
| 73 | 3300049742 | Ga0501080_0012819 | Ga0501080_0012819_1702_2589 | 255 |
| 74 | 3300049585 | Ga0501069_0002523 | Ga0501069_0002523_8225_9106 | 257 |
| 75 | 3300049742 | Ga0501080_0022894 | Ga0501080_0022894_2064_2945 | 257 |
| 76 | 3300005563 | Ga0068855_100017156 | Ga0068855_1000171567 | 258 |
| 77 | 3300025949 | Ga0207667_10011183 | Ga0207667_100111835 | 258 |
| 78 | 3300009094 | Ga0111539_10194655 | Ga0111539_101946553 | 259 |
| 79 | 3300020080 | Ga0206350_10244279 | Ga0206350_102442792 | 259 |
| 80 | 3300049569 | Ga0501032_0061960 | Ga0501032_0061960_92_973 | 259 |
| 81 | 3300049571 | Ga0501034_0637812 | Ga0501034_0637812_11_892 | 259 |
| 82 | 3300049573 | Ga0501037_0093935 | Ga0501037_0093935_95_976 | 259 |
| 83 | 3300049586 | Ga0501070_0002063 | Ga0501070_0002063_11002_11883 | 259 |
| 84 | 3300049823 | Ga0501044_0094513 | Ga0501044_0094513_105_986 | 259 |
| 85 | 3300050507 | nmdc:mga05p37_273697_c1 | nmdc:mga05p37_273697_c1_181_1092 | 259 |
| 86 | 3300050511 | nmdc:mga08y16_140681_c1 | nmdc:mga08y16_140681_c1_1346_2257 | 259 |
| 87 | 3300050512 | nmdc:mga0n895_42406_c1 | nmdc:mga0n895_42406_c1_53_964 | 259 |
| 88 | 3300050514 | nmdc:mga08x19_336396_c1 | nmdc:mga08x19_336396_c1_90_1001 | 259 |
| 89 | 3300050515 | nmdc:mga0a205_35041_c1 | nmdc:mga0a205_35041_c1_687_1598 | 259 |
| 90 | 3300005329 | Ga0070683_100308692 | Ga0070683_1003086923 | 260 |
| 91 | 3300005339 | Ga0070660_100068016 | Ga0070660_1000680163 | 260 |
| 92 | 3300005458 | Ga0070681_10069226 | Ga0070681_100692262 | 260 |
| 93 | 3300005530 | Ga0070679_100037400 | Ga0070679_1000374003 | 260 |
| 94 | 3300005563 | Ga0068855_100627992 | Ga0068855_1006279922 | 260 |
| 95 | 3300009174 | Ga0105241_10113546 | Ga0105241_101135463 | 260 |
| 96 | 3300022467 | Ga0224712_10019956 | Ga0224712_100199563 | 260 |
| 97 | 3300025912 | Ga0207707_10079568 | Ga0207707_100795685 | 260 |
| 98 | 3300025919 | Ga0207657_10043479 | Ga0207657_100434793 | 260 |
| 99 | 3300025921 | Ga0207652_10061120 | Ga0207652_100611205 | 260 |
| 100 | 3300025928 | Ga0207700_10210551 | Ga0207700_102105512 | 260 |
| 101 | 3300025929 | Ga0207664_10179605 | Ga0207664_101796052 | 260 |
| 102 | 3300025949 | Ga0207667_10554711 | Ga0207667_105547112 | 260 |
| 103 | 3300035083 | Ga0373926_0009765 | Ga0373926_0009765_1841_2830 | 260 |
| 104 | 3300035089 | Ga0373944_0001030 | Ga0373944_0001030_3097_4086 | 260 |
| 105 | 3300035113 | Ga0373936_0002035 | Ga0373936_0002035_68_1045 | 260 |
| 106 | 3300035116 | Ga0373945_0000661 | Ga0373945_0000661_5886_6875 | 260 |
| 107 | 3300035118 | Ga0373954_0082891 | Ga0373954_0082891_85_1002 | 260 |
| 108 | 3300035170 | Ga0373943_0000196 | Ga0373943_0000196_13432_14421 | 260 |
| 109 | 3300035171 | Ga0373946_0000087 | Ga0373946_0000087_7147_8136 | 260 |
| 110 | 3300035172 | Ga0373955_0076376 | Ga0373955_0076376_672_1661 | 260 |
| 111 | 3300035692 | Ga0373935_0000156 | Ga0373935_0000156_10133_11122 | 260 |
| 112 | 3300035695 | Ga0373927_0000769 | Ga0373927_0000769_17783_18772 | 260 |
| 113 | 3300035725 | Ga0373947_0003276 | Ga0373947_0003276_1235_2224 | 260 |
| 114 | 3300037068 | Ga0373925_0016247 | Ga0373925_0016247_3195_4184 | 260 |
| 115 | 3300046459 | Ga0495629_0164241 | Ga0495629_0164241_105_1094 | 260 |
| 116 | 3300046461 | Ga0495641_0019491 | Ga0495641_0019491_1572_2561 | 260 |
| 117 | 3300046463 | Ga0495653_0036149 | Ga0495653_0036149_726_1715 | 260 |
| 118 | 3300046473 | Ga0495582_0015398 | Ga0495582_0015398_2418_3407 | 260 |
| 119 | 3300046476 | Ga0495662_0071917 | Ga0495662_0071917_43_1020 | 260 |
| 120 | 3300046477 | Ga0495664_0001258 | Ga0495664_0001258_4861_5850 | 260 |
| 121 | 3300046517 | Ga0495630_0146762 | Ga0495630_0146762_90_1079 | 260 |
| 122 | 3300046663 | Ga0495635_0017678 | Ga0495635_0017678_2780_3769 | 260 |
| 123 | 3300046690 | Ga0495624_0006705 | Ga0495624_0006705_831_1820 | 260 |
| 124 | 3300047319 | Ga0495674_0008702 | Ga0495674_0008702_1415_2404 | 260 |
| 125 | 3300047321 | Ga0495676_0023855 | Ga0495676_0023855_3537_4526 | 260 |
| 126 | 3300047471 | Ga0495684_0052045 | Ga0495684_0052045_1200_2189 | 260 |
