F454786

General Info

Members Datasets Scaffolds Average Seq Length
495 250 991 202

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0114396|Ga0501034_0114396_711_1385
Length 224
Sequence VPTCHLPYKSTRINQEITMNAIDTHLADRPFIVGIGGTTRPGSSTESALRTALQYAEDLGAETQLFGGEALSTLDVFSPEVRERSPAQRAIVDAVRRADAVIFASPGYHGGVSGLVKNAIDLLEDLRADERVYLDGMPVGCIVTAAGWQGCNTTLGAMRSIVHALRGWPTPLGVTLNTAGVKLFDAQGQCLDAQVAASLKVLAEQVVNPASVFSRGNKKSELLL

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
107 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
201 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
202 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
203 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
204 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
205 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
206 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
207 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
208 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
209 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
210 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
211 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
212 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
213 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
214 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
215 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
216 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
217 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
218 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
219 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
220 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
221 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
222 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
223 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
224 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
225 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
226 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
227 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
228 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
229 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
230 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
231 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
232 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
233 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
234 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
235 2643221556 Massilia sp. Root1485 Isolate Unclassified
236 2643221684 Massilia sp. Root133 Isolate Unclassified
237 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
238 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
239 2738541280 Massilia sp. GV090 Isolate Unclassified
240 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
241 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
242 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
243 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
244 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
245 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
246 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
247 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
248 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
249 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
250 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.7
Metatranscriptomes 0
Isolates 10.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 4.44
Nodule 0.4
Rhizoplane 9.7
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0114396 3300049571 Bacteria 2687
2 JGI25153J46596_10000005 3300003215 Bacteria 492839
3 rootH1_10081268 3300003316 Bacteria 1977
4 rootH1_10085143 3300003316 Bacteria 6840
5 rootH1_10085143 3300003323 Bacteria 2404
6 rootH2_10049627 3300003320 Bacteria 2919
7 rootL2_10070594 3300003322 Bacteria 3410
8 rootL2_10092277 3300003322 Bacteria 6260
9 rootH1_10336900 3300003323 Bacteria 1082
10 Ga0055526_1000028 3300003771 Bacteria 150301
11 Ga0058692_1012941 3300003856 Bacteria 1959
12 Ga0065165_1021464 3300005262 Bacteria 2243
13 Ga0065714_10064925 3300005288 Bacteria 15362
14 Ga0070658_10176175 3300005327 Bacteria 1798
15 Ga0070658_10180636 3300005327 Bacteria 1775
16 Ga0070658_10223758 3300005327 Bacteria 1592
17 Ga0070658_10633234 3300005327 Bacteria 928
18 Ga0070676_10000540 3300005328 Bacteria 18295
19 Ga0068869_100000212 3300005334 Bacteria 30223
20 Ga0068868_100000228 3300005338 Bacteria 38192
21 Ga0070660_100012204 3300005339 Bacteria 6134
22 Ga0070661_100075568 3300005344 Bacteria 2482
23 Ga0070661_100077281 3300005344 Bacteria 2454
24 Ga0070675_100068206 3300005354 Bacteria 2945
25 Ga0070675_100679178 3300005354 Bacteria 937
26 Ga0070674_100000131 3300005356 Bacteria 34327
27 Ga0070673_100000011 3300005364 Bacteria 145332
28 Ga0070673_100115076 3300005364 Bacteria 2236
