F454756

General Info

Members Datasets Scaffolds Average Seq Length
495 244 495 201

Family's Representative Sequence

Representative Sequence 3300042436|Ga0439435_0000207|Ga0439435_0000207_2289_2915
Length 208
Sequence MYSPAYNRLEDRAELLEFMRANSFVVLVTGTGGTLHASHLPAMVHDDNGAIRVDMHMARANPQWKEFFDDEEVLVVFPGPHAYISPRWYEEQERVPTWNYAAVHAYGTPKVIDDKNLKLQSQRRLIVTLDPQWLARFDALRREYVDRMLDGIVNFEIALTRIDTRWKLSQNRSRREQELIVSELERSADSGERALAALTRKHFIDKSE

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
122 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
123 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
155 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
156 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.2
Rhizosphere 99.39
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10105527 3300003322 Bacteria 1066
2 Ga0065707_10104596 3300005295 Bacteria 2687
3 Ga0065707_10180152 3300005295 Bacteria 1423
4 Ga0065707_10239471 3300005295 Bacteria 1161
5 Ga0065707_10294643 3300005295 Unclassified 1017
6 Ga0065707_10431917 3300005295 Bacteria 819
7 Ga0070690_100001328 3300005330 Bacteria 12864
8 Ga0070690_100002214 3300005330 Bacteria 10410
9 Ga0070690_100252918 3300005330 Unclassified 1247
10 Ga0070690_100860031 3300005330 Bacteria 707
11 Ga0068869_100008574 3300005334 Bacteria 6599
12 Ga0068869_100073363 3300005334 Bacteria 2537
13 Ga0068869_100079733 3300005334 Bacteria 2440
14 Ga0070666_10295461 3300005335 Bacteria 1153
15 Ga0070680_100087808 3300005336 Bacteria 2572
16 Ga0070680_100437291 3300005336 Bacteria 1117
17 Ga0070680_100844142 3300005336 Bacteria 790
18 Ga0068868_100001141 3300005338 Bacteria 18157
19 Ga0070689_100053625 3300005340 Bacteria 3121
20 Ga0070689_100055194 3300005340 Bacteria 3077
21 Ga0070689_100381098 3300005340 Unclassified 1188
22 Ga0070689_100533008 3300005340 Bacteria 1010
23 Ga0070691_10010497 3300005341 Bacteria 4227
24 Ga0070687_100006271 3300005343 Bacteria 4868
25 Ga0070669_100002686 3300005353 Bacteria 12816
26 Ga0070675_100078436 3300005354 Bacteria 2750
27 Ga0070688_100124066 3300005365 Bacteria 1734
28 Ga0070688_100434965 3300005365 Bacteria 978
29 Ga0070710_10072868 3300005437 Bacteria 1984
30 Ga0070701_10158795 3300005438 Bacteria 1308
31 Ga0070701_10249183 3300005438 Bacteria 1072
32 Ga0070701_10615751 3300005438 Bacteria 721
33 Ga0070705_100001299 3300005440 Bacteria 13380
34 Ga0070705_100039635 3300005440 Bacteria 2674
35 Ga0070705_100090870 3300005440 Bacteria 1901
36 Ga0070705_100125195 3300005440 Bacteria 1666
37 Ga0070705_100591854 3300005440 Bacteria 857
38 Ga0070700_100000811 3300005441 Bacteria 15345
39 Ga0070694_100000228 3300005444 Bacteria 29562
40 Ga0070694_100070922 3300005444 Bacteria 2400
41 Ga0070694_100080937 3300005444 Bacteria 2258
42 Ga0070694_100144360 3300005444 Bacteria 1732
43 Ga0070694_100334684 3300005444 Bacteria 1169
44 Ga0070694_100608698 3300005444 Bacteria 880
45 Ga0070708_100089590 3300005445 Bacteria 2799
46 Ga0070662_100193962 3300005457 Bacteria 1608
47 Ga0070681_10010051 3300005458 Bacteria 9328
48 Ga0070681_10098643 3300005458 Bacteria 2868
49 Ga0068867_100007400 3300005459 Bacteria 7767
50 Ga0068867_100838442 3300005459 Bacteria 823
51 Ga0070706_100773585 3300005467 Bacteria 889
52 Ga0070707_100581987 3300005468 Bacteria 1082
53 Ga0070698_100280526 3300005471 Bacteria 1597
54 Ga0070698_100329462 3300005471 Bacteria 1458
55 Ga0070699_101050227 3300005518 Bacteria 747
56 Ga0070679_100041906 3300005530 Bacteria 4558
57 Ga0070697_100624823 3300005536 Unclassified 948
58 Ga0070697_100649393 3300005536 Bacteria 929
59 Ga0068853_100457588 3300005539 Bacteria 1201
60 Ga0068853_100695122 3300005539 Bacteria 970
61 Ga0070686_100001157 3300005544 Bacteria 15083
62 Ga0070695_100000894 3300005545 Bacteria 16086
63 Ga0070695_100049301 3300005545 Bacteria 2696
64 Ga0070695_100556696 3300005545 Bacteria 895
65 Ga0070696_100001064 3300005546 Bacteria 17754
66 Ga0070696_100003592 3300005546 Bacteria 10330
67 Ga0070696_100728180 3300005546 Bacteria 811
68 Ga0070704_100006688 3300005549 Bacteria 6817
69 Ga0070704_100010611 3300005549 Bacteria 5610
70 Ga0070704_100023368 3300005549 Bacteria 4037
71 Ga0070704_100056281 3300005549 Bacteria 2792
72 Ga0070704_100487125 3300005549 Unclassified 1068
73 Ga0070704_100579692 3300005549 Bacteria 984
74 Ga0068855_100003762 3300005563 Bacteria 18547
75 Ga0070664_101139966 3300005564 Unclassified 735
76 Ga0068854_100007628 3300005578 Bacteria 6922
77 Ga0068854_100572229 3300005578 Bacteria 961
78 Ga0068856_100059469 3300005614 Bacteria 3774
79 Ga0068856_100233765 3300005614 Bacteria 1853
80 Ga0070702_100009678 3300005615 Bacteria 4728
81 Ga0070702_100083726 3300005615 Bacteria 1917
82 Ga0070702_100441404 3300005615 Bacteria 942
83 Ga0068852_100129477 3300005616 Bacteria 2322
84 Ga0068859_100002466 3300005617 Bacteria 18828
85 Ga0068859_100018776 3300005617 Bacteria 6949
86 Ga0068859_100043368 3300005617 Bacteria 4520
87 Ga0068859_100330433 3300005617 Bacteria 1618
88 Ga0068859_100404238 3300005617 Bacteria 1461
89 Ga0068859_101744624 3300005617 Unclassified 688
90 Ga0068864_100109514 3300005618 Bacteria 2459
91 Ga0068866_10000302 3300005718 Bacteria 23469
92 Ga0068866_10020429 3300005718 Bacteria 3035
93 Ga0068861_100001497 3300005719 Bacteria 14824
94 Ga0068863_100233476 3300005841 Bacteria 1774
95 Ga0068858_100068217 3300005842 Bacteria 3295
96 Ga0068858_100091609 3300005842 Bacteria 2829
97 Ga0068860_100006346 3300005843 Bacteria 11866
98 Ga0068860_100685257 3300005843 Bacteria 1034
99 Ga0068862_100007142 3300005844 Bacteria 9273
100 Ga0068862_100014269 3300005844 Bacteria 6589
101 Ga0068862_100031702 3300005844 Bacteria 4464
102 Ga0068871_100095258 3300006358 Bacteria 2486
103 Ga0068871_100549682 3300006358 Bacteria 1046
104 Ga0075428_100001160 3300006844 Bacteria 28222
105 Ga0075428_100021094 3300006844 Bacteria 7216
106 Ga0075430_100000581 3300006846 Bacteria 27790
107 Ga0075430_100070152 3300006846 Bacteria 2939
108 Ga0075430_100145205 3300006846 Bacteria 1976
109 Ga0075431_100008854 3300006847 Bacteria 10085
110 Ga0075431_100011722 3300006847 Bacteria 8843
111 Ga0075431_100039502 3300006847 Bacteria 4861
112 Ga0075431_100041534 3300006847 Bacteria 4741
113 Ga0075433_10004298 3300006852 Bacteria 11067
114 Ga0075433_10021629 3300006852 Bacteria 5396
115 Ga0075433_10073148 3300006852 Bacteria 3015
116 Ga0075434_100004987 3300006871 Bacteria 12043
117 Ga0075434_100467522 3300006871 Bacteria 1282
118 Ga0075429_100000617 3300006880 Bacteria 27413
119 Ga0075429_100001710 3300006880 Bacteria 18147
120 Ga0075429_100110891 3300006880 Bacteria 2398
121 Ga0075429_100122601 3300006880 Bacteria 2272
122 Ga0075429_100862107 3300006880 Bacteria 793
123 Ga0068865_100002724 3300006881 Bacteria 10488
124 Ga0075436_100000152 3300006914 Bacteria 42960
125 Ga0075436_100022503 3300006914 Bacteria 4329
126 Ga0075436_100030597 3300006914 Bacteria 3704
127 Ga0097620_100002466 3300006931 Bacteria 18828
128 Ga0097620_100018776 3300006931 Bacteria 6949
129 Ga0097620_100043369 3300006931 Bacteria 4520
130 Ga0097620_100330443 3300006931 Bacteria 1618
131 Ga0097620_100404230 3300006931 Bacteria 1461