| 127 | 3300048912 | Ga0496109_0256657 | Ga0496109_0256657_470_1447 | 260 |
| 128 | 3300046531 | Ga0495665_0026429 | Ga0495665_0026429_1328_2317 | 261 |
| 129 | 3300046675 | Ga0495657_0024109 | Ga0495657_0024109_26_1015 | 261 |
| 130 | 3300005329 | Ga0070683_100153033 | Ga0070683_1001530332 | 262 |
| 131 | 3300046678 | Ga0495599_0130122 | Ga0495599_0130122_374_1294 | 263 |
| 132 | 3300025929 | Ga0207664_10005715 | Ga0207664_100057153 | 264 |
| 133 | 3300030763 | Ga0265763_1000078 | Ga0265763_10000786 | 265 |
| 134 | 3300030863 | Ga0265766_1000756 | Ga0265766_10007562 | 265 |
| 135 | 3300037418 | Ga0395900_0089555 | Ga0395900_0089555_1643_2569 | 265 |
| 136 | 3300037466 | Ga0395898_0060914 | Ga0395898_0060914_1018_1944 | 265 |
| 137 | 3300038443 | Ga0395901_0183782 | Ga0395901_0183782_1133_2059 | 265 |
| 138 | 3300039437 | Ga0436365_1085450 | Ga0436365_1085450_101_1084 | 265 |
| 139 | 3300044693 | Ga0466961_0011630 | Ga0466961_0011630_4163_5053 | 265 |
| 140 | 3300024225 | Ga0224572_1016075 | Ga0224572_10160752 | 267 |
| 141 | 3300046543 | Ga0495645_0120957 | Ga0495645_0120957_929_1828 | 267 |
| 142 | 3300059503 | Ga0587080_014515 | Ga0587080_014515_75_1031 | 267 |
| 143 | 3300060344 | Ga0587071_015606 | Ga0587071_015606_121_1077 | 267 |
| 144 | 3300005434 | Ga0070709_10087093 | Ga0070709_100870932 | 268 |
| 145 | 3300005435 | Ga0070714_100235424 | Ga0070714_1002354242 | 268 |
| 146 | 3300005436 | Ga0070713_100229113 | Ga0070713_1002291132 | 268 |
| 147 | 3300005437 | Ga0070710_10064946 | Ga0070710_100649462 | 268 |
| 148 | 3300005439 | Ga0070711_100019173 | Ga0070711_1000191733 | 268 |
| 149 | 3300005445 | Ga0070708_100000965 | Ga0070708_10000096514 | 268 |
| 150 | 3300005467 | Ga0070706_100002011 | Ga0070706_1000020119 | 268 |
| 151 | 3300005468 | Ga0070707_100078538 | Ga0070707_1000785385 | 268 |
| 152 | 3300005471 | Ga0070698_100001377 | Ga0070698_10000137721 | 268 |
| 153 | 3300005614 | Ga0068856_100015342 | Ga0068856_1000153425 | 268 |
| 154 | 3300006028 | Ga0070717_10011131 | Ga0070717_100111316 | 268 |
| 155 | 3300006173 | Ga0070716_100006177 | Ga0070716_1000061777 | 268 |
| 156 | 3300006175 | Ga0070712_100074824 | Ga0070712_1000748243 | 268 |
| 157 | 3300006358 | Ga0068871_100167932 | Ga0068871_1001679322 | 268 |
| 158 | 3300022467 | Ga0224712_10013831 | Ga0224712_100138312 | 268 |
| 159 | 3300025898 | Ga0207692_10001841 | Ga0207692_100018417 | 268 |
| 160 | 3300025905 | Ga0207685_10011476 | Ga0207685_100114763 | 268 |
| 161 | 3300025906 | Ga0207699_10005069 | Ga0207699_100050697 | 268 |
| 162 | 3300025910 | Ga0207684_10003525 | Ga0207684_1000352514 | 268 |
| 163 | 3300025915 | Ga0207693_10006056 | Ga0207693_100060569 | 268 |
| 164 | 3300025916 | Ga0207663_10046843 | Ga0207663_100468432 | 268 |
| 165 | 3300025922 | Ga0207646_10002744 | Ga0207646_100027444 | 268 |
| 166 | 3300025928 | Ga0207700_10011699 | Ga0207700_100116994 | 268 |
| 167 | 3300025929 | Ga0207664_10001623 | Ga0207664_100016236 | 268 |
| 168 | 3300025939 | Ga0207665_10004634 | Ga0207665_100046346 | 268 |
| 169 | 3300026078 | Ga0207702_10022216 | Ga0207702_100222165 | 268 |
| 170 | 3300048903 | Ga0496100_0177114 | Ga0496100_0177114_296_1264 | 268 |
| 171 | 3300048904 | Ga0496101_0086585 | Ga0496101_0086585_1174_2142 | 268 |
| 172 | 3300048907 | Ga0496104_0003397 | Ga0496104_0003397_10713_11681 | 268 |
| 173 | 3300048908 | Ga0496105_0005144 | Ga0496105_0005144_2230_3198 | 268 |
| 174 | 3300048909 | Ga0496106_0079158 | Ga0496106_0079158_1022_1990 | 268 |
| 175 | 3300048911 | Ga0496108_0011471 | Ga0496108_0011471_3725_4693 | 268 |
| 176 | 3300048912 | Ga0496109_0029692 | Ga0496109_0029692_97_1065 | 268 |
| 177 | 3300048915 | Ga0496112_0002182 | Ga0496112_0002182_6486_7454 | 268 |
| 178 | 3300048916 | Ga0496113_0015259 | Ga0496113_0015259_2931_3899 | 268 |
| 179 | 3300048917 | Ga0496114_0049174 | Ga0496114_0049174_2307_3275 | 268 |
| 180 | 3300048918 | Ga0496115_0112278 | Ga0496115_0112278_1039_2007 | 268 |
| 181 | 3300005344 | Ga0070661_100080768 | Ga0070661_1000807682 | 269 |