29 Ga0070673_100503247 3300005364 Bacteria 1096
30 Ga0070659_100017673 3300005366 Bacteria 5371
31 Ga0070678_100000005 3300005456 Bacteria 70019
32 Ga0068867_100000049 3300005459 Bacteria 72604
33 Ga0068867_100094571 3300005459 Bacteria 2273
34 Ga0070672_100034259 3300005543 Bacteria 3853
35 Ga0068855_100008922 3300005563 Bacteria 12121
36 Ga0070664_100871380 3300005564 Bacteria 843
37 Ga0068857_100008750 3300005577 Bacteria 8767
38 Ga0068854_100215119 3300005578 Bacteria 1518
39 Ga0068852_100159432 3300005616 Bacteria 2105
40 Ga0068858_100000310 3300005842 Bacteria 51909
41 Ga0081539_10205639 3300005985 Unclassified 906
42 Ga0075368_10000045 3300006042 Bacteria 29195
43 Ga0075363_100004927 3300006048 Bacteria 5903
44 Ga0075367_10000202 3300006178 Bacteria 19823
45 Ga0097621_100039630 3300006237 Bacteria 3785
46 Ga0075370_10017933 3300006353 Bacteria 3832
47 Ga0075430_100138349 3300006846 Bacteria 2028
48 Ga0068865_100000012 3300006881 Bacteria 145314
49 Ga0079104_1018694 3300006946 Bacteria 1956
50 Ga0105244_10074204 3300009036 Bacteria 1692
51 Ga0105240_10001767 3300009093 Bacteria 36501
52 Ga0105245_10000097 3300009098 Bacteria 84528
53 Ga0105245_10001089 3300009098 Bacteria 24632
54 Ga0105243_10000030 3300009148 Bacteria 190342
55 Ga0105243_10000297 3300009148 Bacteria 55019
56 Ga0105241_10152097 3300009174 Bacteria 1894
57 Ga0105242_10000645 3300009176 Bacteria 27285
58 Ga0105238_10476320 3300009551 Bacteria 1247
59 Ga0105239_10001135 3300010375 Bacteria 36722
60 Ga0105239_10795650 3300010375 Bacteria 1083
61 Ga0105246_10000776 3300011119 Bacteria 18109
62 Ga0157374_10000132 3300013296 Bacteria 68144
63 Ga0157378_10003091 3300013297 Bacteria 14800
64 Ga0157378_10391510 3300013297 Bacteria 1367
65 Ga0157375_10000294 3300013308 Bacteria 45311
66 Ga0157375_10913196 3300013308 Bacteria 1021
67 Ga0157376_10000198 3300014969 Bacteria 41983
68 Ga0182006_1000054 3300015261 Bacteria 174021
69 Ga0182005_1000012 3300015265 Bacteria 396944
70 Ga0163161_10000855 3300017792 Bacteria 23757
71 Ga0213872_10002557 3300021361 Bacteria 10597
72 Ga0209564_1000011 3300025295 Bacteria 822327
73 Ga0209758_1000001 3300025297 Bacteria 1981790
74 Ga0207645_10001624 3300025907 Bacteria 18349
75 Ga0207705_10002643 3300025909 Bacteria 13729
76 Ga0207705_10852468 3300025909 Unclassified 706
77 Ga0207654_10107306 3300025911 Bacteria 1731
78 Ga0207695_10001621 3300025913 Bacteria 36491
79 Ga0207657_10011709 3300025919 Bacteria 8691
80 Ga0207649_10062193 3300025920 Bacteria 2353
81 Ga0207694_10014794 3300025924 Bacteria 5883
82 Ga0207687_10000547 3300025927 Bacteria 25260
83 Ga0207687_10015430 3300025927 Bacteria 5010
84 Ga0207687_10614068 3300025927 Bacteria 917
85 Ga0207686_10000148 3300025934 Bacteria 53751
86 Ga0207709_10000137 3300025935 Bacteria 106203
87 Ga0207709_10000299 3300025935 Bacteria 54506
88 Ga0207669_10000031 3300025937 Bacteria 85825
89 Ga0207704_10000021 3300025938 Bacteria 148508
90 Ga0207689_10000132 3300025942 Bacteria 63321
91 Ga0207667_10001769 3300025949 Bacteria 27197
92 Ga0207651_10000012 3300025960 Bacteria 189928
93 Ga0207677_10000058 3300026023 Bacteria 95751
94 Ga0207678_10223970 3300026067 Bacteria 1610
95 Ga0207648_10000051 3300026089 Bacteria 108363
96 Ga0207648_10012162 3300026089 Bacteria 8063
97 Ga0207648_10228713 3300026089 Bacteria 1654
98 Ga0207674_10014284 3300026116 Bacteria 8775
99 Ga0207683_10000115 3300026121 Bacteria 65630
100 Ga0207698_10120048 3300026142 Bacteria 2223
101 Ga0207698_10516275 3300026142 Bacteria 1165
102 Ga0209281_1002444 3300027111 Bacteria 7450
103 Ga0209371_1000477 3300027312 Bacteria 39251
104 Ga0209983_1008049 3300027665 Bacteria 2155
105 Ga0209813_10000162 3300027866 Bacteria 22312
106 Ga0268256_1000405 3300030500 Bacteria 39251
107 Ga0307513_10001351 3300031456 Bacteria 35442
108 Ga0307408_100394450 3300031548 Bacteria 1187
109 Ga0307412_10013665 3300031911 Bacteria 4769
110 Ga0307411_10169268 3300032005 Bacteria 1646
111 Ga0395899_0201737 3300037312 Bacteria 1386
112 Ga0395899_0274307 3300037312 Bacteria 1149
113 Ga0395900_0010806 3300037418 Bacteria 9338
114 Ga0395900_0052186 3300037418 Bacteria 4209
115 Ga0395900_0061753 3300037418 Bacteria 3852
116 Ga0395900_0159267 3300037418 Bacteria 2303
117 Ga0395900_0171951 3300037418 Bacteria 2205
118 Ga0395900_0775382 3300037418 Bacteria 888
119 Ga0395898_0083933 3300037466 Bacteria 3070
120 Ga0395898_0523845 3300037466 Bacteria 1127
121 Ga0395905_0002220 3300037471 Bacteria 21904
122 Ga0395905_0005531 3300037471 Bacteria 12892
123 Ga0395905_0047819 3300037471 Bacteria 4008
124 Ga0395901_0107440 3300038443 Bacteria 2929
125 Ga0395901_0228186 3300038443 Bacteria 1945
126 Ga0395901_0231141 3300038443 Bacteria 1930
127 Ga0395901_0739702 3300038443 Bacteria 977
128 Ga0436361_0210459 3300039447 Unclassified 1893
129 Ga0436361_0266932 3300039447 Bacteria 57257
130 Ga0436361_0794096 3300039447 Bacteria 3481