132 Ga0097620_101744642 3300006931 Unclassified 688
133 Ga0075435_100000533 3300007076 Bacteria 23314
134 Ga0075435_100019845 3300007076 Bacteria 5142
135 Ga0075435_100167245 3300007076 Bacteria 1854
136 Ga0075435_100259786 3300007076 Bacteria 1479
137 Ga0099794_10032853 3300007265 Bacteria 2437
138 Ga0111539_10018923 3300009094 Bacteria 8516
139 Ga0111539_10024047 3300009094 Bacteria 7483
140 Ga0111539_10036241 3300009094 Bacteria 5966
141 Ga0111539_10037274 3300009094 Bacteria 5873
142 Ga0111539_10094322 3300009094 Bacteria 3515
143 Ga0111539_10539826 3300009094 Bacteria 1358
144 Ga0111539_10731343 3300009094 Unclassified 1152
145 Ga0105245_10001017 3300009098 Bacteria 25471
146 Ga0105245_10214887 3300009098 Bacteria 1852
147 Ga0114129_10006282 3300009147 Bacteria 16845
148 Ga0114129_10008545 3300009147 Bacteria 14597
149 Ga0114129_10083659 3300009147 Bacteria 4432
150 Ga0114129_10126348 3300009147 Bacteria 3515
151 Ga0105243_10014115 3300009148 Bacteria 6043
152 Ga0105242_10005204 3300009176 Bacteria 10039
153 Ga0105242_10036741 3300009176 Bacteria 3931
154 Ga0105249_10012265 3300009553 Bacteria 7551
155 Ga0105249_10103813 3300009553 Bacteria 2678
156 Ga0105249_11023903 3300009553 Bacteria 895
157 Ga0105239_10327340 3300010375 Bacteria 1728
158 Ga0157372_10824300 3300013307 Bacteria 1077
159 Ga0157372_11305133 3300013307 Bacteria 837
160 Ga0157375_10597365 3300013308 Bacteria 1263
161 Ga0157380_10012258 3300014326 Bacteria 6211
162 Ga0157377_10040702 3300014745 Bacteria 2575
163 Ga0157377_10297239 3300014745 Bacteria 1064
164 Ga0157376_10103347 3300014969 Bacteria 2494
165 Ga0207653_10014430 3300025885 Bacteria 2479
166 Ga0207692_10257130 3300025898 Bacteria 1048
167 Ga0207642_10000809 3300025899 Bacteria 9743
168 Ga0207642_10034404 3300025899 Bacteria 2154
169 Ga0207645_10037403 3300025907 Bacteria 3114
170 Ga0207643_10260325 3300025908 Bacteria 1071
171 Ga0207707_10079582 3300025912 Bacteria 2862
172 Ga0207707_10229965 3300025912 Bacteria 1613
173 Ga0207660_10008185 3300025917 Bacteria 6765
174 Ga0207660_10042730 3300025917 Bacteria 3183
175 Ga0207660_10157012 3300025917 Bacteria 1752
176 Ga0207660_10780251 3300025917 Bacteria 780
177 Ga0207662_10001491 3300025918 Bacteria 11363
178 Ga0207662_10037149 3300025918 Bacteria 2850
179 Ga0207652_10344123 3300025921 Bacteria 1346
180 Ga0207681_10009478 3300025923 Bacteria 5950
181 Ga0207687_10001010 3300025927 Bacteria 19091
182 Ga0207687_10117330 3300025927 Bacteria 1985
183 Ga0207644_10188200 3300025931 Bacteria 1622
184 Ga0207706_10208110 3300025933 Bacteria 1715
185 Ga0207686_10033345 3300025934 Bacteria 3074
186 Ga0207686_10081393 3300025934 Bacteria 2114
187 Ga0207709_10000532 3300025935 Bacteria 32789
188 Ga0207709_10039286 3300025935 Bacteria 2825
189 Ga0207670_10001905 3300025936 Bacteria 10903
190 Ga0207670_10172535 3300025936 Bacteria 1623
191 Ga0207691_10386407 3300025940 Bacteria 1195
192 Ga0207711_10778773 3300025941 Bacteria 891
193 Ga0207689_10001100 3300025942 Bacteria 26064
194 Ga0207689_10067835 3300025942 Bacteria 2931
195 Ga0207667_10013443 3300025949 Bacteria 9368
196 Ga0207651_11514960 3300025960 Bacteria 604
197 Ga0207712_10030646 3300025961 Bacteria 3618
198 Ga0207712_10055011 3300025961 Bacteria 2797
199 Ga0207668_10019027 3300025972 Bacteria 4332
200 Ga0207640_10019813 3300025981 Bacteria 3982
201 Ga0207640_10506980 3300025981 Bacteria 1006
202 Ga0207703_10019064 3300026035 Bacteria 5359
203 Ga0207639_10316844 3300026041 Bacteria 1384
204 Ga0207708_10001449 3300026075 Bacteria 17783
205 Ga0207708_10146839 3300026075 Bacteria 1854
206 Ga0207708_10222380 3300026075 Bacteria 1513
207 Ga0207702_10074366 3300026078 Bacteria 2933
208 Ga0207641_10134990 3300026088 Bacteria 2220
209 Ga0207648_10000297 3300026089 Bacteria 54091
210 Ga0207648_10001964 3300026089 Bacteria 22482
211 Ga0207674_10349082 3300026116 Bacteria 1430
212 Ga0207675_100002266 3300026118 Bacteria 19130
213 Ga0209967_1000944 3300027364 Bacteria 3717
214 Ga0209981_1005634 3300027378 Bacteria 1665
215 Ga0209996_1010078 3300027395 Bacteria 1250
216 Ga0209968_1009836 3300027526 Bacteria 1466
217 Ga0209968_1014135 3300027526 Bacteria 1256
218 Ga0209999_1000966 3300027543 Bacteria 4847
219 Ga0209999_1007133 3300027543 Bacteria 2011
220 Ga0209999_1017405 3300027543 Bacteria 1310
221 Ga0209983_1006749 3300027665 Bacteria 2355
222 Ga0209966_1001708 3300027695 Bacteria 3734
223 Ga0209966_1023963 3300027695 Bacteria 1203
224 Ga0207428_10001985 3300027907 Bacteria 20758
225 Ga0207428_10058488 3300027907 Bacteria 3059
226 Ga0207428_10170708 3300027907 Bacteria 1647
227 Ga0268265_10001755 3300028380 Bacteria 17430
228 Ga0268265_10013789 3300028380 Bacteria 5499
229 Ga0268265_10046435 3300028380 Bacteria 3246
230 Ga0268265_10136995 3300028380 Bacteria 2044
231 Ga0268264_10011861 3300028381 Bacteria 7180
232 Ga0307408_100272344 3300031548 Bacteria 1406
233 Ga0316579_10021055 3300031691 Bacteria 2900
234 Ga0307407_10285444 3300031903 Bacteria 1145
235 Ga0307412_10437893 3300031911 Bacteria 1074
236 Ga0307412_10797960 3300031911 Bacteria 819
237 Ga0307409_100173455 3300031995 Bacteria 1901
238 Ga0307416_100259286 3300032002 Bacteria 1698
239 Ga0307416_100271160 3300032002 Bacteria 1666
240 Ga0307416_100302246 3300032002 Bacteria 1591
241 Ga0307411_10151282 3300032005 Bacteria 1725
242 Ga0307411_10263036 3300032005 Bacteria 1363
243 Ga0307411_10532277 3300032005 Bacteria 999
244 Ga0316583_10019303 3300032133 Bacteria 2447
245 Ga0373950_0003570 3300034818 Bacteria 2232
246 Ga0373938_0014284 3300034957 Bacteria 1522
247 Ga0373938_0029917 3300034957 Bacteria 1159
248 Ga0373926_0020471 3300035083 Bacteria 2285
249 Ga0373928_0023681 3300035084 Bacteria 1311
250 Ga0373929_0007917 3300035085 Bacteria 1951
251 Ga0373934_0083927 3300035086 Bacteria 1281
252 Ga0373940_0046610 3300035088 Unclassified 1206
253 Ga0373944_0014715 3300035089 Bacteria 2187
254 Ga0373949_0005386 3300035090 Bacteria 2857
255 Ga0373951_0007540 3300035091 Bacteria 2470
256 Ga0373932_0001850 3300035112 Bacteria 5671
257 Ga0373936_0016217 3300035113 Bacteria 2864
258 Ga0373939_0024838 3300035114 Bacteria 1673
259 Ga0373939_0033717 3300035114 Bacteria 1498
260 Ga0373945_0011626 3300035116 Bacteria 2912
261 Ga0373953_0045059 3300035117 Bacteria 1766
262 Ga0373956_0186422 3300035119 Unclassified 982
263 Ga0373960_0140361 3300035121 Unclassified 818
264 Ga0373943_0012696 3300035170 Bacteria 3797
265 Ga0373943_0022248 3300035170 Bacteria 2935
266 Ga0373946_0021598 3300035171 Bacteria 2497
267 Ga0373955_0009632 3300035172 Bacteria 4535
268 Ga0373955_0096599 3300035172 Bacteria 1691
269 Ga0373942_0010970 3300035207 Bacteria 2140
270 Ga0373961_0004501 3300035241 Bacteria 3369
271 Ga0373962_0081263 3300035242 Bacteria 984
272 Ga0373924_0011395 3300035410 Bacteria 3302
273 Ga0373931_0000165 3300035691 Bacteria 28797
274 Ga0373931_0000633 3300035691 Bacteria 14607
275 Ga0373931_0024064 3300035691 Bacteria 3081
276 Ga0373931_0046467 3300035691 Bacteria 2295
277 Ga0373931_0648094 3300035691 Unclassified 694
278 Ga0373933_0214651 3300035724 Bacteria 1233
279 Ga0373947_0005621 3300035725 Bacteria 7310
280 Ga0373947_0161943 3300035725 Bacteria 1447