| 182 | 3300019192 | Ga0184603_125190 | Ga0184603_1251904 | 269 |
| 183 | 3300020070 | Ga0206356_10466239 | Ga0206356_104662393 | 269 |
| 184 | 3300020075 | Ga0206349_1440927 | Ga0206349_14409272 | 269 |
| 185 | 3300020076 | Ga0206355_1154318 | Ga0206355_11543183 | 269 |
| 186 | 3300022467 | Ga0224712_10011651 | Ga0224712_100116513 | 269 |
| 187 | 3300025920 | Ga0207649_10026680 | Ga0207649_100266804 | 269 |
| 188 | 3300026078 | Ga0207702_10073873 | Ga0207702_100738733 | 269 |
| 189 | 3300048912 | Ga0496109_0532442 | Ga0496109_0532442_21_935 | 269 |
| 190 | 3300005327 | Ga0070658_10004706 | Ga0070658_100047068 | 270 |
| 191 | 3300020077 | Ga0206351_10677736 | Ga0206351_106777363 | 270 |
| 192 | 3300036457 | Ga0265778_008040 | Ga0265778_008040_62_1042 | 270 |
| 193 | 3300005327 | Ga0070658_10000342 | Ga0070658_1000034227 | 271 |
| 194 | 3300005336 | Ga0070680_100001460 | Ga0070680_1000014607 | 271 |
| 195 | 3300005434 | Ga0070709_10000730 | Ga0070709_100007305 | 271 |
| 196 | 3300005435 | Ga0070714_100001418 | Ga0070714_1000014189 | 271 |
| 197 | 3300005436 | Ga0070713_100001109 | Ga0070713_10000110911 | 271 |
| 198 | 3300005437 | Ga0070710_10000747 | Ga0070710_100007473 | 271 |
| 199 | 3300005439 | Ga0070711_100000258 | Ga0070711_10000025824 | 271 |
| 200 | 3300005458 | Ga0070681_10001628 | Ga0070681_100016289 | 271 |
| 201 | 3300005467 | Ga0070706_100009310 | Ga0070706_1000093102 | 271 |
| 202 | 3300005471 | Ga0070698_100000873 | Ga0070698_10000087313 | 271 |
| 203 | 3300005530 | Ga0070679_100002684 | Ga0070679_1000026848 | 271 |
| 204 | 3300006028 | Ga0070717_10005146 | Ga0070717_1000514610 | 271 |
| 205 | 3300006173 | Ga0070716_100000222 | Ga0070716_1000002228 | 271 |
| 206 | 3300006175 | Ga0070712_100002878 | Ga0070712_1000028784 | 271 |
| 207 | 3300013105 | Ga0157369_10065520 | Ga0157369_100655204 | 271 |
| 208 | 3300025898 | Ga0207692_10001938 | Ga0207692_100019389 | 271 |
| 209 | 3300025906 | Ga0207699_10000105 | Ga0207699_1000010516 | 271 |
| 210 | 3300025910 | Ga0207684_10037605 | Ga0207684_100376052 | 271 |
| 211 | 3300025915 | Ga0207693_10001586 | Ga0207693_100015864 | 271 |
| 212 | 3300025928 | Ga0207700_10000050 | Ga0207700_1000005045 | 271 |
| 213 | 3300025929 | Ga0207664_10000101 | Ga0207664_1000010145 | 271 |
| 214 | 3300025939 | Ga0207665_10000438 | Ga0207665_1000043812 | 271 |
| 215 | 3300049585 | Ga0501069_0038616 | Ga0501069_0038616_82_1005 | 271 |
| 216 | 3300049586 | Ga0501070_0013674 | Ga0501070_0013674_553_1476 | 271 |
| 217 | 3300005530 | Ga0070679_100029381 | Ga0070679_1000293814 | 272 |
| 218 | 3300006058 | Ga0075432_10015854 | Ga0075432_100158543 | 272 |
| 219 | 3300006844 | Ga0075428_100019148 | Ga0075428_1000191485 | 272 |
| 220 | 3300006852 | Ga0075433_10004694 | Ga0075433_100046949 | 272 |
| 221 | 3300007076 | Ga0075435_100044365 | Ga0075435_1000443654 | 272 |
| 222 | 3300009147 | Ga0114129_10005268 | Ga0114129_1000526813 | 272 |
| 223 | 3300025921 | Ga0207652_10011619 | Ga0207652_100116195 | 272 |
| 224 | 3300025949 | Ga0207667_10117428 | Ga0207667_101174282 | 272 |
| 225 | 3300027907 | Ga0207428_10013659 | Ga0207428_100136593 | 272 |
| 226 | 3300005336 | Ga0070680_100043094 | Ga0070680_1000430945 | 273 |
| 227 | 3300005339 | Ga0070660_100044226 | Ga0070660_1000442262 | 273 |
| 228 | 3300005458 | Ga0070681_10040214 | Ga0070681_100402143 | 273 |
| 229 | 3300005530 | Ga0070679_100012806 | Ga0070679_1000128065 | 273 |
| 230 | 3300021377 | Ga0213874_10042386 | Ga0213874_100423862 | 273 |
| 231 | 3300025912 | Ga0207707_10033803 | Ga0207707_100338032 | 273 |
| 232 | 3300025919 | Ga0207657_10125928 | Ga0207657_101259283 | 273 |
| 233 | 3300039437 | Ga0436365_1064228 | Ga0436365_1064228_25_981 | 273 |
| 234 | 3300039450 | Ga0436363_1397682 | Ga0436363_1397682_248_1165 | 273 |
| 235 | 3300005336 | Ga0070680_100109385 | Ga0070680_1001093853 | 274 |
| 236 | 3300005345 | Ga0070692_10051706 | Ga0070692_100517062 | 274 |
| 237 | 3300005445 | Ga0070708_100037646 | Ga0070708_1000376463 | 274 |
| 238 | 3300005468 | Ga0070707_100551720 | Ga0070707_1005517202 | 274 |