131 Ga0436361_0871491 3300039447 Bacteria 4259
132 Ga0451807_0373153 3300041486 Bacteria 880
133 Ga0439458_0020592 3300042157 Bacteria 1524
134 Ga0466965_0021578 3300044683 Bacteria 3101
135 Ga0466966_0028949 3300044684 Bacteria 3606
136 Ga0466966_0209701 3300044684 Bacteria 1177
137 Ga0466961_0046353 3300044693 Bacteria 2781
138 Ga0466963_0022427 3300044694 Bacteria 3999
139 Ga0466963_0156491 3300044694 Bacteria 1585
140 Ga0466964_0008719 3300044706 Bacteria 3813
141 Ga0466971_0027551 3300044719 Bacteria 2545
142 Ga0466971_0095241 3300044719 Bacteria 1365
143 Ga0466957_0000010 3300044842 Bacteria 75391
144 Ga0466960_0193935 3300044901 Bacteria 1107
145 Ga0466959_0144617 3300045049 Bacteria 1678
146 Ga0466959_0228828 3300045049 Bacteria 1287
147 Ga0466967_0019602 3300045976 Bacteria 5445
148 Ga0466967_0417871 3300045976 Bacteria 1307
149 Ga0495617_000300 3300046452 Bacteria 28024
150 Ga0495627_000001 3300046453 Bacteria 1104709
151 Ga0495627_000078 3300046453 Bacteria 119920
152 Ga0495627_000125 3300046453 Bacteria 93485
153 Ga0495627_054672 3300046453 Unclassified 1193
154 Ga0495590_0000782 3300046457 Bacteria 14460
155 Ga0495590_0010971 3300046457 Bacteria 3396
156 Ga0495590_0076821 3300046457 Bacteria 1175
157 Ga0495591_002605 3300046458 Bacteria 9903
158 Ga0495638_0038540 3300046460 Bacteria 3036
159 Ga0495638_0109909 3300046460 Bacteria 1638
160 Ga0495653_0009293 3300046463 Bacteria 8044
161 Ga0495653_0088147 3300046463 Bacteria 2277
162 Ga0495650_0000184 3300046471 Bacteria 136939
163 Ga0495650_0000764 3300046471 Bacteria 39812
164 Ga0495650_0000815 3300046471 Bacteria 37931
165 Ga0495650_0001172 3300046471 Bacteria 28022
166 Ga0495650_0008064 3300046471 Bacteria 6219
167 Ga0495605_0000056 3300046474 Bacteria 155610
168 Ga0495605_0005950 3300046474 Bacteria 7055
169 Ga0495605_0010768 3300046474 Bacteria 5110
170 Ga0495605_0048855 3300046474 Bacteria 2069
171 Ga0495605_0242416 3300046474 Bacteria 773
172 Ga0495584_0000045 3300046491 Bacteria 89514
173 Ga0495584_0000639 3300046491 Bacteria 23311
174 Ga0495584_0003729 3300046491 Bacteria 8307
175 Ga0495584_0004173 3300046491 Bacteria 7799
176 Ga0495584_0005831 3300046491 Bacteria 6488
177 Ga0495584_0039763 3300046491 Bacteria 2376
178 Ga0495584_0078694 3300046491 Bacteria 1659
179 Ga0495585_0005625 3300046492 Bacteria 7870
180 Ga0495585_0071598 3300046492 Bacteria 1889
181 Ga0495594_0112777 3300046499 Bacteria 1533
182 Ga0495596_0000059 3300046500 Bacteria 80270
183 Ga0495596_0003287 3300046500 Bacteria 8251
184 Ga0495596_0004533 3300046500 Bacteria 6751
185 Ga0495596_0006057 3300046500 Bacteria 5635
186 Ga0495607_0000165 3300046501 Bacteria 70372
187 Ga0495607_0000324 3300046501 Bacteria 49450
188 Ga0495607_0003774 3300046501 Bacteria 11455
189 Ga0495607_0009436 3300046501 Bacteria 6607
190 Ga0495583_0000001 3300046506 Bacteria 811973
191 Ga0495583_0000011 3300046506 Bacteria 350215
192 Ga0495583_0000410 3300046506 Bacteria 65130
193 Ga0495583_0006398 3300046506 Bacteria 7709
194 Ga0495583_0011628 3300046506 Bacteria 5043
195 Ga0495606_0000062 3300046507 Bacteria 184841
196 Ga0495606_0001284 3300046507 Bacteria 34796
197 Ga0495606_0002490 3300046507 Bacteria 21296
198 Ga0495606_0003346 3300046507 Bacteria 17100
199 Ga0495606_0088633 3300046507 Bacteria 1907
200 Ga0495606_0104001 3300046507 Bacteria 1724
201 Ga0495606_0164060 3300046507 Bacteria 1294
202 Ga0495610_0000019 3300046512 Bacteria 351524
203 Ga0495610_0002251 3300046512 Bacteria 16320
204 Ga0495610_0005762 3300046512 Bacteria 8718
205 Ga0495616_0000034 3300046513 Bacteria 129394
206 Ga0495616_0002342 3300046513 Bacteria 12633
207 Ga0495616_0006972 3300046513 Bacteria 6803
208 Ga0495616_0012010 3300046513 Bacteria 4932
209 Ga0495616_0012309 3300046513 Bacteria 4859
210 Ga0495616_0015995 3300046513 Bacteria 4159
211 Ga0495616_0084573 3300046513 Bacteria 1512
212 Ga0495616_0098897 3300046513 Bacteria 1370
213 Ga0495620_0000633 3300046515 Bacteria 21895
214 Ga0495631_0003881 3300046518 Bacteria 8083
215 Ga0495631_0005146 3300046518 Bacteria 6893
216 Ga0495631_0007482 3300046518 Bacteria 5552
217 Ga0495631_0020009 3300046518 Bacteria 3132
218 Ga0495631_0104938 3300046518 Bacteria 1216
219 Ga0495632_0000001 3300046519 Bacteria 873295
220 Ga0495632_0000168 3300046519 Bacteria 67340
221 Ga0495632_0000636 3300046519 Bacteria 32294
222 Ga0495632_0001007 3300046519 Bacteria 24440
223 Ga0495632_0007911 3300046519 Bacteria 6609
224 Ga0495632_0012706 3300046519 Bacteria 4840
225 Ga0495632_0199582 3300046519 Bacteria 911
226 Ga0495637_0000412 3300046520 Bacteria 31651
227 Ga0495637_0000850 3300046520 Bacteria 20082
228 Ga0495643_0000020 3300046522 Bacteria 294973
229 Ga0495643_0000361 3300046522 Bacteria 61853
230 Ga0495643_0006851 3300046522 Bacteria 7427
231 Ga0495643_0014913 3300046522 Bacteria 4609
232 Ga0495643_0020207 3300046522 Bacteria 3844