281 Ga0373937_0002317 3300036401 Bacteria 15907
282 Ga0373937_0013112 3300036401 Bacteria 7300
283 Ga0373937_0035144 3300036401 Bacteria 4560
284 Ga0373937_0179520 3300036401 Bacteria 1988
285 Ga0373937_0640657 3300036401 Bacteria 1008
286 Ga0316582_0004812 3300036647 Bacteria 6884
287 Ga0373925_0156545 3300037068 Bacteria 1792
288 Ga0373925_0278562 3300037068 Bacteria 1346
289 Ga0373925_0314043 3300037068 Bacteria 1267
290 Ga0436360_1260745 3300039438 Bacteria 1406
291 Ga0451807_0929959 3300041486 Bacteria 1667
292 Ga0439441_000389 3300042001 Bacteria 4587
293 Ga0439441_001999 3300042001 Bacteria 2803
294 Ga0439441_013572 3300042001 Bacteria 1416
295 Ga0439443_022199 3300042003 Bacteria 1006
296 Ga0450921_009227 3300042123 Bacteria 813
297 Ga0439434_0000209 3300042435 Bacteria 16171
298 Ga0439435_0000207 3300042436 Bacteria 8283
299 Ga0439435_0000249 3300042436 Bacteria 7786
300 Ga0439435_0002421 3300042436 Bacteria 3702
301 Ga0439444_0003857 3300042437 Bacteria 2145
302 Ga0439444_0005000 3300042437 Bacteria 1951
303 Ga0439460_0002574 3300042461 Bacteria 4379
304 Ga0451577_0115501 3300042876 Bacteria 2403
305 Ga0451576_0001930 3300045051 Bacteria 33143
306 Ga0451576_0021461 3300045051 Bacteria 7018
307 Ga0451576_0161700 3300045051 Bacteria 2337
308 Ga0451576_0198511 3300045051 Bacteria 2095
309 Ga0451576_0338227 3300045051 Bacteria 1575
310 Ga0451576_1572428 3300045051 Unclassified 682
311 Ga0495592_0004316 3300046454 Bacteria 10401
312 Ga0495592_0443358 3300046454 Bacteria 815
313 Ga0495603_0004928 3300046455 Bacteria 7990
314 Ga0495651_0050990 3300046462 Bacteria 3192
315 Ga0495653_0032999 3300046463 Bacteria 4106
316 Ga0495580_0006052 3300046472 Bacteria 9902
317 Ga0495582_0060610 3300046473 Bacteria 2088
318 Ga0495639_0007478 3300046475 Bacteria 4690
319 Ga0495662_0004019 3300046476 Bacteria 7411
320 Ga0495594_0033879 3300046499 Bacteria 2778
321 Ga0495608_0001054 3300046511 Bacteria 19402
322 Ga0495618_0024888 3300046514 Bacteria 3712
323 Ga0495628_0006245 3300046516 Bacteria 10414
324 Ga0495630_0009281 3300046517 Bacteria 7072
325 Ga0495630_0731317 3300046517 Unclassified 757
326 Ga0495666_0011404 3300046526 Bacteria 4433
327 Ga0495652_0031309 3300046529 Bacteria 4659
328 Ga0495665_0038212 3300046531 Bacteria 2560
329 Ga0495640_0006865 3300046533 Bacteria 8967
330 Ga0495640_0010281 3300046533 Bacteria 7237
331 Ga0495586_0005860 3300046535 Bacteria 6566
332 Ga0495586_0030123 3300046535 Bacteria 2904
333 Ga0495586_0064418 3300046535 Bacteria 1997
334 Ga0495587_0018005 3300046536 Bacteria 4380
335 Ga0495645_0182216 3300046543 Bacteria 1438
336 Ga0495622_0114698 3300046557 Bacteria 1232
337 Ga0495667_0010346 3300046559 Bacteria 6311
338 Ga0495634_0015359 3300046642 Bacteria 5504
339 Ga0495634_0371525 3300046642 Bacteria 853
340 Ga0495611_0330598 3300046648 Bacteria 701
341 Ga0495635_0320572 3300046663 Bacteria 1037
342 Ga0495657_0127015 3300046675 Bacteria 1601
343 Ga0495647_0003537 3300046681 Bacteria 5005
344 Ga0495658_0085044 3300046683 Bacteria 1863
345 Ga0495624_0018823 3300046690 Bacteria 4616
346 Ga0495624_0065800 3300046690 Bacteria 2264
347 Ga0495624_0209113 3300046690 Unclassified 1184
348 Ga0495581_0031895 3300047315 Bacteria 3053
349 Ga0495581_0082126 3300047315 Bacteria 1866
350 Ga0495604_0021069 3300047317 Bacteria 5201
351 Ga0495636_0002233 3300047318 Bacteria 7437
352 Ga0495676_0085887 3300047321 Bacteria 2369
353 Ga0495680_0006560 3300047322 Bacteria 10799
354 Ga0495684_0074454 3300047471 Bacteria 2580
355 Ga0495593_0145103 3300047673 Bacteria 1201
356 Ga0495593_0220111 3300047673 Bacteria 953
357 Ga0501031_0136187 3300049568 Bacteria 1604
358 Ga0501031_0425841 3300049568 Bacteria 858
359 Ga0501032_0052933 3300049569 Bacteria 2735
360 Ga0501033_0036620 3300049570 Bacteria 3675
361 Ga0501033_0398394 3300049570 Bacteria 960
362 Ga0501034_0187512 3300049571 Bacteria 2031
363 Ga0501034_1014036 3300049571 Bacteria 714
364 Ga0501036_0017023 3300049572 Bacteria 6075
365 Ga0501036_0058044 3300049572 Bacteria 3279
366 Ga0501036_0074339 3300049572 Bacteria 2874
367 Ga0501036_0624086 3300049572 Bacteria 893
368 Ga0501037_0061447 3300049573 Bacteria 2739
369 Ga0501037_0152236 3300049573 Bacteria 1653
370 Ga0501038_0003148 3300049574 Bacteria 15404
371 Ga0501038_0013212 3300049574 Bacteria 7531
372 Ga0501039_0023222 3300049575 Bacteria 4760
373 Ga0501039_0023883 3300049575 Bacteria 4694
374 Ga0501039_0216470 3300049575 Bacteria 1506
375 Ga0501039_0231304 3300049575 Bacteria 1453
376 Ga0501040_0000430 3300049576 Bacteria 24912
377 Ga0501040_0006197 3300049576 Bacteria 7756
378 Ga0501040_0176909 3300049576 Bacteria 1512
379 Ga0501040_0206349 3300049576 Bacteria 1396
380 Ga0501041_0009051 3300049577 Bacteria 5859
381 Ga0501041_0152490 3300049577 Bacteria 1443
382 Ga0501041_0362709 3300049577 Bacteria 916
383 Ga0501042_0020885 3300049578 Bacteria 4559
384 Ga0501042_0037499 3300049578 Bacteria 3440
385 Ga0501042_0388739 3300049578 Bacteria 1010
386 Ga0501046_0012540 3300049580 Bacteria 7208
387 Ga0501046_0025252 3300049580 Bacteria 4864
388 Ga0501046_0083068 3300049580 Bacteria 2473
389 Ga0501046_0128419 3300049580 Bacteria 1924
390 Ga0501047_0110037 3300049581 Bacteria 2638
391 Ga0501048_0000114 3300049582 Bacteria 45735
392 Ga0501048_0019576 3300049582 Bacteria 4964
393 Ga0501048_0091016 3300049582 Bacteria 2152
394 Ga0501068_0033854 3300049584 Bacteria 3045
395 Ga0501069_0130776 3300049585 Bacteria 1437
396 Ga0501071_0033111 3300049587 Bacteria 3672
397 Ga0501071_0053869 3300049587 Bacteria 2902
398 Ga0501071_0061927 3300049587 Bacteria 2710
399 Ga0501071_0588950 3300049587 Bacteria 855
400 Ga0501072_0012705 3300049588 Bacteria 6438
401 Ga0501072_0016773 3300049588 Bacteria 5623
402 Ga0501072_0070886 3300049588 Bacteria 2753
403 Ga0501072_0101784 3300049588 Bacteria 2283
404 Ga0501072_0231084 3300049588 Unclassified 1473
405 Ga0501072_0433443 3300049588 Bacteria 1041
406 Ga0501072_0611498 3300049588 Bacteria 859
407 Ga0501072_0629667 3300049588 Bacteria 845
408 Ga0501073_0192349 3300049589 Bacteria 1412
409 Ga0501073_0197278 3300049589 Bacteria 1392
410 Ga0501074_0027837 3300049590 Bacteria 4097
411 Ga0501074_0070291 3300049590 Bacteria 2517
412 Ga0501074_0300941 3300049590 Bacteria 1139
413 Ga0501075_0078186 3300049591 Bacteria 2504
414 Ga0501075_0083165 3300049591 Bacteria 2424
415 Ga0501075_0374507 3300049591 Bacteria 1085
416 Ga0501075_0484685 3300049591 Bacteria 943
417 Ga0501076_0000440 3300049592 Bacteria 26295
418 Ga0501076_0002635 3300049592 Bacteria 12378
419 Ga0501076_0059579 3300049592 Bacteria 3037
420 Ga0501076_0149256 3300049592 Bacteria 1901
421 Ga0501076_0719535 3300049592 Bacteria 824
422 Ga0501077_0003896 3300049593 Bacteria 8984
423 Ga0501077_0071260 3300049593 Bacteria 2203
424 Ga0501257_098218 3300049686 Bacteria 767
425 Ga0501079_0002366 3300049741 Bacteria 13700
426 Ga0501079_0031080 3300049741 Bacteria 4103
427 Ga0501079_0038380 3300049741 Bacteria 3693
428 Ga0501079_0170587 3300049741 Bacteria 1697
429 Ga0501080_0001892 3300049742 Bacteria 18029
430 Ga0501080_0024338 3300049742 Bacteria 5614
431 Ga0501080_0058135 3300049742 Bacteria 3600
432 Ga0501080_0111892 3300049742 Bacteria 2531
433 Ga0501081_0000059 3300049743 Bacteria 42443
434 Ga0501081_0004845 3300049743 Bacteria 8648
435 Ga0501081_0209195 3300049743 Bacteria 1416
436 Ga0501083_0136538 3300049744 Bacteria 1607
437 Ga0501035_0042580 3300049822 Bacteria 4095
438 Ga0501035_0074702 3300049822 Bacteria 2998
439 Ga0501035_0676115 3300049822 Bacteria 835
440 Ga0501044_0378766 3300049823 Bacteria 1330
441 Ga0501045_0009707 3300049824 Bacteria 6732
442 Ga0501045_0034129 3300049824 Bacteria 3692
443 Ga0501045_0092860 3300049824 Bacteria 2232
444 Ga0501045_0210889 3300049824 Bacteria 1447
445 nmdc:mga05p37_1051379_c1 3300050507 Bacteria 859
446 nmdc:mga05p37_5788_c1 3300050507 Bacteria 14531
447 nmdc:mga05p37_72_c1 3300050507 Bacteria 88725
448 nmdc:mga09592_3229_c1 3300050508 Bacteria 13192
449 nmdc:mga09592_364782_c1 3300050508 Bacteria 1250
450 nmdc:mga09592_739_c1 3300050508 Bacteria 25175
451 nmdc:mga0qj67_205451_c1 3300050509 Bacteria 1600
452 nmdc:mga0qj67_345824_c1 3300050509 Bacteria 1203
453 nmdc:mga0qj67_369_c1 3300050509 Bacteria 30904
454 nmdc:mga0qj67_3854_c1 3300050509 Bacteria 10836
455 nmdc:mga0qj67_99709_c1 3300050509 Bacteria 2341
456 nmdc:mga06r32_15519_c1 3300050510 Bacteria 6918
457 nmdc:mga06r32_278448_c1 3300050510 Bacteria 1660
458 nmdc:mga06r32_285527_c1 3300050510 Bacteria 1637
459 nmdc:mga06r32_458690_c1 3300050510 Bacteria 1254
460 nmdc:mga06r32_47314_c1 3300050510 Bacteria 4108
461 nmdc:mga06r32_5539_c1 3300050510 Bacteria 11382
462 nmdc:mga08y16_105630_c1 3300050511 Bacteria 2932
463 nmdc:mga08y16_25228_c1 3300050511 Bacteria 6268
464 nmdc:mga08y16_2532_c1 3300050511 Bacteria 18792
465 nmdc:mga08y16_509423_c1 3300050511 Bacteria 1222
466 nmdc:mga08y16_605494_c1 3300050511 Unclassified 1104
467 nmdc:mga0n895_169310_c1 3300050512 Bacteria 2216
468 nmdc:mga0n895_252710_c1 3300050512 Bacteria 1789
469 nmdc:mga0n895_25471_c1 3300050512 Bacteria 5590
470 nmdc:mga0n895_307_c1 3300050512 Bacteria 32508
471 nmdc:mga0rr50_2271_c1 3300050513 Bacteria 10781
472 nmdc:mga0rr50_3057_c2 3300050513 Bacteria 3467
473 nmdc:mga0rr50_377206_c1 3300050513 Bacteria 1195
474 nmdc:mga08x19_17534_c1 3300050514 Bacteria 4382
475 nmdc:mga08x19_181289_c1 3300050514 Bacteria 1438
476 nmdc:mga08x19_2576_c1 3300050514 Bacteria 11011
477 nmdc:mga08x19_5329_c1 3300050514 Bacteria 7602
478 nmdc:mga0a205_21494_c1 3300050515 Bacteria 6102
479 nmdc:mga0a205_3356_c1 3300050515 Bacteria 14254
480 nmdc:mga0a205_68251_c1 3300050515 Bacteria 3434
481 nmdc:mga0a205_814295_c1 3300050515 Bacteria 781
482 Ga0495601_0008072 3300053077 Bacteria 6205
483 Ga0495612_0196073 3300053078 Bacteria 890
484 Ga0500566_0114568 3300053094 Bacteria 1461
485 Ga0501084_0017946 3300054114 Bacteria 5892
486 Ga0501084_0454407 3300054114 Bacteria 1083
487 Ga0501084_0826236 3300054114 Bacteria 780
488 Ga0501082_0014688 3300060353 Bacteria 6747
489 Ga0501082_0026902 3300060353 Bacteria 4956
490 Ga0501082_0107212 3300060353 Bacteria 2417
491 Ga0501082_0702591 3300060353 Bacteria 885
492 Ga0530510_0003467 3300061734 Bacteria 10848
493 Ga0530510_0026256 3300061734 Bacteria 4167
494 Ga0530510_0073140 3300061734 Bacteria 2488
495 Ga0530510_0291378 3300061734 Bacteria 1220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0101784 Ga0501072_0101784_14_529 138
2 3300042001 Ga0439441_001999 Ga0439441_001999_2221_2784 151
3 3300025960 Ga0207651_11514960 Ga0207651_115149601 152
4 3300007076 Ga0075435_100167245 Ga0075435_1001672452 155
5 3300005336 Ga0070680_100844142 Ga0070680_1008441421 157
6 3300005438 Ga0070701_10249183 Ga0070701_102491831 157
7 3300025917 Ga0207660_10157012 Ga0207660_101570122 157
8 3300025908 Ga0207643_10260325 Ga0207643_102603252 158
9 3300031911 Ga0307412_10437893 Ga0307412_104378932 158
10 3300032002 Ga0307416_100259286 Ga0307416_1002592863 159
11 3300032005 Ga0307411_10532277 Ga0307411_105322772 159
12 3300049573 Ga0501037_0152236 Ga0501037_0152236_642_1256 159
13 3300049575 Ga0501039_0216470 Ga0501039_0216470_41_655 159
14 3300049577 Ga0501041_0362709 Ga0501041_0362709_242_856 159
15 3300049578 Ga0501042_0388739 Ga0501042_0388739_129_743 159
16 3300049580 Ga0501046_0025252 Ga0501046_0025252_3411_4025 159
17 3300049592 Ga0501076_0719535 Ga0501076_0719535_96_710 159
18 3300049593 Ga0501077_0071260 Ga0501077_0071260_14_628 159
19 3300049741 Ga0501079_0170587 Ga0501079_0170587_405_1019 159
20 3300049743 Ga0501081_0209195 Ga0501081_0209195_517_1131 159
21 3300049824 Ga0501045_0092860 Ga0501045_0092860_1206_1820 159
22 3300060353 Ga0501082_0107212 Ga0501082_0107212_1421_2035 159
23 3300061734 Ga0530510_0291378 Ga0530510_0291378_450_1064 159
24 3300005444 Ga0070694_100070922 Ga0070694_1000709222 160
25 3300005545 Ga0070695_100049301 Ga0070695_1000493012 160
26 3300005549 Ga0070704_100023368 Ga0070704_1000233684 160
27 3300006846 Ga0075430_100070152 Ga0075430_1000701524 160
28 3300006847 Ga0075431_100039502 Ga0075431_1000395022 160
29 3300009094 Ga0111539_10731343 Ga0111539_107313432 160
30 3300027543 Ga0209999_1007133 Ga0209999_10071333 160
31 3300027695 Ga0209966_1001708 Ga0209966_10017084 160
32 3300035242 Ga0373962_0081263 Ga0373962_0081263_133_747 160
33 3300035691 Ga0373931_0024064 Ga0373931_0024064_342_956 160
34 3300042436 Ga0439435_0002421 Ga0439435_0002421_823_1440 160
35 3300042437 Ga0439444_0003857 Ga0439444_0003857_1338_1955 160
36 3300050508 nmdc:mga09592_364782_c1 nmdc:mga09592_364782_c1_269_883 160
37 3300050509 nmdc:mga0qj67_345824_c1 nmdc:mga0qj67_345824_c1_484_1101 160
38 3300050509 nmdc:mga0qj67_99709_c1 nmdc:mga0qj67_99709_c1_185_799 160
39 3300050511 nmdc:mga08y16_605494_c1 nmdc:mga08y16_605494_c1_389_1006 160
40 3300005440 Ga0070705_100125195 Ga0070705_1001251952 161
41 3300009147 Ga0114129_10083659 Ga0114129_100836594 161
42 3300027665 Ga0209983_1006749 Ga0209983_10067491 161
43 3300042003 Ga0439443_022199 Ga0439443_022199_270_887 161
44 3300005338 Ga0068868_100001141 Ga0068868_1000011411 165
45 3300005544 Ga0070686_100001157 Ga0070686_1000011571 165
46 3300005615 Ga0070702_100083726 Ga0070702_1000837263 165
47 3300025940 Ga0207691_10386407 Ga0207691_103864071 165
48 3300046454 Ga0495592_0443358 Ga0495592_0443358_58_621 166
49 3300049587 Ga0501071_0588950 Ga0501071_0588950_273_845 166
50 3300046648 Ga0495611_0330598 Ga0495611_0330598_12_578 167
51 3300005444 Ga0070694_100144360 Ga0070694_1001443602 172
52 3300005518 Ga0070699_101050227 Ga0070699_1010502272 172
53 3300005564 Ga0070664_101139966 Ga0070664_1011399661 172
54 3300006852 Ga0075433_10073148 Ga0075433_100731482 172
55 3300006871 Ga0075434_100467522 Ga0075434_1004675223 172
56 3300006914 Ga0075436_100000152 Ga0075436_10000015221 172
57 3300006914 Ga0075436_100022503 Ga0075436_1000225036 172
58 3300007076 Ga0075435_100259786 Ga0075435_1002597862 172
59 3300025898 Ga0207692_10257130 Ga0207692_102571301 172
60 3300049585 Ga0501069_0130776 Ga0501069_0130776_90_695 172
61 3300050512 nmdc:mga0n895_25471_c1 nmdc:mga0n895_25471_c1_4686_5291 172
62 3300050514 nmdc:mga08x19_17534_c1 nmdc:mga08x19_17534_c1_3006_3611 172
63 3300050514 nmdc:mga08x19_181289_c1 nmdc:mga08x19_181289_c1_445_1050 172
64 3300050514 nmdc:mga08x19_2576_c1 nmdc:mga08x19_2576_c1_6693_7298 172
65 3300050515 nmdc:mga0a205_68251_c1 nmdc:mga0a205_68251_c1_833_1438 172
66 3300006880 Ga0075429_100122601 Ga0075429_1001226013 173
67 3300009147 Ga0114129_10126348 Ga0114129_101263484 173
68 3300031995 Ga0307409_100173455 Ga0307409_1001734553 173
69 3300050507 nmdc:mga05p37_1051379_c1 nmdc:mga05p37_1051379_c1_68_676 173
70 3300050510 nmdc:mga06r32_285527_c1 nmdc:mga06r32_285527_c1_719_1327 173
71 3300005458 Ga0070681_10010051 Ga0070681_100100513 174
72 3300013307 Ga0157372_11305133 Ga0157372_113051331 174
73 3300025912 Ga0207707_10079582 Ga0207707_100795824 174
74 3300025917 Ga0207660_10780251 Ga0207660_107802512 174
75 3300025921 Ga0207652_10344123 Ga0207652_103441232 174
76 3300031691 Ga0316579_10021055 Ga0316579_100210552 174
77 3300032133 Ga0316583_10019303 Ga0316583_100193033 174
78 3300034957 Ga0373938_0014284 Ga0373938_0014284_855_1451 174
79 3300034957 Ga0373938_0029917 Ga0373938_0029917_422_1033 174
80 3300035114 Ga0373939_0024838 Ga0373939_0024838_742_1338 174
81 3300035691 Ga0373931_0046467 Ga0373931_0046467_1638_2234 174
82 3300036647 Ga0316582_0004812 Ga0316582_0004812_3102_3713 174
83 3300005295 Ga0065707_10104596 Ga0065707_101045963 175
84 3300005295 Ga0065707_10180152 Ga0065707_101801521 175
85 3300005295 Ga0065707_10239471 Ga0065707_102394712 175
86 3300005330 Ga0070690_100001328 Ga0070690_1000013283 175
87 3300005330 Ga0070690_100002214 Ga0070690_1000022145 175
88 3300005330 Ga0070690_100860031 Ga0070690_1008600311 175
89 3300005334 Ga0068869_100008574 Ga0068869_1000085743 175
90 3300005334 Ga0068869_100073363 Ga0068869_1000733634 175
91 3300005334 Ga0068869_100079733 Ga0068869_1000797333 175
92 3300005335 Ga0070666_10295461 Ga0070666_102954611 175
93 3300005336 Ga0070680_100087808 Ga0070680_1000878084 175
94 3300005340 Ga0070689_100055194 Ga0070689_1000551943 175
95 3300005340 Ga0070689_100381098 Ga0070689_1003810982 175
96 3300005341 Ga0070691_10010497 Ga0070691_100104973 175
97 3300005343 Ga0070687_100006271 Ga0070687_1000062714 175
98 3300005353 Ga0070669_100002686 Ga0070669_10000268612 175
99 3300005354 Ga0070675_100078436 Ga0070675_1000784363 175
100 3300005365 Ga0070688_100124066 Ga0070688_1001240662 175
101 3300005440 Ga0070705_100001299 Ga0070705_1000012993 175
102 3300005441 Ga0070700_100000811 Ga0070700_1000008114 175
103 3300005444 Ga0070694_100000228 Ga0070694_10000022815 175
104 3300005444 Ga0070694_100080937 Ga0070694_1000809373 175
105 3300005445 Ga0070708_100089590 Ga0070708_1000895903 175
106 3300005457 Ga0070662_100193962 Ga0070662_1001939623 175
107 3300005458 Ga0070681_10098643 Ga0070681_100986434 175
108 3300005459 Ga0068867_100007400 Ga0068867_1000074004 175
109 3300005530 Ga0070679_100041906 Ga0070679_1000419064 175
110 3300005536 Ga0070697_100649393 Ga0070697_1006493931 175
111 3300005539 Ga0068853_100457588 Ga0068853_1004575881 175
112 3300005545 Ga0070695_100000894 Ga0070695_10000089417 175
113 3300005546 Ga0070696_100001064 Ga0070696_10000106419 175
114 3300005546 Ga0070696_100003592 Ga0070696_1000035927 175
115 3300005549 Ga0070704_100010611 Ga0070704_1000106117 175
116 3300005549 Ga0070704_100579692 Ga0070704_1005796922 175
117 3300005563 Ga0068855_100003762 Ga0068855_1000037622 175
118 3300005578 Ga0068854_100007628 Ga0068854_1000076284 175
119 3300005578 Ga0068854_100572229 Ga0068854_1005722291 175
120 3300005614 Ga0068856_100059469 Ga0068856_1000594694 175
121 3300005614 Ga0068856_100233765 Ga0068856_1002337653 175
122 3300005615 Ga0070702_100441404 Ga0070702_1004414042 175
123 3300005616 Ga0068852_100129477 Ga0068852_1001294774 175
124 3300005617 Ga0068859_100002466 Ga0068859_10000246619 175
125 3300005617 Ga0068859_100018776 Ga0068859_1000187762 175
126 3300005617 Ga0068859_100404238 Ga0068859_1004042382 175
127 3300005618 Ga0068864_100109514 Ga0068864_1001095143 175
128 3300005718 Ga0068866_10000302 Ga0068866_100003022 175
129 3300005718 Ga0068866_10020429 Ga0068866_100204292 175
130 3300005719 Ga0068861_100001497 Ga0068861_10000149714 175
131 3300005841 Ga0068863_100233476 Ga0068863_1002334762 175
132 3300005842 Ga0068858_100068217 Ga0068858_1000682173 175
133 3300005842 Ga0068858_100091609 Ga0068858_1000916091 175
134 3300005843 Ga0068860_100006346 Ga0068860_1000063465 175
135 3300005843 Ga0068860_100685257 Ga0068860_1006852572 175
136 3300005844 Ga0068862_100007142 Ga0068862_1000071423 175
137 3300005844 Ga0068862_100014269 Ga0068862_1000142694 175
138 3300005844 Ga0068862_100031702 Ga0068862_1000317027 175
139 3300006358 Ga0068871_100095258 Ga0068871_1000952583 175
140 3300006358 Ga0068871_100549682 Ga0068871_1005496822 175
141 3300006844 Ga0075428_100001160 Ga0075428_10000116018 175
142 3300006846 Ga0075430_100145205 Ga0075430_1001452052 175
143 3300006852 Ga0075433_10004298 Ga0075433_1000429813 175
144 3300006852 Ga0075433_10021629 Ga0075433_100216297 175
145 3300006871 Ga0075434_100004987 Ga0075434_10000498715 175
146 3300006880 Ga0075429_100000617 Ga0075429_1000006174 175
147 3300006880 Ga0075429_100110891 Ga0075429_1001108913 175
148 3300006881 Ga0068865_100002724 Ga0068865_1000027243 175
149 3300006914 Ga0075436_100030597 Ga0075436_1000305974 175
150 3300006931 Ga0097620_100002466 Ga0097620_10000246619 175
151 3300006931 Ga0097620_100018776 Ga0097620_1000187766 175
152 3300006931 Ga0097620_100404230 Ga0097620_1004042302 175
153 3300007076 Ga0075435_100000533 Ga0075435_1000005333 175
154 3300007076 Ga0075435_100019845 Ga0075435_1000198452 175
155 3300009094 Ga0111539_10018923 Ga0111539_100189234 175
156 3300009094 Ga0111539_10024047 Ga0111539_100240477 175
157 3300009094 Ga0111539_10037274 Ga0111539_100372743 175
158 3300009094 Ga0111539_10539826 Ga0111539_105398263 175
159 3300009098 Ga0105245_10001017 Ga0105245_100010172 175
160 3300009098 Ga0105245_10214887 Ga0105245_102148872 175
161 3300009147 Ga0114129_10008545 Ga0114129_1000854512 175
162 3300009148 Ga0105243_10014115 Ga0105243_100141154 175
163 3300009176 Ga0105242_10005204 Ga0105242_100052043 175
164 3300009176 Ga0105242_10036741 Ga0105242_100367413 175
165 3300009553 Ga0105249_10012265 Ga0105249_100122657 175
166 3300010375 Ga0105239_10327340 Ga0105239_103273403 175
167 3300013308 Ga0157375_10597365 Ga0157375_105973652 175
168 3300014326 Ga0157380_10012258 Ga0157380_100122586 175
169 3300014745 Ga0157377_10040702 Ga0157377_100407022 175
170 3300014745 Ga0157377_10297239 Ga0157377_102972392 175
171 3300014969 Ga0157376_10103347 Ga0157376_101033473 175
172 3300025885 Ga0207653_10014430 Ga0207653_100144303 175
173 3300025899 Ga0207642_10000809 Ga0207642_100008098 175
174 3300025899 Ga0207642_10034404 Ga0207642_100344043 175
175 3300025907 Ga0207645_10037403 Ga0207645_100374033 175
176 3300025912 Ga0207707_10229965 Ga0207707_102299652 175
177 3300025917 Ga0207660_10008185 Ga0207660_100081858 175
178 3300025918 Ga0207662_10001491 Ga0207662_100014914 175
179 3300025923 Ga0207681_10009478 Ga0207681_100094784 175
180 3300025927 Ga0207687_10001010 Ga0207687_100010102 175
181 3300025927 Ga0207687_10117330 Ga0207687_101173303 175
182 3300025933 Ga0207706_10208110 Ga0207706_102081102 175
183 3300025934 Ga0207686_10033345 Ga0207686_100333452 175
184 3300025934 Ga0207686_10081393 Ga0207686_100813934 175
185 3300025935 Ga0207709_10000532 Ga0207709_1000053227 175
186 3300025935 Ga0207709_10039286 Ga0207709_100392862 175
187 3300025936 Ga0207670_10001905 Ga0207670_1000190515 175
188 3300025941 Ga0207711_10778773 Ga0207711_107787732 175
189 3300025942 Ga0207689_10001100 Ga0207689_1000110019 175
190 3300025942 Ga0207689_10067835 Ga0207689_100678354 175
191 3300025949 Ga0207667_10013443 Ga0207667_100134432 175
192 3300025961 Ga0207712_10030646 Ga0207712_100306463 175
193 3300025961 Ga0207712_10055011 Ga0207712_100550112 175
194 3300025972 Ga0207668_10019027 Ga0207668_100190274 175
195 3300025981 Ga0207640_10019813 Ga0207640_100198133 175
196 3300025981 Ga0207640_10506980 Ga0207640_105069802 175
197 3300026035 Ga0207703_10019064 Ga0207703_100190644 175
198 3300026041 Ga0207639_10316844 Ga0207639_103168442 175
199 3300026075 Ga0207708_10001449 Ga0207708_1000144917 175
200 3300026078 Ga0207702_10074366 Ga0207702_100743663 175
201 3300026088 Ga0207641_10134990 Ga0207641_101349903 175
202 3300026089 Ga0207648_10000297 Ga0207648_1000029731 175
203 3300026089 Ga0207648_10001964 Ga0207648_1000196420 175
204 3300026118 Ga0207675_100002266 Ga0207675_1000022669 175
205 3300027907 Ga0207428_10001985 Ga0207428_100019856 175
206 3300028380 Ga0268265_10001755 Ga0268265_1000175519 175
207 3300028380 Ga0268265_10013789 Ga0268265_100137894 175
208 3300028380 Ga0268265_10046435 Ga0268265_100464354 175
209 3300028381 Ga0268264_10011861 Ga0268264_100118613 175
210 3300034818 Ga0373950_0003570 Ga0373950_0003570_993_1607 175
211 3300035083 Ga0373926_0020471 Ga0373926_0020471_1226_1840 175
212 3300035084 Ga0373928_0023681 Ga0373928_0023681_64_678 175
213 3300035085 Ga0373929_0007917 Ga0373929_0007917_961_1575 175
214 3300035086 Ga0373934_0083927 Ga0373934_0083927_641_1255 175
215 3300035088 Ga0373940_0046610 Ga0373940_0046610_519_1133 175
216 3300035089 Ga0373944_0014715 Ga0373944_0014715_1338_1952 175
217 3300035090 Ga0373949_0005386 Ga0373949_0005386_1491_2105 175
218 3300035091 Ga0373951_0007540 Ga0373951_0007540_1760_2374 175
219 3300035112 Ga0373932_0001850 Ga0373932_0001850_4831_5445 175
220 3300035113 Ga0373936_0016217 Ga0373936_0016217_117_731 175
221 3300035116 Ga0373945_0011626 Ga0373945_0011626_1817_2431 175
222 3300035170 Ga0373943_0012696 Ga0373943_0012696_2731_3345 175
223 3300035170 Ga0373943_0022248 Ga0373943_0022248_775_1389 175
224 3300035171 Ga0373946_0021598 Ga0373946_0021598_787_1401 175
225 3300035207 Ga0373942_0010970 Ga0373942_0010970_843_1457 175
226 3300035241 Ga0373961_0004501 Ga0373961_0004501_1031_1645 175
227 3300035691 Ga0373931_0000165 Ga0373931_0000165_9828_10442 175
228 3300035691 Ga0373931_0000633 Ga0373931_0000633_3375_3989 175
229 3300035725 Ga0373947_0005621 Ga0373947_0005621_5950_6564 175
230 3300035725 Ga0373947_0161943 Ga0373947_0161943_334_948 175
231 3300036401 Ga0373937_0179520 Ga0373937_0179520_411_1025 175
232 3300037068 Ga0373925_0156545 Ga0373925_0156545_515_1129 175
233 3300037068 Ga0373925_0278562 Ga0373925_0278562_232_846 175
234 3300039438 Ga0436360_1260745 Ga0436360_1260745_12_626 175
235 3300041486 Ga0451807_0929959 Ga0451807_0929959_801_1415 175
236 3300042001 Ga0439441_000389 Ga0439441_000389_1172_1786 175
237 3300042876 Ga0451577_0115501 Ga0451577_0115501_1109_1723 175
238 3300045051 Ga0451576_0001930 Ga0451576_0001930_3927_4541 175
239 3300045051 Ga0451576_0021461 Ga0451576_0021461_6227_6841 175
240 3300045051 Ga0451576_0161700 Ga0451576_0161700_1216_1830 175
241 3300045051 Ga0451576_0338227 Ga0451576_0338227_754_1368 175
242 3300045051 Ga0451576_1572428 Ga0451576_1572428_29_643 175
243 3300046455 Ga0495603_0004928 Ga0495603_0004928_4054_4668 175
244 3300046472 Ga0495580_0006052 Ga0495580_0006052_7343_7957 175
245 3300046475 Ga0495639_0007478 Ga0495639_0007478_982_1596 175
246 3300046499 Ga0495594_0033879 Ga0495594_0033879_1173_1787 175
247 3300046531 Ga0495665_0038212 Ga0495665_0038212_726_1340 175
248 3300046535 Ga0495586_0005860 Ga0495586_0005860_4615_5229 175
249 3300046557 Ga0495622_0114698 Ga0495622_0114698_167_781 175
250 3300046681 Ga0495647_0003537 Ga0495647_0003537_3891_4505 175
251 3300046683 Ga0495658_0085044 Ga0495658_0085044_866_1480 175
252 3300046690 Ga0495624_0209113 Ga0495624_0209113_518_1132 175
253 3300047315 Ga0495581_0082126 Ga0495581_0082126_1030_1644 175
254 3300047321 Ga0495676_0085887 Ga0495676_0085887_1235_1849 175
255 3300049568 Ga0501031_0425841 Ga0501031_0425841_222_836 175
256 3300049686 Ga0501257_098218 Ga0501257_098218_118_708 175
257 3300050507 nmdc:mga05p37_72_c1 nmdc:mga05p37_72_c1_63158_63772 175
258 3300050508 nmdc:mga09592_739_c1 nmdc:mga09592_739_c1_5012_5626 175
259 3300050509 nmdc:mga0qj67_205451_c1 nmdc:mga0qj67_205451_c1_339_953 175
260 3300050510 nmdc:mga06r32_458690_c1 nmdc:mga06r32_458690_c1_456_1070 175
261 3300050511 nmdc:mga08y16_105630_c1 nmdc:mga08y16_105630_c1_535_1149 175
262 3300050511 nmdc:mga08y16_25228_c1 nmdc:mga08y16_25228_c1_2895_3509 175
263 3300050511 nmdc:mga08y16_2532_c1 nmdc:mga08y16_2532_c1_8321_8935 175
264 3300050511 nmdc:mga08y16_509423_c1 nmdc:mga08y16_509423_c1_21_635 175
265 3300050512 nmdc:mga0n895_169310_c1 nmdc:mga0n895_169310_c1_1573_2187 175
266 3300050512 nmdc:mga0n895_307_c1 nmdc:mga0n895_307_c1_2254_2868 175
267 3300050513 nmdc:mga0rr50_2271_c1 nmdc:mga0rr50_2271_c1_169_783 175
268 3300050513 nmdc:mga0rr50_3057_c2 nmdc:mga0rr50_3057_c2_305_919 175
269 3300050514 nmdc:mga08x19_5329_c1 nmdc:mga08x19_5329_c1_3997_4611 175
270 3300050515 nmdc:mga0a205_21494_c1 nmdc:mga0a205_21494_c1_5348_5962 175
271 3300050515 nmdc:mga0a205_3356_c1 nmdc:mga0a205_3356_c1_9353_9967 175
272 3300005295 Ga0065707_10294643 Ga0065707_102946432 176
273 3300005295 Ga0065707_10431917 Ga0065707_104319171 176
274 3300005330 Ga0070690_100252918 Ga0070690_1002529182 176
275 3300005336 Ga0070680_100437291 Ga0070680_1004372912 176
276 3300005340 Ga0070689_100053625 Ga0070689_1000536253 176
277 3300005340 Ga0070689_100533008 Ga0070689_1005330082 176
278 3300005365 Ga0070688_100434965 Ga0070688_1004349652 176
279 3300005437 Ga0070710_10072868 Ga0070710_100728682 176
280 3300005438 Ga0070701_10158795 Ga0070701_101587952 176
281 3300005438 Ga0070701_10615751 Ga0070701_106157511 176
282 3300005440 Ga0070705_100039635 Ga0070705_1000396353 176
283 3300005440 Ga0070705_100591854 Ga0070705_1005918542 176
284 3300005444 Ga0070694_100334684 Ga0070694_1003346842 176
285 3300005444 Ga0070694_100608698 Ga0070694_1006086982 176
286 3300005459 Ga0068867_100838442 Ga0068867_1008384422 176
287 3300005467 Ga0070706_100773585 Ga0070706_1007735852 176
288 3300005468 Ga0070707_100581987 Ga0070707_1005819872 176
289 3300005471 Ga0070698_100280526 Ga0070698_1002805262 176
290 3300005471 Ga0070698_100329462 Ga0070698_1003294622 176
291 3300005539 Ga0068853_100695122 Ga0068853_1006951222 176
292 3300005546 Ga0070696_100728180 Ga0070696_1007281801 176
293 3300005549 Ga0070704_100006688 Ga0070704_1000066887 176
294 3300005549 Ga0070704_100056281 Ga0070704_1000562813 176
295 3300005549 Ga0070704_100487125 Ga0070704_1004871252 176
296 3300005615 Ga0070702_100009678 Ga0070702_1000096784 176
297 3300005617 Ga0068859_100043368 Ga0068859_1000433683 176
298 3300005617 Ga0068859_100330433 Ga0068859_1003304332 176
299 3300005617 Ga0068859_101744624 Ga0068859_1017446241 176
300 3300006844 Ga0075428_100021094 Ga0075428_1000210944 176
301 3300006846 Ga0075430_100000581 Ga0075430_10000058112 176
302 3300006847 Ga0075431_100008854 Ga0075431_1000088549 176
303 3300006847 Ga0075431_100011722 Ga0075431_1000117224 176
304 3300006847 Ga0075431_100041534 Ga0075431_1000415342 176
305 3300006880 Ga0075429_100001710 Ga0075429_1000017104 176
306 3300006880 Ga0075429_100862107 Ga0075429_1008621071 176
307 3300006931 Ga0097620_100043369 Ga0097620_1000433694 176
308 3300006931 Ga0097620_100330443 Ga0097620_1003304432 176
309 3300006931 Ga0097620_101744642 Ga0097620_1017446421 176
310 3300007265 Ga0099794_10032853 Ga0099794_100328532 176
311 3300009094 Ga0111539_10036241 Ga0111539_100362414 176
312 3300009094 Ga0111539_10094322 Ga0111539_100943225 176
313 3300009147 Ga0114129_10006282 Ga0114129_1000628217 176
314 3300009553 Ga0105249_10103813 Ga0105249_101038132 176
315 3300009553 Ga0105249_11023903 Ga0105249_110239032 176
316 3300013307 Ga0157372_10824300 Ga0157372_108243002 176
317 3300025917 Ga0207660_10042730 Ga0207660_100427304 176
318 3300025918 Ga0207662_10037149 Ga0207662_100371493 176
319 3300025931 Ga0207644_10188200 Ga0207644_101882003 176
320 3300026075 Ga0207708_10146839 Ga0207708_101468393 176
321 3300026075 Ga0207708_10222380 Ga0207708_102223802 176
322 3300026116 Ga0207674_10349082 Ga0207674_103490822 176
323 3300027364 Ga0209967_1000944 Ga0209967_10009444 176
324 3300027378 Ga0209981_1005634 Ga0209981_10056343 176
325 3300027395 Ga0209996_1010078 Ga0209996_10100781 176
326 3300027526 Ga0209968_1009836 Ga0209968_10098362 176
327 3300027526 Ga0209968_1014135 Ga0209968_10141352 176
328 3300027543 Ga0209999_1000966 Ga0209999_10009663 176
329 3300027543 Ga0209999_1017405 Ga0209999_10174052 176
330 3300027695 Ga0209966_1023963 Ga0209966_10239632 176
331 3300027907 Ga0207428_10058488 Ga0207428_100584884 176
332 3300027907 Ga0207428_10170708 Ga0207428_101707082 176
333 3300028380 Ga0268265_10136995 Ga0268265_101369953 176
334 3300031548 Ga0307408_100272344 Ga0307408_1002723442 176
335 3300031903 Ga0307407_10285444 Ga0307407_102854442 176
336 3300031911 Ga0307412_10797960 Ga0307412_107979602 176
337 3300032002 Ga0307416_100271160 Ga0307416_1002711602 176
338 3300032005 Ga0307411_10151282 Ga0307411_101512822 176
339 3300032005 Ga0307411_10263036 Ga0307411_102630362 176
340 3300035114 Ga0373939_0033717 Ga0373939_0033717_583_1200 176
341 3300035119 Ga0373956_0186422 Ga0373956_0186422_223_840 176
342 3300035121 Ga0373960_0140361 Ga0373960_0140361_82_699 176
343 3300035172 Ga0373955_0009632 Ga0373955_0009632_1289_1906 176
344 3300035172 Ga0373955_0096599 Ga0373955_0096599_825_1442 176
345 3300035410 Ga0373924_0011395 Ga0373924_0011395_2429_3046 176
346 3300035691 Ga0373931_0648094 Ga0373931_0648094_11_628 176
347 3300035724 Ga0373933_0214651 Ga0373933_0214651_115_732 176
348 3300036401 Ga0373937_0002317 Ga0373937_0002317_9605_10222 176
349 3300036401 Ga0373937_0035144 Ga0373937_0035144_2510_3127 176
350 3300036401 Ga0373937_0640657 Ga0373937_0640657_266_883 176
351 3300037068 Ga0373925_0314043 Ga0373925_0314043_246_863 176
352 3300042001 Ga0439441_013572 Ga0439441_013572_606_1223 176
353 3300042123 Ga0450921_009227 Ga0450921_009227_133_750 176
354 3300042435 Ga0439434_0000209 Ga0439434_0000209_7992_8609 176
355 3300042436 Ga0439435_0000249 Ga0439435_0000249_1316_1933 176
356 3300045051 Ga0451576_0198511 Ga0451576_0198511_328_945 176
357 3300046462 Ga0495651_0050990 Ga0495651_0050990_1855_2472 176
358 3300046517 Ga0495630_0731317 Ga0495630_0731317_63_680 176
359 3300046533 Ga0495640_0006865 Ga0495640_0006865_6481_7098 176
360 3300046535 Ga0495586_0064418 Ga0495586_0064418_722_1339 176
361 3300046543 Ga0495645_0182216 Ga0495645_0182216_515_1132 176
362 3300046642 Ga0495634_0371525 Ga0495634_0371525_213_830 176
363 3300046663 Ga0495635_0320572 Ga0495635_0320572_161_778 176
364 3300046675 Ga0495657_0127015 Ga0495657_0127015_509_1126 176
365 3300046690 Ga0495624_0065800 Ga0495624_0065800_87_704 176
366 3300047315 Ga0495581_0031895 Ga0495581_0031895_414_1031 176
367 3300047318 Ga0495636_0002233 Ga0495636_0002233_2156_2773 176
368 3300047673 Ga0495593_0220111 Ga0495593_0220111_250_867 176
369 3300049568 Ga0501031_0136187 Ga0501031_0136187_534_1151 176
370 3300049569 Ga0501032_0052933 Ga0501032_0052933_763_1380 176
371 3300049570 Ga0501033_0036620 Ga0501033_0036620_531_1148 176
372 3300049570 Ga0501033_0398394 Ga0501033_0398394_311_931 176
373 3300049571 Ga0501034_0187512 Ga0501034_0187512_1151_1768 176
374 3300049571 Ga0501034_1014036 Ga0501034_1014036_21_641 176
375 3300049572 Ga0501036_0017023 Ga0501036_0017023_665_1282 176
376 3300049572 Ga0501036_0058044 Ga0501036_0058044_1241_1861 176
377 3300049572 Ga0501036_0624086 Ga0501036_0624086_45_662 176
378 3300049573 Ga0501037_0061447 Ga0501037_0061447_1463_2080 176
379 3300049574 Ga0501038_0003148 Ga0501038_0003148_1999_2616 176
380 3300049575 Ga0501039_0023883 Ga0501039_0023883_440_1057 176
381 3300049575 Ga0501039_0231304 Ga0501039_0231304_610_1227 176
382 3300049576 Ga0501040_0000430 Ga0501040_0000430_1073_1690 176
383 3300049576 Ga0501040_0176909 Ga0501040_0176909_525_1151 176
384 3300049576 Ga0501040_0206349 Ga0501040_0206349_378_995 176
385 3300049577 Ga0501041_0152490 Ga0501041_0152490_448_1074 176
386 3300049578 Ga0501042_0020885 Ga0501042_0020885_2588_3205 176
387 3300049578 Ga0501042_0037499 Ga0501042_0037499_541_1161 176
388 3300049580 Ga0501046_0012540 Ga0501046_0012540_1074_1691 176
389 3300049580 Ga0501046_0083068 Ga0501046_0083068_216_836 176
390 3300049580 Ga0501046_0128419 Ga0501046_0128419_645_1262 176
391 3300049581 Ga0501047_0110037 Ga0501047_0110037_465_1082 176
392 3300049582 Ga0501048_0000114 Ga0501048_0000114_640_1257 176
393 3300049582 Ga0501048_0091016 Ga0501048_0091016_1513_2133 176
394 3300049584 Ga0501068_0033854 Ga0501068_0033854_2059_2676 176
395 3300049587 Ga0501071_0033111 Ga0501071_0033111_1990_2607 176
396 3300049587 Ga0501071_0061927 Ga0501071_0061927_1753_2370 176
397 3300049588 Ga0501072_0016773 Ga0501072_0016773_4803_5420 176
398 3300049588 Ga0501072_0070886 Ga0501072_0070886_292_909 176
399 3300049588 Ga0501072_0433443 Ga0501072_0433443_262_879 176
400 3300049588 Ga0501072_0611498 Ga0501072_0611498_116_742 176
401 3300049588 Ga0501072_0629667 Ga0501072_0629667_59_676 176
402 3300049589 Ga0501073_0192349 Ga0501073_0192349_416_1033 176
403 3300049589 Ga0501073_0197278 Ga0501073_0197278_705_1322 176
404 3300049590 Ga0501074_0027837 Ga0501074_0027837_1210_1827 176
405 3300049590 Ga0501074_0300941 Ga0501074_0300941_380_997 176
406 3300049591 Ga0501075_0078186 Ga0501075_0078186_391_1008 176
407 3300049591 Ga0501075_0083165 Ga0501075_0083165_1288_1905 176
408 3300049591 Ga0501075_0374507 Ga0501075_0374507_286_912 176
409 3300049592 Ga0501076_0000440 Ga0501076_0000440_1211_1828 176
410 3300049592 Ga0501076_0059579 Ga0501076_0059579_802_1419 176
411 3300049593 Ga0501077_0003896 Ga0501077_0003896_7048_7665 176
412 3300049741 Ga0501079_0002366 Ga0501079_0002366_5782_6399 176
413 3300049741 Ga0501079_0038380 Ga0501079_0038380_2163_2780 176
414 3300049742 Ga0501080_0001892 Ga0501080_0001892_348_965 176
415 3300049742 Ga0501080_0058135 Ga0501080_0058135_1632_2249 176
416 3300049742 Ga0501080_0111892 Ga0501080_0111892_969_1595 176
417 3300049743 Ga0501081_0000059 Ga0501081_0000059_12123_12740 176
418 3300049744 Ga0501083_0136538 Ga0501083_0136538_492_1109 176
419 3300049822 Ga0501035_0074702 Ga0501035_0074702_1887_2504 176
420 3300049822 Ga0501035_0676115 Ga0501035_0676115_31_651 176
421 3300049823 Ga0501044_0378766 Ga0501044_0378766_45_662 176
422 3300049824 Ga0501045_0009707 Ga0501045_0009707_1296_1913 176
423 3300049824 Ga0501045_0210889 Ga0501045_0210889_609_1229 176
424 3300050507 nmdc:mga05p37_5788_c1 nmdc:mga05p37_5788_c1_4219_4836 176
425 3300050508 nmdc:mga09592_3229_c1 nmdc:mga09592_3229_c1_3594_4211 176
426 3300050509 nmdc:mga0qj67_369_c1 nmdc:mga0qj67_369_c1_26384_27004 176
427 3300050509 nmdc:mga0qj67_3854_c1 nmdc:mga0qj67_3854_c1_8075_8692 176
428 3300050510 nmdc:mga06r32_15519_c1 nmdc:mga06r32_15519_c1_2942_3559 176
429 3300050510 nmdc:mga06r32_278448_c1 nmdc:mga06r32_278448_c1_282_899 176
430 3300050510 nmdc:mga06r32_47314_c1 nmdc:mga06r32_47314_c1_402_1019 176
431 3300050510 nmdc:mga06r32_5539_c1 nmdc:mga06r32_5539_c1_8547_9167 176
432 3300050513 nmdc:mga0rr50_377206_c1 nmdc:mga0rr50_377206_c1_422_1039 176
433 3300050515 nmdc:mga0a205_814295_c1 nmdc:mga0a205_814295_c1_66_683 176
434 3300053078 Ga0495612_0196073 Ga0495612_0196073_60_677 176
435 3300054114 Ga0501084_0017946 Ga0501084_0017946_4809_5426 176
436 3300054114 Ga0501084_0454407 Ga0501084_0454407_237_854 176
437 3300054114 Ga0501084_0826236 Ga0501084_0826236_118_744 176
438 3300060353 Ga0501082_0014688 Ga0501082_0014688_4801_5418 176
439 3300060353 Ga0501082_0702591 Ga0501082_0702591_174_800 176
440 3300061734 Ga0530510_0026256 Ga0530510_0026256_806_1423 176
441 3300061734 Ga0530510_0073140 Ga0530510_0073140_308_925 176
442 3300005440 Ga0070705_100090870 Ga0070705_1000908703 177
443 3300005536 Ga0070697_100624823 Ga0070697_1006248232 177
444 3300005545 Ga0070695_100556696 Ga0070695_1005566962 177
445 3300025936 Ga0207670_10172535 Ga0207670_101725352 177
446 3300032002 Ga0307416_100302246 Ga0307416_1003022463 177
447 3300035117 Ga0373953_0045059 Ga0373953_0045059_764_1384 177
448 3300036401 Ga0373937_0013112 Ga0373937_0013112_3802_4422 177
449 3300042436 Ga0439435_0000207 Ga0439435_0000207_2289_2915 177
450 3300042437 Ga0439444_0005000 Ga0439444_0005000_701_1327 177
451 3300042461 Ga0439460_0002574 Ga0439460_0002574_1306_1932 177
452 3300046454 Ga0495592_0004316 Ga0495592_0004316_7572_8192 177
453 3300046463 Ga0495653_0032999 Ga0495653_0032999_834_1454 177
454 3300046473 Ga0495582_0060610 Ga0495582_0060610_1154_1774 177
455 3300046476 Ga0495662_0004019 Ga0495662_0004019_6191_6811 177
456 3300046511 Ga0495608_0001054 Ga0495608_0001054_13886_14506 177
457 3300046514 Ga0495618_0024888 Ga0495618_0024888_857_1477 177
458 3300046516 Ga0495628_0006245 Ga0495628_0006245_4826_5446 177
459 3300046517 Ga0495630_0009281 Ga0495630_0009281_4116_4736 177
460 3300046526 Ga0495666_0011404 Ga0495666_0011404_3226_3846 177
461 3300046529 Ga0495652_0031309 Ga0495652_0031309_3558_4178 177
462 3300046533 Ga0495640_0010281 Ga0495640_0010281_1709_2329 177
463 3300046535 Ga0495586_0030123 Ga0495586_0030123_204_824 177
464 3300046536 Ga0495587_0018005 Ga0495587_0018005_164_784 177
465 3300046559 Ga0495667_0010346 Ga0495667_0010346_4909_5529 177
466 3300046642 Ga0495634_0015359 Ga0495634_0015359_2804_3424 177
467 3300046690 Ga0495624_0018823 Ga0495624_0018823_639_1259 177
468 3300047317 Ga0495604_0021069 Ga0495604_0021069_4512_5132 177
469 3300047322 Ga0495680_0006560 Ga0495680_0006560_9714_10334 177
470 3300047471 Ga0495684_0074454 Ga0495684_0074454_1489_2109 177
471 3300047673 Ga0495593_0145103 Ga0495593_0145103_271_891 177
472 3300049572 Ga0501036_0074339 Ga0501036_0074339_1227_1847 177
473 3300049574 Ga0501038_0013212 Ga0501038_0013212_2033_2653 177
474 3300049575 Ga0501039_0023222 Ga0501039_0023222_2757_3377 177
475 3300049576 Ga0501040_0006197 Ga0501040_0006197_4066_4686 177
476 3300049577 Ga0501041_0009051 Ga0501041_0009051_2434_3054 177
477 3300049582 Ga0501048_0019576 Ga0501048_0019576_2019_2639 177
478 3300049587 Ga0501071_0053869 Ga0501071_0053869_1793_2413 177
479 3300049588 Ga0501072_0012705 Ga0501072_0012705_1015_1635 177
480 3300049588 Ga0501072_0231084 Ga0501072_0231084_779_1399 177
481 3300049590 Ga0501074_0070291 Ga0501074_0070291_1508_2128 177
482 3300049591 Ga0501075_0484685 Ga0501075_0484685_110_730 177
483 3300049592 Ga0501076_0002635 Ga0501076_0002635_4185_4805 177
484 3300049592 Ga0501076_0149256 Ga0501076_0149256_75_695 177
485 3300049741 Ga0501079_0031080 Ga0501079_0031080_3262_3882 177
486 3300049742 Ga0501080_0024338 Ga0501080_0024338_2716_3336 177
487 3300049743 Ga0501081_0004845 Ga0501081_0004845_561_1181 177
488 3300049822 Ga0501035_0042580 Ga0501035_0042580_1352_1972 177
489 3300049824 Ga0501045_0034129 Ga0501045_0034129_242_862 177
490 3300050512 nmdc:mga0n895_252710_c1 nmdc:mga0n895_252710_c1_802_1422 177
491 3300053077 Ga0495601_0008072 Ga0495601_0008072_2081_2701 177
492 3300053094 Ga0500566_0114568 Ga0500566_0114568_162_782 177
493 3300060353 Ga0501082_0026902 Ga0501082_0026902_2115_2735 177
494 3300061734 Ga0530510_0003467 Ga0530510_0003467_3007_3627 177
495 3300003322 rootL2_10105527 rootL2_101055271 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04299

FMN_bind_2

Putative FMN-binding domain

1

161

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cp3-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function dip1874 from corynebacterium diphtheriae 0.7748 3 51
3swj-assembly1.cif.gz_A crystal structure of campylobacter jejuni chuz 0.7269 5 66
7qih-assembly1.cif.gz_B complex of the yersinia enterocolitica type iii secretion proteins yscx and yscy 0.6933 136 173
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.6675 2 172
2ig6-assembly1.cif.gz_B crystal structure of a nimc/nima family protein (ca_c2569) from clostridium acetobutylicum at 1.80 a resolution 0.6522 5 64
ID Description Score Start End Superfamily
3cp3A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7744 3 51 2.30.110.10
3fkhA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7461 3 48 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6895 1 64 2.30.110.10
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6618 1 174 2.30.110.10
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6418 1 174 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A2D6SA63-F1-model_v4 deleted 0.8206 1 81
AF-A0A1E4ZRH9-F1-model_v4 General stress protein FMN-binding split barrel domain-containing protein 0.8043 5 64
AF-A0A553JJG7-F1-model_v4 FMN-binding negative transcriptional regulator 0.7434 1 86
AF-A0A1F4BGR9-F1-model_v4 Transcriptional regulator 0.7398 1 175
AF-A0A7Y4VIH7-F1-model_v4 FMN-binding negative transcriptional regulator 0.7383 1 175

Feature Viewer

pLDDT pTM Quality
74.72 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map