| 239 | 3300025919 | Ga0207657_10095542 | Ga0207657_100955423 | 274 |
| 240 | 3300025932 | Ga0207690_10224890 | Ga0207690_102248902 | 274 |
| 241 | 3300039450 | Ga0436363_1387926 | Ga0436363_1387926_221_1180 | 274 |
| 242 | 3300045976 | Ga0466967_0071658 | Ga0466967_0071658_1831_2766 | 274 |
| 243 | 3300046517 | Ga0495630_0388216 | Ga0495630_0388216_82_1023 | 274 |
| 244 | 3300047471 | Ga0495684_0142020 | Ga0495684_0142020_842_1783 | 274 |
| 245 | 3300053084 | Ga0495595_0048133 | Ga0495595_0048133_158_1099 | 274 |
| 246 | 3300053085 | Ga0495619_0007509 | Ga0495619_0007509_845_1786 | 274 |
| 247 | 3300059652 | Ga0587107_005414 | Ga0587107_005414_119_1075 | 274 |
| 248 | 3300005467 | Ga0070706_100116969 | Ga0070706_1001169693 | 275 |
| 249 | 3300005467 | Ga0070706_100537313 | Ga0070706_1005373131 | 275 |
| 250 | 3300005471 | Ga0070698_100001007 | Ga0070698_10000100722 | 275 |
| 251 | 3300019183 | Ga0184601_125904 | Ga0184601_1259041 | 275 |
| 252 | 3300021388 | Ga0213875_10033071 | Ga0213875_100330712 | 275 |
| 253 | 3300025922 | Ga0207646_10458932 | Ga0207646_104589322 | 275 |
| 254 | 3300028666 | Ga0265336_10023060 | Ga0265336_100230603 | 275 |
| 255 | 3300028800 | Ga0265338_10000551 | Ga0265338_1000055143 | 275 |
| 256 | 3300028800 | Ga0265338_10006545 | Ga0265338_1000654510 | 275 |
| 257 | 3300030882 | Ga0265764_100145 | Ga0265764_1001454 | 275 |
| 258 | 3300030888 | Ga0265769_100062 | Ga0265769_1000623 | 275 |
| 259 | 3300031043 | Ga0265779_100587 | Ga0265779_1005872 | 275 |
| 260 | 3300037853 | Ga0436364_0765310 | Ga0436364_0765310_801_1790 | 275 |
| 261 | 3300049586 | Ga0501070_0213973 | Ga0501070_0213973_156_1079 | 275 |
| 262 | 3300005327 | Ga0070658_10196518 | Ga0070658_101965183 | 276 |
| 263 | 3300005338 | Ga0068868_100087677 | Ga0068868_1000876774 | 276 |
| 264 | 3300005435 | Ga0070714_100002728 | Ga0070714_1000027286 | 276 |
| 265 | 3300022467 | Ga0224712_10018943 | Ga0224712_100189432 | 276 |
| 266 | 3300025909 | Ga0207705_10198408 | Ga0207705_101984083 | 276 |
| 267 | 3300025929 | Ga0207664_10000914 | Ga0207664_1000091413 | 276 |
| 268 | 3300025949 | Ga0207667_10283875 | Ga0207667_102838752 | 276 |
| 269 | 3300031241 | Ga0265325_10043778 | Ga0265325_100437782 | 276 |
| 270 | 3300031247 | Ga0265340_10005572 | Ga0265340_100055727 | 276 |
| 271 | 3300039447 | Ga0436361_0396973 | Ga0436361_0396973_515_1531 | 276 |
| 272 | 3300048909 | Ga0496106_0266549 | Ga0496106_0266549_258_1262 | 276 |
| 273 | 3300006028 | Ga0070717_10050238 | Ga0070717_100502381 | 277 |
| 274 | 3300009545 | Ga0105237_10294998 | Ga0105237_102949982 | 277 |
| 275 | 3300013105 | Ga0157369_10069779 | Ga0157369_100697794 | 277 |
| 276 | 3300025914 | Ga0207671_10174289 | Ga0207671_101742892 | 277 |
| 277 | 3300035083 | Ga0373926_0000521 | Ga0373926_0000521_1903_2868 | 277 |
| 278 | 3300035171 | Ga0373946_0072371 | Ga0373946_0072371_488_1453 | 277 |
| 279 | 3300035692 | Ga0373935_0001541 | Ga0373935_0001541_11815_12780 | 277 |
| 280 | 3300035725 | Ga0373947_0000002 | Ga0373947_0000002_347029_347994 | 277 |
| 281 | 3300036401 | Ga0373937_0121546 | Ga0373937_0121546_384_1349 | 277 |
| 282 | 3300046536 | Ga0495587_0130722 | Ga0495587_0130722_203_1168 | 277 |
| 283 | 3300048088 | Ga0495602_0066372 | Ga0495602_0066372_296_1261 | 277 |
| 284 | 3300005435 | Ga0070714_100017374 | Ga0070714_1000173743 | 278 |
| 285 | 3300025909 | Ga0207705_10098270 | Ga0207705_100982703 | 278 |
| 286 | 3300025928 | Ga0207700_10050343 | Ga0207700_100503434 | 278 |
| 287 | 3300025929 | Ga0207664_10044397 | Ga0207664_100443973 | 278 |
| 288 | 3300044684 | Ga0466966_0062756 | Ga0466966_0062756_471_1400 | 278 |
| 289 | 3300044693 | Ga0466961_0025159 | Ga0466961_0025159_1297_2226 | 278 |
| 290 | 3300045049 | Ga0466959_0043568 | Ga0466959_0043568_604_1533 | 278 |
| 291 | 3300048929 | Ga0496126_0019004 | Ga0496126_0019004_4484_5464 | 278 |
| 292 | 3300059493 | Ga0587077_010288 | Ga0587077_010288_247_1203 | 279 |
| 293 | 3300005435 | Ga0070714_100271945 | Ga0070714_1002719451 | 280 |