233 Ga0495643_0020998 3300046522 Bacteria 3754
234 Ga0495643_0085939 3300046522 Bacteria 1630
235 Ga0495643_0167564 3300046522 Bacteria 1076
236 Ga0495644_0006314 3300046523 Bacteria 4603
237 Ga0495644_0009545 3300046523 Bacteria 3740
238 Ga0495648_0000300 3300046524 Bacteria 54935
239 Ga0495648_0001274 3300046524 Bacteria 25136
240 Ga0495648_0005102 3300046524 Bacteria 11016
241 Ga0495648_0008850 3300046524 Bacteria 7876
242 Ga0495648_0046958 3300046524 Bacteria 2673
243 Ga0495663_0000002 3300046525 Bacteria 495384
244 Ga0495666_0151144 3300046526 Bacteria 1079
245 Ga0495642_0000061 3300046528 Bacteria 65572
246 Ga0495642_0001122 3300046528 Bacteria 12332
247 Ga0495642_0026790 3300046528 Bacteria 2291
248 Ga0495642_0060524 3300046528 Bacteria 1570
249 Ga0495652_0040928 3300046529 Bacteria 4003
250 Ga0495654_0000706 3300046530 Bacteria 26213
251 Ga0495654_0016984 3300046530 Bacteria 3832
252 Ga0495586_0104531 3300046535 Bacteria 1574
253 Ga0495586_0182737 3300046535 Bacteria 1186
254 Ga0495587_0017735 3300046536 Bacteria 4419
255 Ga0495587_0046383 3300046536 Bacteria 2580
256 Ga0495609_0045725 3300046538 Bacteria 1961
257 Ga0495597_0000919 3300046542 Bacteria 22835
258 Ga0495597_0001459 3300046542 Bacteria 16935
259 Ga0495597_0001644 3300046542 Bacteria 15611
260 Ga0495597_0013358 3300046542 Bacteria 3935
261 Ga0495645_0084624 3300046543 Bacteria 2271
262 Ga0495622_0000006 3300046557 Bacteria 245799
263 Ga0495633_0000312 3300046558 Bacteria 55371
264 Ga0495633_0000413 3300046558 Bacteria 44456
265 Ga0495633_0004923 3300046558 Bacteria 8343
266 Ga0495633_0011869 3300046558 Bacteria 4667
267 Ga0495633_0027138 3300046558 Bacteria 2802
268 Ga0495633_0195564 3300046558 Bacteria 929
269 Ga0495656_0003729 3300046615 Bacteria 5173
270 Ga0495656_0024674 3300046615 Bacteria 2377
271 Ga0495656_0050280 3300046615 Bacteria 1779
272 Ga0495656_0098811 3300046615 Bacteria 1346
273 Ga0495668_0000018 3300046616 Bacteria 417480
274 Ga0495668_0000091 3300046616 Bacteria 144428
275 Ga0495668_0002360 3300046616 Bacteria 15707
276 Ga0495668_0012037 3300046616 Bacteria 5149
277 Ga0495668_0035036 3300046616 Bacteria 2813
278 Ga0495668_0066134 3300046616 Bacteria 1989
279 Ga0495634_0016601 3300046642 Bacteria 5262
280 Ga0495611_0000506 3300046648 Bacteria 23099
281 Ga0495611_0042052 3300046648 Bacteria 2040
282 Ga0495625_0000320 3300046660 Bacteria 73013
283 Ga0495625_0007836 3300046660 Bacteria 9204
284 Ga0495625_0071886 3300046660 Bacteria 2427
285 Ga0495625_0074686 3300046660 Bacteria 2374
286 Ga0495625_0092452 3300046660 Bacteria 2090
287 Ga0495661_0000109 3300046665 Bacteria 97921
288 Ga0495661_0001619 3300046665 Bacteria 18447
289 Ga0495661_0002611 3300046665 Bacteria 13813
290 Ga0495661_0008495 3300046665 Bacteria 7102
291 Ga0495661_0024572 3300046665 Bacteria 3901
292 Ga0495661_0038797 3300046665 Bacteria 2964
293 Ga0495661_0051911 3300046665 Bacteria 2473
294 Ga0495661_0072681 3300046665 Bacteria 2006
295 Ga0495588_0000098 3300046674 Bacteria 166999
296 Ga0495588_0028410 3300046674 Bacteria 2799
297 Ga0495588_0192189 3300046674 Bacteria 1078
298 Ga0495669_0000498 3300046684 Bacteria 18031
299 Ga0495669_0006141 3300046684 Bacteria 5010
300 Ga0495669_0008931 3300046684 Bacteria 4221
301 Ga0495669_0391494 3300046684 Bacteria 673
302 Ga0495670_0001168 3300046691 Bacteria 12753
303 Ga0495670_0195818 3300046691 Bacteria 1069
304 Ga0495670_0245743 3300046691 Unclassified 953
305 Ga0495671_0000016 3300046692 Bacteria 294821
306 Ga0495671_0000159 3300046692 Bacteria 59318
307 Ga0495671_0002797 3300046692 Bacteria 10915
308 Ga0495671_0073193 3300046692 Bacteria 1682
309 Ga0495649_0000067 3300046694 Bacteria 92384
310 Ga0495649_0001755 3300046694 Bacteria 15985
311 Ga0495649_0075186 3300046694 Bacteria 1809
312 Ga0495649_0086486 3300046694 Bacteria 1673
313 Ga0495649_0184257 3300046694 Bacteria 1088
314 Ga0495649_0377273 3300046694 Bacteria 714
315 Ga0495589_0000045 3300046794 Bacteria 123922
316 Ga0495589_0000054 3300046794 Bacteria 111355
317 Ga0495589_0034347 3300046794 Bacteria 2546
318 Ga0495589_0039793 3300046794 Bacteria 2349
319 Ga0495589_0121517 3300046794 Bacteria 1257
320 Ga0495660_0000055 3300046810 Bacteria 134615
321 Ga0495660_0007613 3300046810 Bacteria 6360
322 Ga0495660_0027531 3300046810 Bacteria 3216
323 Ga0495581_0296772 3300047315 Bacteria 945
324 Ga0495672_0000820 3300047320 Bacteria 33401
325 Ga0495672_0005768 3300047320 Bacteria 9739
326 Ga0495672_0101422 3300047320 Bacteria 1560
327 Ga0495680_0012680 3300047322 Bacteria 7401
328 Ga0495683_0001505 3300047323 Bacteria 15121
329 Ga0495683_0014111 3300047323 Bacteria 4163
330 Ga0495683_0070993 3300047323 Unclassified 1709
331 Ga0495683_0084316 3300047323 Bacteria 1546
332 Ga0495683_0087874 3300047323 Bacteria 1509
333 Ga0495687_000012 3300047443 Bacteria 391586
334 Ga0495687_000016 3300047443 Bacteria 359237
335 Ga0495687_000708 3300047443 Bacteria 37141
336 Ga0495687_000843 3300047443 Bacteria 32659
337 Ga0495687_001687 3300047443 Bacteria 19701
338 Ga0495687_037177 3300047443 Bacteria 2171
339 Ga0495675_0012498 3300047444 Bacteria 5344
340 Ga0495677_0000126 3300047445 Bacteria 37137
341 Ga0495677_0000309 3300047445 Bacteria 21155
342 Ga0495677_0001144 3300047445 Bacteria 10598
343 Ga0495679_004846 3300047446 Bacteria 6080
344 Ga0495673_0000263 3300047469 Bacteria 73113
345 Ga0495673_0000841 3300047469 Bacteria 28516
346 Ga0495673_0015856 3300047469 Bacteria 3869
347 Ga0495681_0000063 3300047470 Bacteria 99734
348 Ga0495681_0000208 3300047470 Bacteria 48683
349 Ga0495681_0000802 3300047470 Bacteria 24208
350 Ga0495681_0002840 3300047470 Bacteria 12239
351 Ga0495681_0030263 3300047470 Unclassified 2759
352 Ga0495681_0042281 3300047470 Bacteria 2207
353 Ga0495681_0049687 3300047470 Bacteria 1981
354 Ga0495681_0084934 3300047470 Bacteria 1406
355 Ga0495681_0186731 3300047470 Bacteria 848
356 Ga0495686_0002090 3300047472 Bacteria 19631
357 Ga0495686_0003050 3300047472 Bacteria 14842
358 Ga0495686_0004833 3300047472 Bacteria 10878
359 Ga0495686_0009263 3300047472 Bacteria 7111
360 Ga0495686_0112418 3300047472 Bacteria 1632
361 Ga0495602_0003531 3300048088 Bacteria 16157
362 Ga0495615_0000010 3300048090 Bacteria 70447
363 Ga0495615_0001489 3300048090 Bacteria 3507
364 Ga0495615_0013682 3300048090 Bacteria 1699
365 Ga0495626_0000053 3300048091 Bacteria 155543
366 Ga0495626_0000526 3300048091 Bacteria 38270
367 Ga0495626_0000592 3300048091 Bacteria 35519
368 Ga0495626_0002095 3300048091 Bacteria 14508
369 Ga0495626_0003625 3300048091 Bacteria 9822
370 Ga0495626_0007702 3300048091 Bacteria 5967
371 Ga0495626_0008640 3300048091 Bacteria 5565
372 Ga0495626_0072451 3300048091 Bacteria 1545
373 Ga0495626_0080558 3300048091 Bacteria 1447
374 Ga0496101_0038135 3300048904 Bacteria 3412
375 Ga0496101_0538281 3300048904 Bacteria 923
376 Ga0496102_0009677 3300048905 Bacteria 8290
377 Ga0496102_0011657 3300048905 Bacteria 7587
378 Ga0496102_0172777 3300048905 Bacteria 2034
379 Ga0496102_0502911 3300048905 Bacteria 1134
380 Ga0496107_0581319 3300048910 Bacteria 829
381 Ga0496109_0006189 3300048912 Bacteria 10059
382 Ga0496112_0032981 3300048915 Bacteria 5030
383 Ga0496113_0009275 3300048916 Bacteria 6455
384 Ga0496113_0324180 3300048916 Bacteria 1235
385 Ga0496114_0055824 3300048917 Bacteria 3295
386 Ga0496116_0000093 3300048919 Bacteria 205660
387 Ga0496116_0114719 3300048919 Bacteria 1573
388 Ga0496117_0000117 3300048920 Bacteria 177596
389 Ga0496117_0031309 3300048920 Bacteria 4064
390 Ga0496117_0033516 3300048920 Bacteria 3882
391 Ga0496118_0000025 3300048921 Bacteria 379363
392 Ga0496118_0005210 3300048921 Bacteria 14872
393 Ga0496118_0018407 3300048921 Bacteria 6306
394 Ga0496119_0003770 3300048922 Bacteria 15511
395 Ga0496119_0033489 3300048922 Bacteria 3404
396 Ga0496120_0014459 3300048923 Bacteria 5259
397 Ga0496120_0032521 3300048923 Bacteria 3144
398 Ga0496121_0000226 3300048924 Bacteria 121831
399 Ga0496121_0047844 3300048924 Bacteria 3644
400 Ga0496121_0051601 3300048924 Bacteria 3462
401 Ga0496121_0121422 3300048924 Bacteria 1973
402 Ga0496122_0000572 3300048925 Bacteria 75443
403 Ga0496122_0000702 3300048925 Bacteria 66240
404 Ga0496122_0007295 3300048925 Bacteria 12349
405 Ga0496122_0037305 3300048925 Bacteria 3914
406 Ga0496123_0000584 3300048926 Bacteria 62207
407 Ga0496123_0000914 3300048926 Bacteria 46373
408 Ga0496123_0001331 3300048926 Bacteria 34894
409 Ga0496123_0004173 3300048926 Bacteria 15446
410 Ga0496123_0167474 3300048926 Unclassified 1163
411 Ga0496124_0000374 3300048927 Bacteria 81451
412 Ga0496124_0002349 3300048927 Bacteria 24977
413 Ga0496124_0003374 3300048927 Bacteria 19616
414 Ga0496124_0067972 3300048927 Bacteria 2963
415 Ga0496124_0079706 3300048927 Bacteria 2696
416 Ga0496124_0083416 3300048927 Bacteria 2622
417 Ga0496125_0000373 3300048928 Bacteria 84239
418 Ga0496125_0001849 3300048928 Bacteria 29183
419 Ga0496125_0003220 3300048928 Bacteria 20145
420 Ga0496125_0005926 3300048928 Bacteria 13391
421 Ga0496125_0032373 3300048928 Bacteria 4645
422 Ga0496125_0151495 3300048928 Bacteria 1592
423 Ga0496125_0328423 3300048928 Bacteria 923
424 Ga0496126_0002875 3300048929 Bacteria 22468
425 Ga0496126_0033033 3300048929 Bacteria 4870
426 Ga0496126_0191237 3300048929 Bacteria 1733
427 Ga0496126_0262239 3300048929 Bacteria 1436
428 Ga0495678_000061 3300049459 Bacteria 142649
429 Ga0495678_013375 3300049459 Bacteria 3856
430 Ga0495678_083656 3300049459 Unclassified 1140
431 Ga0495682_0000243 3300049460 Bacteria 43302
432 nmdc:mga03n38_3425_c1 3300050490 Bacteria 5092
433 nmdc:mga06z11_8_c1 3300050494 Bacteria 115826
434 nmdc:mga04h51_8_c1 3300050495 Bacteria 107557
435 nmdc:mga07m45_18517_c1 3300050496 Bacteria 3761
436 nmdc:mga0qj67_128583_c1 3300050509 Bacteria 2050
437 Ga0500644_0000031 3300053088 Bacteria 86737
438 Ga0500651_0353748 3300053093 Bacteria 833
439 Ga0500618_000152 3300053125 Bacteria 57055
440 Ga0500618_000711 3300053125 Bacteria 19286
441 Ga0500618_143246 3300053125 Bacteria 544
442 Ga0500559_0000029 3300053136 Bacteria 117549
443 Ga0500559_0000091 3300053136 Bacteria 72157
444 Ga0500564_000370 3300053138 Bacteria 12769
445 Ga0466962_0190428 3300061719 Bacteria 1001
446 2524612612 2524023250 Bacteria 5457705
447 2599412746 2599185169 Bacteria 5441380
448 2601525754 2600255254 Bacteria 5281859
449 2601528050 2600255255 Bacteria 5282785
450 2601614884 2600255280 Bacteria 5292309
451 2601620191 2600255281 Bacteria 5288753
452 2601645975 2600255287 Bacteria 5210468
453 2601648593 2600255288 Bacteria 5282738
454 2601652939 2600255289 Bacteria 5281907
455 2601658944 2600255290 Bacteria 5282218
456 2601666035 2600255291 Bacteria 5217298
457 2601698932 2600255298 Bacteria 5215185
458 2601703904 2600255299 Bacteria 5218662
459 2601705590 2600255300 Bacteria 5287774
460 2601711179 2600255301 Bacteria 5280532
461 2601716193 2600255302 Bacteria 5288235
462 2601723838 2600255303 Bacteria 5219315
463 2601726599 2600255304 Bacteria 5283973
464 2601731139 2600255305 Bacteria 5282329
465 2601736155 2600255306 Bacteria 5281613
466 2601743506 2600255307 Bacteria 5439064
467 2601754136 2600255309 Bacteria 5431045
468 2602021238 2600255392 Bacteria 5437392
469 2603658909 2602042052 Bacteria 5215873
470 2603663697 2602042053 Bacteria 5214361
471 2603838537 2602042103 Bacteria 5284714
472 2603844209 2602042104 Bacteria 5281639
473 2603848688 2602042105 Bacteria 5282303
474 2603853761 2602042106 Bacteria 5282744
475 2603871813 2602042110 Bacteria 5283285
476 2603879290 2602042111 Bacteria 5212080
477 2606049001 2603880178 Bacteria 5283018
478 2606068123 2603880184 Bacteria 5217896
479 2606146679 2603880202 Bacteria 5284684
480 2606176406 2603880211 Bacteria 5284226
481 2643800656 2643221556 Bacteria 7251154
482 2644470885 2643221684 Bacteria 7145183
483 2676409651 2675903046 Bacteria 5451247
484 2738709485 2738541275 Bacteria 4830863
485 2738741323 2738541280 Bacteria 6630198
486 2738847910 2738541301 Bacteria 4834102
487 2738863639 2738541304 Bacteria 4833665
488 2739296157 2738543022 Bacteria 4835059
489 2739357835 2738543033 Bacteria 4833336
490 2753763581 2751185897 Bacteria 5322941
491 2819555243 2818991438 Bacteria 5793701
492 2928102620 2928100450 Bacteria 4837635
493 2928959293 2928959182 Bacteria 4725774
494 2984563247 2984559226 Bacteria 5683096
495 2984595983 2984595703 Bacteria 5682994
496 8047677483 8047673197 Bacteria 7395230
497 Ga0501034_0114396
498 JGI25153J46596_10000005
499 rootH1_10081268
500 rootH1_10085143
501 rootH2_10049627
502 rootL2_10070594
503 rootL2_10092277
504 rootH1_10336900
505 Ga0055526_1000028
506 Ga0058692_1012941
507 Ga0065165_1021464
508 Ga0065714_10064925
509 Ga0070658_10176175
510 Ga0070658_10180636
511 Ga0070658_10223758
512 Ga0070658_10633234
513 Ga0070676_10000540
514 Ga0068869_100000212
515 Ga0068868_100000228
516 Ga0070660_100012204
517 Ga0070661_100075568
518 Ga0070661_100077281
519 Ga0070675_100068206
520 Ga0070675_100679178
521 Ga0070674_100000131
522 Ga0070673_100000011
523 Ga0070673_100115076
524 Ga0070673_100503247
525 Ga0070659_100017673
526 Ga0070678_100000005
527 Ga0068867_100000049
528 Ga0068867_100094571
529 Ga0070672_100034259
530 Ga0068855_100008922
531 Ga0070664_100871380
532 Ga0068857_100008750
533 Ga0068854_100215119
534 Ga0068852_100159432
535 Ga0068858_100000310
536 Ga0081539_10205639
537 Ga0075368_10000045
538 Ga0075363_100004927
539 Ga0075367_10000202
540 Ga0097621_100039630
541 Ga0075370_10017933
542 Ga0075430_100138349
543 Ga0068865_100000012
544 Ga0079104_1018694
545 Ga0105244_10074204
546 Ga0105240_10001767
547 Ga0105245_10000097
548 Ga0105245_10001089
549 Ga0105243_10000030
550 Ga0105243_10000297
551 Ga0105241_10152097
552 Ga0105242_10000645
553 Ga0105238_10476320
554 Ga0105239_10001135
555 Ga0105239_10795650
556 Ga0105246_10000776
557 Ga0157374_10000132
558 Ga0157378_10003091
559 Ga0157378_10391510
560 Ga0157375_10000294
561 Ga0157375_10913196
562 Ga0157376_10000198
563 Ga0182006_1000054
564 Ga0182005_1000012
565 Ga0163161_10000855
566 Ga0213872_10002557
567 Ga0209564_1000011
568 Ga0209758_1000001
569 Ga0207645_10001624
570 Ga0207705_10002643
571 Ga0207705_10852468
572 Ga0207654_10107306
573 Ga0207695_10001621
574 Ga0207657_10011709
575 Ga0207649_10062193
576 Ga0207694_10014794
577 Ga0207687_10000547
578 Ga0207687_10015430
579 Ga0207687_10614068
580 Ga0207686_10000148
581 Ga0207709_10000137
582 Ga0207709_10000299
583 Ga0207669_10000031
584 Ga0207704_10000021
585 Ga0207689_10000132
586 Ga0207667_10001769
587 Ga0207651_10000012
588 Ga0207677_10000058
589 Ga0207678_10223970
590 Ga0207648_10000051
591 Ga0207648_10012162
592 Ga0207648_10228713
593 Ga0207674_10014284
594 Ga0207683_10000115
595 Ga0207698_10120048
596 Ga0207698_10516275
597 Ga0209281_1002444
598 Ga0209371_1000477
599 Ga0209983_1008049
600 Ga0209813_10000162
601 Ga0268256_1000405
602 Ga0307513_10001351
603 Ga0307408_100394450
604 Ga0307412_10013665
605 Ga0307411_10169268
606 Ga0395899_0201737
607 Ga0395899_0274307
608 Ga0395900_0010806
609 Ga0395900_0052186
610 Ga0395900_0061753
611 Ga0395900_0159267
612 Ga0395900_0171951
613 Ga0395900_0775382
614 Ga0395898_0083933
615 Ga0395898_0523845
616 Ga0395905_0002220
617 Ga0395905_0005531
618 Ga0395905_0047819
619 Ga0395901_0107440
620 Ga0395901_0228186
621 Ga0395901_0231141
622 Ga0395901_0739702
623 Ga0436361_0210459
624 Ga0436361_0266932
625 Ga0436361_0794096
626 Ga0436361_0871491
627 Ga0451807_0373153
628 Ga0439458_0020592
629 Ga0466965_0021578
630 Ga0466966_0028949
631 Ga0466966_0209701
632 Ga0466961_0046353
633 Ga0466963_0022427
634 Ga0466963_0156491
635 Ga0466964_0008719
636 Ga0466971_0027551
637 Ga0466971_0095241
638 Ga0466957_0000010
639 Ga0466960_0193935
640 Ga0466959_0144617
641 Ga0466959_0228828
642 Ga0466967_0019602
643 Ga0466967_0417871
644 Ga0495617_000300
645 Ga0495627_000001
646 Ga0495627_000078
647 Ga0495627_000125
648 Ga0495627_054672
649 Ga0495590_0000782
650 Ga0495590_0010971
651 Ga0495590_0076821
652 Ga0495591_002605
653 Ga0495638_0038540
654 Ga0495638_0109909
655 Ga0495653_0009293
656 Ga0495653_0088147
657 Ga0495650_0000184
658 Ga0495650_0000764
659 Ga0495650_0000815
660 Ga0495650_0001172
661 Ga0495650_0008064
662 Ga0495605_0000056
663 Ga0495605_0005950
664 Ga0495605_0010768
665 Ga0495605_0048855
666 Ga0495605_0242416
667 Ga0495584_0000045
668 Ga0495584_0000639
669 Ga0495584_0003729
670 Ga0495584_0004173
671 Ga0495584_0005831
672 Ga0495584_0039763
673 Ga0495584_0078694
674 Ga0495585_0005625
675 Ga0495585_0071598
676 Ga0495594_0112777
677 Ga0495596_0000059
678 Ga0495596_0003287
679 Ga0495596_0004533
680 Ga0495596_0006057
681 Ga0495607_0000165
682 Ga0495607_0000324
683 Ga0495607_0003774
684 Ga0495607_0009436
685 Ga0495583_0000001
686 Ga0495583_0000011
687 Ga0495583_0000410
688 Ga0495583_0006398
689 Ga0495583_0011628
690 Ga0495606_0000062
691 Ga0495606_0001284
692 Ga0495606_0002490
693 Ga0495606_0003346
694 Ga0495606_0088633
695 Ga0495606_0104001
696 Ga0495606_0164060
697 Ga0495610_0000019
698 Ga0495610_0002251
699 Ga0495610_0005762
700 Ga0495616_0000034
701 Ga0495616_0002342
702 Ga0495616_0006972
703 Ga0495616_0012010
704 Ga0495616_0012309
705 Ga0495616_0015995
706 Ga0495616_0084573
707 Ga0495616_0098897
708 Ga0495620_0000633
709 Ga0495631_0003881
710 Ga0495631_0005146
711 Ga0495631_0007482
712 Ga0495631_0020009
713 Ga0495631_0104938
714 Ga0495632_0000001
715 Ga0495632_0000168
716 Ga0495632_0000636
717 Ga0495632_0001007
718 Ga0495632_0007911
719 Ga0495632_0012706
720 Ga0495632_0199582
721 Ga0495637_0000412
722 Ga0495637_0000850
723 Ga0495643_0000020
724 Ga0495643_0000361
725 Ga0495643_0006851
726 Ga0495643_0014913
727 Ga0495643_0020207
728 Ga0495643_0020998
729 Ga0495643_0085939
730 Ga0495643_0167564
731 Ga0495644_0006314
732 Ga0495644_0009545
733 Ga0495648_0000300
734 Ga0495648_0001274
735 Ga0495648_0005102
736 Ga0495648_0008850
737 Ga0495648_0046958
738 Ga0495663_0000002
739 Ga0495666_0151144
740 Ga0495642_0000061
741 Ga0495642_0001122
742 Ga0495642_0026790
743 Ga0495642_0060524
744 Ga0495652_0040928
745 Ga0495654_0000706
746 Ga0495654_0016984
747 Ga0495586_0104531
748 Ga0495586_0182737
749 Ga0495587_0017735
750 Ga0495587_0046383
751 Ga0495609_0045725
752 Ga0495597_0000919
753 Ga0495597_0001459
754 Ga0495597_0001644
755 Ga0495597_0013358
756 Ga0495645_0084624
757 Ga0495622_0000006
758 Ga0495633_0000312
759 Ga0495633_0000413
760 Ga0495633_0004923
761 Ga0495633_0011869
762 Ga0495633_0027138
763 Ga0495633_0195564
764 Ga0495656_0003729
765 Ga0495656_0024674
766 Ga0495656_0050280
767 Ga0495656_0098811
768 Ga0495668_0000018
769 Ga0495668_0000091
770 Ga0495668_0002360
771 Ga0495668_0012037
772 Ga0495668_0035036
773 Ga0495668_0066134
774 Ga0495634_0016601
775 Ga0495611_0000506
776 Ga0495611_0042052
777 Ga0495625_0000320
778 Ga0495625_0007836
779 Ga0495625_0071886
780 Ga0495625_0074686
781 Ga0495625_0092452
782 Ga0495661_0000109
783 Ga0495661_0001619
784 Ga0495661_0002611
785 Ga0495661_0008495
786 Ga0495661_0024572
787 Ga0495661_0038797
788 Ga0495661_0051911
789 Ga0495661_0072681
790 Ga0495588_0000098
791 Ga0495588_0028410
792 Ga0495588_0192189
793 Ga0495669_0000498
794 Ga0495669_0006141
795 Ga0495669_0008931
796 Ga0495669_0391494
797 Ga0495670_0001168
798 Ga0495670_0195818
799 Ga0495670_0245743
800 Ga0495671_0000016
801 Ga0495671_0000159
802 Ga0495671_0002797
803 Ga0495671_0073193
804 Ga0495649_0000067
805 Ga0495649_0001755
806 Ga0495649_0075186
807 Ga0495649_0086486
808 Ga0495649_0184257
809 Ga0495649_0377273
810 Ga0495589_0000045
811 Ga0495589_0000054
812 Ga0495589_0034347
813 Ga0495589_0039793
814 Ga0495589_0121517
815 Ga0495660_0000055
816 Ga0495660_0007613
817 Ga0495660_0027531
818 Ga0495581_0296772
819 Ga0495672_0000820
820 Ga0495672_0005768
821 Ga0495672_0101422
822 Ga0495680_0012680
823 Ga0495683_0001505
824 Ga0495683_0014111
825 Ga0495683_0070993
826 Ga0495683_0084316
827 Ga0495683_0087874
828 Ga0495687_000012
829 Ga0495687_000016
830 Ga0495687_000708
831 Ga0495687_000843
832 Ga0495687_001687
833 Ga0495687_037177
834 Ga0495675_0012498
835 Ga0495677_0000126
836 Ga0495677_0000309
837 Ga0495677_0001144
838 Ga0495679_004846
839 Ga0495673_0000263
840 Ga0495673_0000841
841 Ga0495673_0015856
842 Ga0495681_0000063
843 Ga0495681_0000208
844 Ga0495681_0000802
845 Ga0495681_0002840
846 Ga0495681_0030263
847 Ga0495681_0042281
848 Ga0495681_0049687
849 Ga0495681_0084934
850 Ga0495681_0186731
851 Ga0495686_0002090
852 Ga0495686_0003050
853 Ga0495686_0004833
854 Ga0495686_0009263
855 Ga0495686_0112418
856 Ga0495602_0003531
857 Ga0495615_0000010
858 Ga0495615_0001489
859 Ga0495615_0013682
860 Ga0495626_0000053
861 Ga0495626_0000526
862 Ga0495626_0000592
863 Ga0495626_0002095
864 Ga0495626_0003625
865 Ga0495626_0007702
866 Ga0495626_0008640
867 Ga0495626_0072451
868 Ga0495626_0080558
869 Ga0496101_0038135
870 Ga0496101_0538281
871 Ga0496102_0009677
872 Ga0496102_0011657
873 Ga0496102_0172777
874 Ga0496102_0502911
875 Ga0496107_0581319
876 Ga0496109_0006189
877 Ga0496112_0032981
878 Ga0496113_0009275
879 Ga0496113_0324180
880 Ga0496114_0055824
881 Ga0496116_0000093
882 Ga0496116_0114719
883 Ga0496117_0000117
884 Ga0496117_0031309
885 Ga0496117_0033516
886 Ga0496118_0000025
887 Ga0496118_0005210
888 Ga0496118_0018407
889 Ga0496119_0003770
890 Ga0496119_0033489
891 Ga0496120_0014459
892 Ga0496120_0032521
893 Ga0496121_0000226
894 Ga0496121_0047844
895 Ga0496121_0051601
896 Ga0496121_0121422
897 Ga0496122_0000572
898 Ga0496122_0000702
899 Ga0496122_0007295
900 Ga0496122_0037305
901 Ga0496123_0000584
902 Ga0496123_0000914
903 Ga0496123_0001331
904 Ga0496123_0004173
905 Ga0496123_0167474
906 Ga0496124_0000374
907 Ga0496124_0002349
908 Ga0496124_0003374
909 Ga0496124_0067972
910 Ga0496124_0079706
911 Ga0496124_0083416
912 Ga0496125_0000373
913 Ga0496125_0001849
914 Ga0496125_0003220
915 Ga0496125_0005926
916 Ga0496125_0032373
917 Ga0496125_0151495
918 Ga0496125_0328423
919 Ga0496126_0002875
920 Ga0496126_0033033
921 Ga0496126_0191237
922 Ga0496126_0262239
923 Ga0495678_000061
924 Ga0495678_013375
925 Ga0495678_083656
926 Ga0495682_0000243
927 nmdc:mga03n38_3425_c1
928 nmdc:mga06z11_8_c1
929 nmdc:mga04h51_8_c1
930 nmdc:mga07m45_18517_c1
931 nmdc:mga0qj67_128583_c1
932 Ga0500644_0000031
933 Ga0500651_0353748
934 Ga0500618_000152
935 Ga0500618_000711
936 Ga0500618_143246
937 Ga0500559_0000029
938 Ga0500559_0000091
939 Ga0500564_000370
940 Ga0466962_0190428
941 2524612612
942 2599412746
943 2601525754
944 2601528050
945 2601614884
946 2601620191
947 2601645975
948 2601648593
949 2601652939
950 2601658944
951 2601666035
952 2601698932
953 2601703904
954 2601705590
955 2601711179
956 2601716193
957 2601723838
958 2601726599
959 2601731139
960 2601736155
961 2601743506
962 2601754136
963 2602021238
964 2603658909
965 2603663697
966 2603838537
967 2603844209
968 2603848688
969 2603853761
970 2603871813
971 2603879290
972 2606049001
973 2606068123
974 2606146679
975 2606176406
976 2643800656
977 2644470885
978 2676409651
979 2738709485
980 2738741323
981 2738847910
982 2738863639
983 2739296157
984 2739357835
985 2753763581
986 2819555243
987 2928102620
988 2928959293
989 2984563247
990 2984595983
991 8047677483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

30

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q62-assembly1.cif.gz_D crystal structure of arsh from sinorhizobium meliloti 0.903 1 185
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.8966 7 184
2q62-assembly2.cif.gz_F crystal structure of arsh from sinorhizobium meliloti 0.8846 1 185
2fzv-assembly1.cif.gz_D crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8792 2 185
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8788 6 187
ID Description Score Start End Superfamily
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8831 1 187 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8771 7 187 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8713 2 186 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8622 7 187 3.40.50.360
af_Q2G0L7_1_184_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.85 6 186 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A239F0S3-F1-model_v4 FMN reductase 0.9915 3 186 GO:0005829
GO:0010181
GO:0016491
AF-A0A1G7PRJ4-F1-model_v4 FMN reductase 0.9915 4 184 GO:0005829
GO:0010181
GO:0052873
AF-A0A2N3DG65-F1-model_v4 NADPH-dependent FMN reductase 0.9896 6 182 GO:0005829
GO:0010181
GO:0016491
AF-A0A7T8ACE9-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9882 1 186 GO:0005829
GO:0010181
GO:0016491
AF-A0A4R6FFD0-F1-model_v4 FMN reductase 0.9866 1 188 GO:0005829
GO:0010181
GO:0016491

Map