| 294 | 3300005436 | Ga0070713_100117803 | Ga0070713_1001178032 | 280 |
| 295 | 3300009093 | Ga0105240_10005320 | Ga0105240_1000532011 | 280 |
| 296 | 3300009174 | Ga0105241_10013190 | Ga0105241_100131903 | 280 |
| 297 | 3300009545 | Ga0105237_10018224 | Ga0105237_100182247 | 280 |
| 298 | 3300009551 | Ga0105238_10090280 | Ga0105238_100902803 | 280 |
| 299 | 3300010375 | Ga0105239_10008718 | Ga0105239_100087186 | 280 |
| 300 | 3300044656 | Ga0466969_0048136 | Ga0466969_0048136_722_1609 | 280 |
| 301 | 3300044693 | Ga0466961_0053152 | Ga0466961_0053152_1185_2072 | 280 |
| 302 | 3300044765 | Ga0466970_0024887 | Ga0466970_0024887_224_1111 | 280 |
| 303 | 3300045049 | Ga0466959_0091953 | Ga0466959_0091953_760_1647 | 280 |
| 304 | 3300005327 | Ga0070658_10000108 | Ga0070658_1000010812 | 281 |
| 305 | 3300005336 | Ga0070680_100046675 | Ga0070680_1000466752 | 281 |
| 306 | 3300005455 | Ga0070663_100060264 | Ga0070663_1000602641 | 281 |
| 307 | 3300006028 | Ga0070717_10092936 | Ga0070717_100929362 | 281 |
| 308 | 3300020077 | Ga0206351_10697985 | Ga0206351_106979851 | 281 |
| 309 | 3300022467 | Ga0224712_10026621 | Ga0224712_100266211 | 281 |
| 310 | 3300025909 | Ga0207705_10000394 | Ga0207705_1000039434 | 281 |
| 311 | 3300025917 | Ga0207660_10030998 | Ga0207660_100309985 | 281 |
| 312 | 3300026067 | Ga0207678_10003714 | Ga0207678_100037147 | 281 |
| 313 | 3300033547 | Ga0316212_1003717 | Ga0316212_10037173 | 281 |
| 314 | 3300044684 | Ga0466966_0067090 | Ga0466966_0067090_96_1025 | 281 |
| 315 | 3300044693 | Ga0466961_0029022 | Ga0466961_0029022_638_1567 | 281 |
| 316 | 3300006173 | Ga0070716_100027978 | Ga0070716_1000279783 | 282 |
| 317 | 3300021388 | Ga0213875_10039817 | Ga0213875_100398172 | 282 |
| 318 | 3300025939 | Ga0207665_10004822 | Ga0207665_100048223 | 282 |
| 319 | 3300037853 | Ga0436364_0398528 | Ga0436364_0398528_1847_2914 | 282 |
| 320 | 3300048923 | Ga0496120_0185470 | Ga0496120_0185470_43_954 | 282 |
| 321 | 3300003659 | JGI25404J52841_10001562 | JGI25404J52841_100015624 | 283 |
| 322 | 3300004798 | Ga0058859_11732587 | Ga0058859_117325872 | 283 |
| 323 | 3300004799 | Ga0058863_10129332 | Ga0058863_101293322 | 283 |
| 324 | 3300004801 | Ga0058860_12247198 | Ga0058860_122471982 | 283 |
| 325 | 3300005327 | Ga0070658_10032228 | Ga0070658_100322284 | 283 |
| 326 | 3300005329 | Ga0070683_100050455 | Ga0070683_1000504554 | 283 |
| 327 | 3300005335 | Ga0070666_10028984 | Ga0070666_100289844 | 283 |
| 328 | 3300005340 | Ga0070689_100065769 | Ga0070689_1000657694 | 283 |
| 329 | 3300005343 | Ga0070687_100079025 | Ga0070687_1000790252 | 283 |
| 330 | 3300005344 | Ga0070661_100117256 | Ga0070661_1001172563 | 283 |
| 331 | 3300005347 | Ga0070668_100108777 | Ga0070668_1001087772 | 283 |
| 332 | 3300005353 | Ga0070669_100162162 | Ga0070669_1001621622 | 283 |
| 333 | 3300005354 | Ga0070675_100025930 | Ga0070675_1000259306 | 283 |
| 334 | 3300005355 | Ga0070671_100092252 | Ga0070671_1000922521 | 283 |
| 335 | 3300005356 | Ga0070674_100054858 | Ga0070674_1000548583 | 283 |
| 336 | 3300005365 | Ga0070688_100071033 | Ga0070688_1000710332 | 283 |
| 337 | 3300005456 | Ga0070678_100116393 | Ga0070678_1001163932 | 283 |
| 338 | 3300005457 | Ga0070662_100065088 | Ga0070662_1000650882 | 283 |
| 339 | 3300005466 | Ga0070685_10021215 | Ga0070685_100212154 | 283 |
| 340 | 3300005467 | Ga0070706_100297305 | Ga0070706_1002973052 | 283 |
| 341 | 3300005468 | Ga0070707_100396357 | Ga0070707_1003963571 | 283 |
| 342 | 3300005543 | Ga0070672_100031823 | Ga0070672_1000318234 | 283 |
| 343 | 3300005547 | Ga0070693_100062953 | Ga0070693_1000629533 | 283 |
| 344 | 3300005549 | Ga0070704_100034422 | Ga0070704_1000344224 | 283 |
| 345 | 3300005564 | Ga0070664_100079660 | Ga0070664_1000796602 | 283 |
| 346 | 3300005578 | Ga0068854_100178249 | Ga0068854_1001782492 | 283 |
| 347 | 3300005615 | Ga0070702_100038952 | Ga0070702_1000389523 | 283 |
| 348 | 3300005617 | Ga0068859_100143263 | Ga0068859_1001432633 | 283 |
| 349 | 3300005618 | Ga0068864_100024739 | Ga0068864_1000247397 | 283 |
| 350 | 3300005844 | Ga0068862_100059655 | Ga0068862_1000596554 | 283 |
| 351 | 3300005983 | Ga0081540_1000134 | Ga0081540_100013456 | 283 |
| 352 | 3300006931 | Ga0097620_100143244 | Ga0097620_1001432443 | 283 |
| 353 | 3300009036 | Ga0105244_10035853 | Ga0105244_100358532 | 283 |
| 354 | 3300009093 | Ga0105240_10084936 | Ga0105240_100849363 | 283 |
| 355 | 3300009148 | Ga0105243_10072682 | Ga0105243_100726822 | 283 |
| 356 | 3300013307 | Ga0157372_10038454 | Ga0157372_100384543 | 283 |
| 357 | 3300014326 | Ga0157380_10137701 | Ga0157380_101377013 | 283 |
| 358 | 3300017792 | Ga0163161_10079115 | Ga0163161_100791152 | 283 |
| 359 | 3300020081 | Ga0206354_11029550 | Ga0206354_110295503 | 283 |
| 360 | 3300025885 | Ga0207653_10012142 | Ga0207653_100121424 | 283 |
| 361 | 3300025901 | Ga0207688_10012880 | Ga0207688_100128802 | 283 |
| 362 | 3300025904 | Ga0207647_10013505 | Ga0207647_100135056 | 283 |
| 363 | 3300025906 | Ga0207699_10116594 | Ga0207699_101165942 | 283 |
| 364 | 3300025908 | Ga0207643_10016854 | Ga0207643_100168543 | 283 |
| 365 | 3300025909 | Ga0207705_10086942 | Ga0207705_100869422 | 283 |
| 366 | 3300025912 | Ga0207707_10213989 | Ga0207707_102139892 | 283 |
| 367 | 3300025918 | Ga0207662_10019958 | Ga0207662_100199585 | 283 |
| 368 | 3300025919 | Ga0207657_10015156 | Ga0207657_100151566 | 283 |
| 369 | 3300025921 | Ga0207652_10034465 | Ga0207652_100344653 | 283 |
| 370 | 3300025926 | Ga0207659_10127182 | Ga0207659_101271823 | 283 |
| 371 | 3300025928 | Ga0207700_10013214 | Ga0207700_100132144 | 283 |
| 372 | 3300025929 | Ga0207664_10040805 | Ga0207664_100408053 | 283 |
| 373 | 3300025933 | Ga0207706_10045392 | Ga0207706_100453922 | 283 |
| 374 | 3300025935 | Ga0207709_10088663 | Ga0207709_100886632 | 283 |
| 375 | 3300025937 | Ga0207669_10048334 | Ga0207669_100483342 | 283 |
| 376 | 3300025938 | Ga0207704_10162396 | Ga0207704_101623963 | 283 |
| 377 | 3300025940 | Ga0207691_10010556 | Ga0207691_100105569 | 283 |
| 378 | 3300025942 | Ga0207689_10005438 | Ga0207689_100054387 | 283 |
| 379 | 3300025944 | Ga0207661_10228934 | Ga0207661_102289342 | 283 |
| 380 | 3300025961 | Ga0207712_10205816 | Ga0207712_102058161 | 283 |
| 381 | 3300025972 | Ga0207668_10042538 | Ga0207668_100425383 | 283 |
| 382 | 3300026035 | Ga0207703_10051994 | Ga0207703_100519942 | 283 |
| 383 | 3300026067 | Ga0207678_10012193 | Ga0207678_100121936 | 283 |
| 384 | 3300026075 | Ga0207708_10006954 | Ga0207708_100069548 | 283 |
| 385 | 3300026095 | Ga0207676_10080475 | Ga0207676_100804753 | 283 |
| 386 | 3300026116 | Ga0207674_10010202 | Ga0207674_100102029 | 283 |
| 387 | 3300026118 | Ga0207675_100027441 | Ga0207675_1000274414 | 283 |
| 388 | 3300026121 | Ga0207683_10010628 | Ga0207683_100106289 | 283 |
| 389 | 3300026142 | Ga0207698_10114194 | Ga0207698_101141942 | 283 |
| 390 | 3300028380 | Ga0268265_10238836 | Ga0268265_102388362 | 283 |
| 391 | 3300034957 | Ga0373938_0007985 | Ga0373938_0007985_665_1627 | 283 |
| 392 | 3300035084 | Ga0373928_0014196 | Ga0373928_0014196_348_1310 | 283 |
| 393 | 3300035091 | Ga0373951_0008653 | Ga0373951_0008653_896_1858 | 283 |
| 394 | 3300045976 | Ga0466967_0295678 | Ga0466967_0295678_514_1389 | 283 |
| 395 | 3300046453 | Ga0495627_039445 | Ga0495627_039445_432_1292 | 283 |
| 396 | 3300046477 | Ga0495664_0101527 | Ga0495664_0101527_644_1603 | 283 |
| 397 | 3300048913 | Ga0496110_0043235 | Ga0496110_0043235_2519_3481 | 283 |
| 398 | 3300048915 | Ga0496112_0163551 | Ga0496112_0163551_651_1613 | 283 |
| 399 | 3300049590 | Ga0501074_0305166 | Ga0501074_0305166_84_1004 | 283 |
| 400 | 3300059493 | Ga0587077_013252 | Ga0587077_013252_349_1311 | 283 |
| 401 | 3300059512 | Ga0587092_011728 | Ga0587092_011728_195_1157 | 283 |
| 402 | 3300059628 | Ga0587122_002013 | Ga0587122_002013_244_1206 | 283 |
| 403 | 3300059655 | Ga0587114_004468 | Ga0587114_004468_161_1123 | 283 |
| 404 | 3300060344 | Ga0587071_008214 | Ga0587071_008214_392_1354 | 283 |
| 405 | 3300013105 | Ga0157369_10015418 | Ga0157369_100154187 | 284 |
| 406 | 3300020069 | Ga0197907_11323763 | Ga0197907_113237634 | 284 |
| 407 | 3300020070 | Ga0206356_10155563 | Ga0206356_101555635 | 284 |
| 408 | 3300020075 | Ga0206349_1031490 | Ga0206349_10314902 | 284 |
| 409 | 3300020075 | Ga0206349_1196369 | Ga0206349_11963693 | 284 |
| 410 | 3300020077 | Ga0206351_10069119 | Ga0206351_100691193 | 284 |
| 411 | 3300020080 | Ga0206350_11022604 | Ga0206350_110226043 | 284 |
| 412 | 3300020080 | Ga0206350_11036766 | Ga0206350_110367663 | 284 |
| 413 | 3300020610 | Ga0154015_1066679 | Ga0154015_10666793 | 284 |
| 414 | 3300022467 | Ga0224712_10003796 | Ga0224712_100037962 | 284 |
| 415 | 3300025909 | Ga0207705_10001806 | Ga0207705_100018068 | 284 |
| 416 | 3300020069 | Ga0197907_11185792 | Ga0197907_111857923 | 285 |
| 417 | 3300020070 | Ga0206356_10039243 | Ga0206356_100392433 | 285 |
| 418 | 3300020077 | Ga0206351_10852899 | Ga0206351_108528993 | 285 |
| 419 | 3300020078 | Ga0206352_10883012 | Ga0206352_108830121 | 285 |
| 420 | 3300020080 | Ga0206350_10002456 | Ga0206350_100024562 | 285 |
| 421 | 3300020081 | Ga0206354_10960839 | Ga0206354_109608395 | 285 |
| 422 | 3300020082 | Ga0206353_10836602 | Ga0206353_1083660215 | 285 |
| 423 | 3300022467 | Ga0224712_10016527 | Ga0224712_100165272 | 285 |
| 424 | 3300025909 | Ga0207705_10000597 | Ga0207705_100005978 | 285 |
| 425 | 3300025912 | Ga0207707_10000983 | Ga0207707_1000098311 | 285 |
| 426 | 3300025917 | Ga0207660_10000164 | Ga0207660_1000016412 | 285 |
| 427 | 3300025921 | Ga0207652_10000702 | Ga0207652_100007029 | 285 |
| 428 | 3300035086 | Ga0373934_0121123 | Ga0373934_0121123_14_973 | 285 |
| 429 | 3300046477 | Ga0495664_0060507 | Ga0495664_0060507_420_1379 | 285 |
| 430 | 3300046529 | Ga0495652_0121486 | Ga0495652_0121486_273_1232 | 285 |
| 431 | 3300046559 | Ga0495667_0043387 | Ga0495667_0043387_71_1030 | 285 |
| 432 | 3300046675 | Ga0495657_0034081 | Ga0495657_0034081_2547_3506 | 285 |
| 433 | 3300047471 | Ga0495684_0171839 | Ga0495684_0171839_129_1088 | 285 |
| 434 | 3300048088 | Ga0495602_0100156 | Ga0495602_0100156_162_1121 | 285 |
| 435 | 3300053085 | Ga0495619_0130742 | Ga0495619_0130742_188_1147 | 285 |
| 436 | 3300003320 | rootH2_10098903 | rootH2_100989033 | 286 |
| 437 | 3300006173 | Ga0070716_100020861 | Ga0070716_1000208614 | 286 |
| 438 | 3300025906 | Ga0207699_10083896 | Ga0207699_100838962 | 286 |
| 439 | 3300025939 | Ga0207665_10005172 | Ga0207665_100051723 | 286 |
| 440 | 3300028800 | Ga0265338_10005567 | Ga0265338_1000556715 | 286 |
| 441 | 3300028800 | Ga0265338_10228510 | Ga0265338_102285102 | 286 |
| 442 | 3300006028 | Ga0070717_10474984 | Ga0070717_104749841 | 289 |
| 443 | 3300005467 | Ga0070706_100051618 | Ga0070706_1000516183 | 290 |
| 444 | 3300020080 | Ga0206350_11604676 | Ga0206350_116046763 | 290 |
| 445 | 3300022467 | Ga0224712_10022654 | Ga0224712_100226542 | 290 |
| 446 | 3300025910 | Ga0207684_10042959 | Ga0207684_100429593 | 290 |
| 447 | 3300025915 | Ga0207693_10104250 | Ga0207693_101042502 | 290 |
| 448 | 3300005468 | Ga0070707_100004535 | Ga0070707_10000453512 | 293 |
| 449 | 3300005563 | Ga0068855_100007431 | Ga0068855_10000743110 | 294 |
| 450 | 3300005578 | Ga0068854_100006361 | Ga0068854_1000063613 | 294 |
| 451 | 3300005614 | Ga0068856_100176186 | Ga0068856_1001761863 | 294 |
| 452 | 3300005616 | Ga0068852_100007902 | Ga0068852_1000079027 | 294 |
| 453 | 3300020070 | Ga0206356_11766282 | Ga0206356_117662821 | 294 |
| 454 | 3300025904 | Ga0207647_10013702 | Ga0207647_100137024 | 294 |
| 455 | 3300025911 | Ga0207654_10013416 | Ga0207654_100134164 | 294 |
| 456 | 3300025913 | Ga0207695_10001690 | Ga0207695_100016907 | 294 |
| 457 | 3300025914 | Ga0207671_10000619 | Ga0207671_100006199 | 294 |
| 458 | 3300025924 | Ga0207694_10002705 | Ga0207694_100027059 | 294 |
| 459 | 3300025981 | Ga0207640_10003813 | Ga0207640_100038133 | 294 |
| 460 | 3300026041 | Ga0207639_10045770 | Ga0207639_100457702 | 294 |
| 461 | 3300026142 | Ga0207698_10061370 | Ga0207698_100613703 | 294 |
| 462 | 3300028379 | Ga0268266_10125797 | Ga0268266_101257971 | 294 |
| 463 | 3300005435 | Ga0070714_100148542 | Ga0070714_1001485423 | 296 |
| 464 | 3300005435 | Ga0070714_100502295 | Ga0070714_1005022951 | 296 |
| 465 | 3300005439 | Ga0070711_100058287 | Ga0070711_1000582873 | 296 |
| 466 | 3300006173 | Ga0070716_100060605 | Ga0070716_1000606053 | 296 |
| 467 | 3300006175 | Ga0070712_100034455 | Ga0070712_1000344553 | 296 |
| 468 | 3300022467 | Ga0224712_10103175 | Ga0224712_101031751 | 296 |
| 469 | 3300025916 | Ga0207663_10071671 | Ga0207663_100716713 | 296 |
| 470 | 3300025929 | Ga0207664_10441137 | Ga0207664_104411371 | 296 |
| 471 | 3300025939 | Ga0207665_10083238 | Ga0207665_100832383 | 296 |
| 472 | 3300035398 | Ga0316574_0004885 | Ga0316574_0004885_4117_5013 | 296 |
| 473 | 3300036401 | Ga0373937_0245837 | Ga0373937_0245837_119_1075 | 296 |
| 474 | 3300001989 | JGI24739J22299_10010913 | JGI24739J22299_100109132 | 297 |
| 475 | 3300001989 | JGI24739J22299_10033568 | JGI24739J22299_100335682 | 297 |
| 476 | 3300005367 | Ga0070667_100038678 | Ga0070667_1000386784 | 297 |
| 477 | 3300005548 | Ga0070665_100065650 | Ga0070665_1000656503 | 297 |
| 478 | 3300005577 | Ga0068857_100518037 | Ga0068857_1005180371 | 297 |
| 479 | 3300010375 | Ga0105239_10267009 | Ga0105239_102670093 | 297 |
| 480 | 3300013307 | Ga0157372_10307956 | Ga0157372_103079562 | 297 |
| 481 | 3300022467 | Ga0224712_10053006 | Ga0224712_100530062 | 297 |
| 482 | 3300025904 | Ga0207647_10035051 | Ga0207647_100350513 | 297 |
| 483 | 3300025904 | Ga0207647_10088176 | Ga0207647_100881763 | 297 |
| 484 | 3300025986 | Ga0207658_10251881 | Ga0207658_102518811 | 297 |
| 485 | 3300026116 | Ga0207674_10056090 | Ga0207674_100560904 | 297 |
| 486 | 3300028379 | Ga0268266_10050358 | Ga0268266_100503583 | 297 |
| 487 | 3300028556 | Ga0265337_1000373 | Ga0265337_100037313 | 297 |
| 488 | 3300028786 | Ga0307517_10213195 | Ga0307517_102131952 | 297 |
| 489 | 3300031456 | Ga0307513_10396744 | Ga0307513_103967442 | 297 |
| 490 | 3300044684 | Ga0466966_0056957 | Ga0466966_0056957_533_1456 | 297 |
| 491 | 3300046529 | Ga0495652_0130947 | Ga0495652_0130947_427_1389 | 297 |
| 492 | 3300049586 | Ga0501070_0081591 | Ga0501070_0081591_470_1390 | 297 |
| 493 | 3300053077 | Ga0495601_0021489 | Ga0495601_0021489_496_1458 | 297 |
| 494 | 3300053078 | Ga0495612_0011274 | Ga0495612_0011274_1315_2277 | 297 |
| 495 | iso_pu_bacteria | 2895880812 | 2895883704 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cqb-assembly1.cif.gz_A | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.8905 | 69 | 149 |
| 3cqb-assembly1.cif.gz_B | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.8719 | 62 | 146 |
| 3cqb-assembly1.cif.gz_B | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.7356 | 62 | 146 |
| 3cqb-assembly1.cif.gz_A | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.7027 | 69 | 149 |
| 4qhj-assembly1.cif.gz_B | crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f | 0.6935 | 77 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS5_62_152_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9745 | 67 | 156 | 3.30.2010.10 |
| af_Q59076_58_147_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9623 | 69 | 155 | 3.30.2010.10 |
| af_P9WHS5_62_152_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9537 | 67 | 156 | 3.30.2010.10 |
| af_P23894_64_157_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9422 | 77 | 155 | 3.30.2010.10 |
| af_Q59076_58_147_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9211 | 69 | 155 | 3.30.2010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3I2P7-F1-model_v4 | M48 family metalloprotease | 0.9902 | 61 | 150 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A528D7J6-F1-model_v4 | Protease HtpX | 0.9774 | 68 | 145 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A6I1IQ61-F1-model_v4 | deleted | 0.9178 | 45 | 155 |
|
| AF-A0A7C2FZA4-F1-model_v4 | Protease HtpX homolog (EC 3.4.24.-) | 0.9155 | 4 | 292 |
GO:0004222
GO:0005886 GO:0006508 GO:0008270 |
| AF-A0A0W1R2Z5-F1-model_v4 | Heat-shock protein HtpX | 0.9125 | 6 | 294 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar