F454787

General Info

Members Datasets Scaffolds Average Seq Length
495 253 990 278

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0447528|Ga0501034_0447528_173_1039
Length 288
Sequence MARILGGIGTSHVPTIGVAFDRGKHEDPDWKPLFEQYKPVAAWLAEKKPDVFVYIYNDHATTFFFDHYPTFALGVSAQYPIADEGLGPRKVPPIRGHAPLARHIAHSLVNDEFDISIFQDLPLDHGCNSPMTMLFPQTVKENAWPVAMVPLAVNVLQHPVPTPMRCWKLGKAIRKAVLSFPEDLRVVIAGTGGLSHQMNGERAGYNDTDWDEQFLDLIHRDPAKLTAMRLADYAKLGGTEGAEEIMWLAMRGALSDKVKKVHSAYYLAMTTTMAVELLEEPETEKVAA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
207 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
253 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0.2
Rhizoplane 0.2
Rhizosphere 96.57
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0447528 3300049571 Unclassified 1210
2 Ga0065707_10119754 3300005295 Bacteria 2151
3 Ga0070690_100000209 3300005330 Bacteria 30439
4 Ga0070690_100077586 3300005330 Bacteria 2169
5 Ga0070690_100272785 3300005330 Bacteria 1204
6 Ga0068869_100003175 3300005334 Bacteria 10031
7 Ga0068869_100148356 3300005334 Bacteria 1817
8 Ga0070666_10032342 3300005335 Bacteria 3455
9 Ga0070680_100009242 3300005336 Bacteria 7561
10 Ga0070680_100236059 3300005336 Bacteria 1545
11 Ga0070682_100001825 3300005337 Bacteria 11864
12 Ga0068868_100000337 3300005338 Bacteria 31658
13 Ga0068868_100106470 3300005338 Bacteria 2275
14 Ga0070689_100003242 3300005340 Bacteria 10793
15 Ga0070689_100268563 3300005340 Bacteria 1412
16 Ga0070687_100000022 3300005343 Bacteria 52094
17 Ga0070687_100256815 3300005343 Bacteria 1089
18 Ga0070692_10001244 3300005345 Bacteria 9092
19 Ga0070692_10003785 3300005345 Bacteria 6224
20 Ga0070692_10054771 3300005345 Bacteria 2084
21 Ga0070692_10217417 3300005345 Bacteria 1128
22 Ga0070668_100029611 3300005347 Bacteria 4159
23 Ga0070668_100332554 3300005347 Bacteria 1282
24 Ga0070669_100002546 3300005353 Bacteria 13173
25 Ga0070669_100091916 3300005353 Bacteria 2277
26 Ga0070675_100035041 3300005354 Bacteria 4076
27 Ga0070675_100036744 3300005354 Bacteria 3988
28 Ga0070674_100044071 3300005356 Bacteria 3039
29 Ga0070674_100085673 3300005356 Bacteria 2262
30 Ga0070673_100098165 3300005364 Bacteria 2407
31 Ga0070688_100100342 3300005365 Bacteria 1908
32 Ga0070688_100143988 3300005365 Bacteria 1622
33 Ga0070659_100270827 3300005366 Bacteria 1411
34 Ga0070701_10000098 3300005438 Bacteria 24485
35 Ga0070701_10033816 3300005438 Bacteria 2557
36 Ga0070701_10084120 3300005438 Bacteria 1729
37 Ga0070701_10164763 3300005438 Bacteria 1287
38 Ga0070705_100000199 3300005440 Bacteria 35224
39 Ga0070705_100012156 3300005440 Bacteria 4367
40 Ga0070705_100128787 3300005440 Bacteria 1648
41 Ga0070705_100214805 3300005440 Bacteria 1328
42 Ga0070700_100000502 3300005441 Bacteria 19488
43 Ga0070700_100000624 3300005441 Bacteria 17574
44 Ga0070700_100058955 3300005441 Bacteria 2414
45 Ga0070694_100009600 3300005444 Bacteria 5936
46 Ga0070694_100280814 3300005444 Bacteria 1269
47 Ga0070663_100009645 3300005455 Bacteria 5987
48 Ga0070663_100150730 3300005455 Bacteria 1783
49 Ga0070678_100101737 3300005456 Bacteria 2228
50 Ga0070678_100528209 3300005456 Bacteria 1045
51 Ga0070662_100348956 3300005457 Bacteria 1212
52 Ga0070681_10001304 3300005458 Bacteria 21760
53 Ga0070681_10018326 3300005458 Bacteria 6997
54 Ga0068867_100000231 3300005459 Bacteria 36523
55 Ga0068867_100008572 3300005459 Bacteria 7216
56 Ga0068867_100075492 3300005459 Bacteria 2529
57 Ga0070679_100029290 3300005530 Bacteria 5433
58 Ga0070679_100062118 3300005530 Bacteria 3723
59 Ga0070697_100097925 3300005536 Bacteria 2434
60 Ga0068853_100081407 3300005539 Bacteria 2835
61 Ga0070672_100114912 3300005543 Bacteria 2197
62 Ga0070686_100000124 3300005544 Bacteria 54388
63 Ga0070686_100092808 3300005544 Bacteria 2022
64 Ga0070686_100158029 3300005544 Bacteria 1594
65 Ga0070686_100428135 3300005544 Bacteria 1012
66 Ga0070695_100000276 3300005545 Bacteria 25838
67 Ga0070695_100004953 3300005545 Bacteria 7851
68 Ga0070696_100000275 3300005546 Bacteria 30800
69 Ga0070696_100012541 3300005546 Bacteria 5689
70 Ga0070696_100029579 3300005546 Bacteria 3745
71 Ga0070693_100000130 3300005547 Bacteria 33644
72 Ga0070693_100160084 3300005547 Bacteria 1433
73 Ga0070704_100001666 3300005549 Bacteria 12048
74 Ga0070704_100117936 3300005549 Bacteria 2032
75 Ga0068855_100000977 3300005563 Bacteria 35582
76 Ga0068854_100000985 3300005578 Bacteria 17141
77 Ga0070702_100000042 3300005615 Bacteria 34567
78 Ga0070702_100049059 3300005615 Bacteria 2406
79 Ga0068859_100001713 3300005617 Bacteria 22369
80 Ga0068859_100080690 3300005617 Bacteria 3294
81 Ga0068859_100082734 3300005617 Bacteria 3253
82 Ga0068859_100293811 3300005617 Bacteria 1718
83 Ga0068866_10002281 3300005718 Bacteria 7943
84 Ga0068866_10010911 3300005718 Bacteria 3913
85 Ga0068866_10030132 3300005718 Bacteria 2601
86 Ga0068861_100001131 3300005719 Bacteria 16573
87 Ga0068861_100209144 3300005719 Bacteria 1642
88 Ga0068870_10090263 3300005840 Bacteria 1712
89 Ga0068870_10141881 3300005840 Bacteria 1407
90 Ga0068863_100072529 3300005841 Bacteria 3257
91 Ga0068858_100009148 3300005842 Bacteria 9473
92 Ga0068858_100030162 3300005842 Bacteria 5036
93 Ga0068860_100023675 3300005843 Bacteria 5936
94 Ga0068860_100049478 3300005843 Bacteria 4003
95 Ga0068860_100369357 3300005843 Bacteria 1414
96 Ga0068862_100002640 3300005844 Bacteria 15784
97 Ga0068862_100164362 3300005844 Bacteria 1983
98 Ga0081539_10000521 3300005985 Bacteria 80101
99 Ga0070717_10264613 3300006028 Bacteria 1522
100 Ga0075365_10099875 3300006038 Unclassified 1986
101 Ga0075368_10030183 3300006042 Bacteria 2098
102 Ga0075364_10230261 3300006051 Bacteria 1258
103 Ga0070715_10027065 3300006163 Bacteria 2287
104 Ga0070715_10072264 3300006163 Bacteria 1544
105 Ga0070716_100043648 3300006173 Bacteria 2508
106 Ga0075362_10029548 3300006177 Bacteria 2362
107 Ga0075367_10002115 3300006178 Bacteria 8924
108 Ga0075366_10001918 3300006195 Bacteria 10519
109 Ga0097621_100007905 3300006237 Bacteria 7628
110 Ga0097621_100107167 3300006237 Bacteria 2358
111 Ga0075370_10018222 3300006353 Bacteria 3807
112 Ga0075428_100038490 3300006844 Bacteria 5263
113 Ga0075428_100039971 3300006844 Bacteria 5162
114 Ga0075431_100267412 3300006847 Bacteria 1734
115 Ga0075433_10019220 3300006852 Bacteria 5687
116 Ga0075433_10156816 3300006852 Bacteria 2025
117 Ga0075434_100027688 3300006871 Bacteria 5565
118 Ga0075434_100060617 3300006871 Bacteria 3763
119 Ga0075434_100177410 3300006871 Bacteria 2150
120 Ga0075434_100441354 3300006871 Bacteria 1323
121 Ga0075429_100033906 3300006880 Bacteria 4436
122 Ga0075429_100038593 3300006880 Bacteria 4158
123 Ga0075429_100039625 3300006880 Bacteria 4099
124 Ga0068865_100000673 3300006881 Bacteria 19281
125 Ga0068865_100023055 3300006881 Bacteria 4070
126 Ga0075436_100000476 3300006914 Bacteria 26049
127 Ga0075436_100026213 3300006914 Bacteria 4012
128 Ga0075436_100064863 3300006914 Bacteria 2525
129 Ga0075436_100068710 3300006914 Bacteria 2447
130 Ga0075436_100346827 3300006914 Bacteria 1069
131 Ga0097620_100001713 3300006931 Bacteria 22369
132 Ga0097620_100080689 3300006931 Bacteria 3294
133 Ga0097620_100082729 3300006931 Bacteria 3253
134 Ga0097620_100293845 3300006931 Bacteria 1718
135 Ga0075435_100001047 3300007076 Bacteria 17522
136 Ga0075435_100009969 3300007076 Bacteria 6922
137 Ga0075435_100264191 3300007076 Bacteria 1467
138 Ga0099794_10008179 3300007265 Bacteria 4334
139 Ga0099795_10008643 3300007788 Bacteria 2914
140 Ga0111539_10004200 3300009094 Bacteria 18898
141 Ga0111539_10015906 3300009094 Bacteria 9343
142 Ga0111539_10035841 3300009094 Bacteria 6005
143 Ga0111539_10083302 3300009094 Bacteria 3761
144 Ga0111539_10232247 3300009094 Bacteria 2148
145 Ga0111539_10414838 3300009094 Bacteria 1568
146 Ga0105245_10000216 3300009098 Bacteria 55016
147 Ga0114129_10029481 3300009147 Bacteria 7773
148 Ga0114129_10084872 3300009147 Bacteria 4395
149 Ga0114129_10310916 3300009147 Bacteria 2097
150 Ga0105243_10000351 3300009148 Bacteria 49081
151 Ga0105243_10047342 3300009148 Bacteria 3384
152 Ga0105243_10613600 3300009148 Bacteria 1049
153 Ga0105241_10012938 3300009174 Bacteria 6119
154 Ga0105242_10000213 3300009176 Bacteria 45343
155 Ga0105248_10052791 3300009177 Bacteria 4562
156 Ga0105249_10000741 3300009553 Bacteria 29423
157 Ga0157378_10000354 3300013297 Bacteria 45097
158 Ga0157378_10833179 3300013297 Bacteria 950
159 Ga0163162_10166945 3300013306 Bacteria 2325
160 Ga0157375_10053730 3300013308 Bacteria 3965
161 Ga0157375_10095572 3300013308 Bacteria 3043
162 Ga0157375_10244736 3300013308 Bacteria 1953
163 Ga0157375_10800205 3300013308 Bacteria 1091
164 Ga0157380_10025130 3300014326 Bacteria 4515
165 Ga0157380_10046562 3300014326 Bacteria 3407
166 Ga0157380_10088117 3300014326 Bacteria 2553
167 Ga0157377_10178672 3300014745 Bacteria 1333
168 Ga0157379_10104290 3300014968 Bacteria 2545
169 Ga0157379_10195423 3300014968 Bacteria 1828
170 Ga0157379_10299714 3300014968 Bacteria 1465
171 Ga0157376_10012315 3300014969 Bacteria 6345
172 Ga0163161_10123955 3300017792 Bacteria 1944
173 Ga0207656_10037447 3300025321 Bacteria 2041
174 Ga0207653_10009134 3300025885 Bacteria 3092
175 Ga0207642_10001235 3300025899 Bacteria 7910
176 Ga0207642_10074946 3300025899 Bacteria 1623
177 Ga0207685_10018405 3300025905 Bacteria 2280
178 Ga0207645_10051580 3300025907 Bacteria 2628
179 Ga0207645_10082132 3300025907 Bacteria 2066
180 Ga0207643_10084226 3300025908 Bacteria 1845
181 Ga0207707_10010483 3300025912 Bacteria 8041
182 Ga0207707_10016998 3300025912 Bacteria 6337
183 Ga0207660_10000599 3300025917 Bacteria 24309
184 Ga0207662_10000021 3300025918 Bacteria 72688
185 Ga0207662_10066545 3300025918 Bacteria 2171
186 Ga0207662_10105283 3300025918 Bacteria 1753
187 Ga0207652_10007317 3300025921 Bacteria 8895
188 Ga0207652_10279032 3300025921 Bacteria 1507
189 Ga0207681_10001820 3300025923 Bacteria 13678
190 Ga0207681_10101486 3300025923 Bacteria 2076
191 Ga0207659_10036363 3300025926 Bacteria 3410
192 Ga0207659_10058652 3300025926 Bacteria 2764
193 Ga0207659_10063528 3300025926 Bacteria 2669
194 Ga0207687_10000136 3300025927 Bacteria 48993
195 Ga0207690_10149759 3300025932 Bacteria 1729
196 Ga0207706_10075159 3300025933 Bacteria 2971
197 Ga0207686_10000345 3300025934 Bacteria 33420
198 Ga0207686_10187681 3300025934 Bacteria 1471
199 Ga0207709_10000272 3300025935 Bacteria 60885
200 Ga0207670_10000515 3300025936 Bacteria 21318
201 Ga0207670_10161005 3300025936 Bacteria 1675
202 Ga0207669_10051590 3300025937 Bacteria 2465
203 Ga0207704_10000208 3300025938 Bacteria 29760
204 Ga0207704_10001065 3300025938 Bacteria 12207
205 Ga0207704_10024392 3300025938 Bacteria 3279
206 Ga0207665_10178942 3300025939 Unclassified 1535
207 Ga0207691_10010489 3300025940 Bacteria 8889
208 Ga0207691_10100562 3300025940 Bacteria 2581
209 Ga0207689_10000170 3300025942 Bacteria 57072
210 Ga0207689_10005668 3300025942 Bacteria 11111
211 Ga0207689_10024559 3300025942 Bacteria 5055
212 Ga0207689_10157827 3300025942 Bacteria 1870
213 Ga0207689_10180464 3300025942 Bacteria 1741
214 Ga0207661_10791243 3300025944 Bacteria 873
215 Ga0207667_10001513 3300025949 Bacteria 29191
216 Ga0207712_10005705 3300025961 Bacteria 7846
217 Ga0207668_10032696 3300025972 Bacteria 3441
218 Ga0207668_10130997 3300025972 Bacteria 1915
219 Ga0207640_10004757 3300025981 Bacteria 7369
220 Ga0207658_10050799 3300025986 Bacteria 3053
221 Ga0207677_10001117 3300026023 Bacteria 14634
222 Ga0207703_10022469 3300026035 Bacteria 4948
223 Ga0207703_10026523 3300026035 Bacteria 4561
224 Ga0207639_10530644 3300026041 Bacteria 1079
225 Ga0207678_10060632 3300026067 Bacteria 3254
226 Ga0207678_10284039 3300026067 Bacteria 1421
227 Ga0207708_10004610 3300026075 Bacteria 10144
228 Ga0207708_10096918 3300026075 Bacteria 2279
229 Ga0207708_10419429 3300026075 Bacteria 1110
230 Ga0207648_10000152 3300026089 Bacteria 69770
231 Ga0207648_10000930 3300026089 Bacteria 32957
232 Ga0207648_10005280 3300026089 Bacteria 13045
233 Ga0207648_10292068 3300026089 Bacteria 1460
234 Ga0207676_10033646 3300026095 Bacteria 3874
235 Ga0207676_10430415 3300026095 Bacteria 1240
236 Ga0207675_100000086 3300026118 Bacteria 72707
237 Ga0207675_100007091 3300026118 Bacteria 10591
238 Ga0207683_10133062 3300026121 Bacteria 2237
239 Ga0209996_1022504 3300027395 Bacteria 892
240 Ga0210000_1005724 3300027462 Bacteria 1806
241 Ga0209999_1013551 3300027543 Bacteria 1478
242 Ga0209588_1001440 3300027671 Bacteria 6215
243 Ga0209971_1012700 3300027682 Bacteria 1994
244 Ga0209813_10010469 3300027866 Bacteria 2399
245 Ga0207428_10001849 3300027907 Bacteria 21630
246 Ga0207428_10004629 3300027907 Bacteria 13038
247 Ga0207428_10028665 3300027907 Bacteria 4623
248 Ga0268265_10000621 3300028380 Bacteria 35352
249 Ga0268265_10711130 3300028380 Bacteria 971
250 Ga0268264_10001005 3300028381 Bacteria 28618
251 Ga0268264_10057050 3300028381 Bacteria 3265
252 Ga0268264_10385598 3300028381 Bacteria 1343
253 Ga0307508_10198664 3300031616 Bacteria 1606
254 Ga0307514_10016026 3300031649 Bacteria 6174
255 Ga0307406_10031759 3300031901 Bacteria 3218
256 Ga0307412_10048041 3300031911 Bacteria 2805
257 Ga0307409_100061485 3300031995 Bacteria 2935
258 Ga0307416_100264976 3300032002 Bacteria 1682
259 Ga0307414_10244678 3300032004 Bacteria 1487
260 Ga0307414_10384741 3300032004 Bacteria 1214
261 Ga0373926_0030687 3300035083 Bacteria 1894
262 Ga0373934_0000350 3300035086 Bacteria 16141
263 Ga0373949_0000037 3300035090 Bacteria 47703
264 Ga0373936_0036334 3300035113 Bacteria 1964
265 Ga0373936_0060577 3300035113 Bacteria 1544
266 Ga0373941_0002769 3300035115 Bacteria 3893
267 Ga0373953_0034032 3300035117 Bacteria 1996
268 Ga0373954_0000008 3300035118 Bacteria 79963
269 Ga0373956_0000078 3300035119 Bacteria 32263
270 Ga0373957_0019871 3300035120 Bacteria 2368
271 Ga0373957_0072904 3300035120 Bacteria 1345
272 Ga0373960_0046660 3300035121 Bacteria 1272
273 Ga0373943_0045096 3300035170 Bacteria 2147
274 Ga0373955_0039316 3300035172 Bacteria 2524
275 Ga0373955_0054388 3300035172 Bacteria 2189
276 Ga0373955_0135257 3300035172 Bacteria 1441
277 Ga0373942_0070106 3300035207 Bacteria 1022
278 Ga0373931_0001153 3300035691 Bacteria 11239
279 Ga0373931_0004785 3300035691 Bacteria 6212
280 Ga0373931_0025028 3300035691 Bacteria 3030
281 Ga0373931_0026390 3300035691 Bacteria 2956
282 Ga0373931_0143976 3300035691 Bacteria 1383
283 Ga0373935_0033987 3300035692 Bacteria 3176
284 Ga0373933_0000380 3300035724 Bacteria 28436
285 Ga0373933_0051199 3300035724 Bacteria 2467
286 Ga0373933_0075895 3300035724 Bacteria 2052
287 Ga0373947_0003038 3300035725 Bacteria 9981
288 Ga0373937_0000480 3300036401 Bacteria 36669
289 Ga0373937_0070207 3300036401 Bacteria 3231
290 Ga0373937_0122950 3300036401 Bacteria 2420
291 Ga0373937_0168680 3300036401 Bacteria 2053
292 Ga0373937_0294770 3300036401 Bacteria 1532
293 Ga0373937_0326304 3300036401 Bacteria 1452
294 Ga0373925_0056696 3300037068 Bacteria 2935
295 Ga0436361_0875743 3300039447 Bacteria 16933
296 Ga0451807_0190102 3300041486 Bacteria 1823
297 Ga0439451_016177 3300042009 Bacteria 1504
298 Ga0439435_0013935 3300042436 Bacteria 1978
299 Ga0439444_0003529 3300042437 Bacteria 2215
300 Ga0439460_0009939 3300042461 Bacteria 2425
301 Ga0439460_0026813 3300042461 Bacteria 1614
302 Ga0451577_0013166 3300042876 Bacteria 7751
303 Ga0466969_0034974 3300044656 Bacteria 2544
304 Ga0453684_0346168 3300044712 Bacteria 1677
305 Ga0466967_0035530 3300045976 Bacteria 4244
306 Ga0495592_0002686 3300046454 Bacteria 12579
307 Ga0495651_0052414 3300046462 Bacteria 3142
308 Ga0495651_0381748 3300046462 Bacteria 924
309 Ga0495653_0042692 3300046463 Bacteria 3529
310 Ga0495580_0088280 3300046472 Bacteria 2159
311 Ga0495580_0126261 3300046472 Bacteria 1775
312 Ga0495664_0213676 3300046477 Bacteria 1168
313 Ga0495594_0105502 3300046499 Bacteria 1587
314 Ga0495594_0119740 3300046499 Bacteria 1488
315 Ga0495596_0000264 3300046500 Bacteria 34854
316 Ga0495608_0034065 3300046511 Bacteria 3439
317 Ga0495608_0066041 3300046511 Bacteria 2369
318 Ga0495610_0002057 3300046512 Bacteria 17196
319 Ga0495618_0004445 3300046514 Bacteria 8624
320 Ga0495628_0007077 3300046516 Bacteria 9716
321 Ga0495628_0039547 3300046516 Bacteria 3772
322 Ga0495628_0142589 3300046516 Bacteria 1828
323 Ga0495630_0019473 3300046517 Bacteria 4988
324 Ga0495652_0001265 3300046529 Bacteria 28259
325 Ga0495652_0234849 3300046529 Bacteria 1369
326 Ga0495665_0067077 3300046531 Bacteria 1893
327 Ga0495640_0136952 3300046533 Bacteria 1580
328 Ga0495640_0182817 3300046533 Bacteria 1335
329 Ga0495586_0092729 3300046535 Bacteria 1669
330 Ga0495587_0064708 3300046536 Bacteria 2136
331 Ga0495645_0000794 3300046543 Bacteria 21665
332 Ga0495645_0147471 3300046543 Bacteria 1638
333 Ga0495667_0052490 3300046559 Bacteria 2685
334 Ga0495667_0237031 3300046559 Bacteria 1162
335 Ga0495634_0058666 3300046642 Bacteria 2564
336 Ga0495635_0267570 3300046663 Unclassified 1150
337 Ga0495657_0086826 3300046675 Bacteria 2014
338 Ga0495657_0119967 3300046675 Bacteria 1657
339 Ga0495599_0005019 3300046678 Bacteria 7873
340 Ga0495623_0322233 3300046679 Bacteria 848
341 Ga0495647_0007402 3300046681 Bacteria 3676
342 Ga0495658_0044560 3300046683 Bacteria 2486
343 Ga0495658_0184490 3300046683 Bacteria 1295
344 Ga0495669_0009137 3300046684 Bacteria 4177
345 Ga0495600_0013643 3300046809 Bacteria 5111
346 Ga0495604_0099913 3300047317 Bacteria 2134
347 Ga0495636_0029769 3300047318 Bacteria 2230
348 Ga0495674_0084217 3300047319 Bacteria 2725
349 Ga0495672_0005287 3300047320 Bacteria 10279
350 Ga0495680_0034493 3300047322 Bacteria 4084
351 Ga0495680_0074298 3300047322 Bacteria 2582
352 Ga0495680_0184362 3300047322 Bacteria 1504
353 Ga0495675_0031666 3300047444 Bacteria 3376
354 Ga0495684_0043762 3300047471 Bacteria 3428
355 Ga0495614_0143933 3300048089 Bacteria 1061
356 Ga0495626_0000318 3300048091 Bacteria 50627
357 Ga0501298_014324 3300049521 Bacteria 1416
358 Ga0501031_0160980 3300049568 Bacteria 1467
359 Ga0501032_0288030 3300049569 Unclassified 1063
360 Ga0501033_0274028 3300049570 Bacteria 1192
361 Ga0501036_0043050 3300049572 Bacteria 3823
362 Ga0501036_0090491 3300049572 Bacteria 2585
363 Ga0501037_0240482 3300049573 Bacteria 1269
364 Ga0501038_0004050 3300049574 Bacteria 13624
365 Ga0501038_0117029 3300049574 Bacteria 2202
366 Ga0501039_0003537 3300049575 Bacteria 11707
367 Ga0501039_0030363 3300049575 Bacteria 4168
368 Ga0501039_0035542 3300049575 Bacteria 3845
369 Ga0501039_0064348 3300049575 Bacteria 2843
370 Ga0501039_0441326 3300049575 Bacteria 1022
371 Ga0501040_0020845 3300049576 Bacteria 4370
372 Ga0501040_0042815 3300049576 Bacteria 3085
373 Ga0501040_0043451 3300049576 Bacteria 3063
374 Ga0501040_0147586 3300049576 Bacteria 1658
375 Ga0501040_0158537 3300049576 Unclassified 1599
376 Ga0501041_0016114 3300049577 Bacteria 4439
377 Ga0501042_0005155 3300049578 Bacteria 8390
378 Ga0501042_0049006 3300049578 Bacteria 3012
379 Ga0501042_0123901 3300049578 Bacteria 1861
380 Ga0501042_0291768 3300049578 Bacteria 1178
381 Ga0501042_0511496 3300049578 Bacteria 872
382 Ga0501043_0057675 3300049579 Bacteria 3049
383 Ga0501046_0003307 3300049580 Bacteria 14810
384 Ga0501046_0033079 3300049580 Bacteria 4181
385 Ga0501046_0072498 3300049580 Bacteria 2674
386 Ga0501048_0014107 3300049582 Bacteria 5921
387 Ga0501048_0175361 3300049582 Bacteria 1519
388 Ga0501068_0192991 3300049584 Unclassified 1290
389 Ga0501070_0069441 3300049586 Bacteria 2917
390 Ga0501071_0003385 3300049587 Bacteria 9958
391 Ga0501071_0119052 3300049587 Bacteria 1957
392 Ga0501071_0130561 3300049587 Bacteria 1866
393 Ga0501071_0132568 3300049587 Bacteria 1852
394 Ga0501071_0407373 3300049587 Bacteria 1038
395 Ga0501072_0026482 3300049588 Bacteria 4521
396 Ga0501072_0047737 3300049588 Bacteria 3372
397 Ga0501072_0129678 3300049588 Bacteria 2009
398 Ga0501072_0347278 3300049588 Bacteria 1178
399 Ga0501074_0026973 3300049590 Bacteria 4163
400 Ga0501075_0001333 3300049591 Bacteria 16020
401 Ga0501075_0004318 3300049591 Bacteria 9617
402 Ga0501075_0017205 3300049591 Bacteria 5219
403 Ga0501075_0090391 3300049591 Bacteria 2323
404 Ga0501075_0094584 3300049591 Bacteria 2268
405 Ga0501076_0008800 3300049592 Bacteria 7418
406 Ga0501076_0010212 3300049592 Bacteria 6959
407 Ga0501076_0013043 3300049592 Bacteria 6223
408 Ga0501076_0018912 3300049592 Bacteria 5257
409 Ga0501076_0103468 3300049592 Bacteria 2297
410 Ga0501076_0150945 3300049592 Unclassified 1890
411 Ga0501076_0313820 3300049592 Bacteria 1286
412 Ga0501077_0001012 3300049593 Bacteria 16973
413 Ga0501077_0016229 3300049593 Bacteria 4691
414 Ga0501077_0085543 3300049593 Bacteria 1999
415 Ga0501079_0013489 3300049741 Bacteria 6231
416 Ga0501079_0015069 3300049741 Bacteria 5894
417 Ga0501079_0175819 3300049741 Bacteria 1669
418 Ga0501079_0280668 3300049741 Unclassified 1302
419 Ga0501080_0016538 3300049742 Bacteria 6815
420 Ga0501080_0204030 3300049742 Bacteria 1814
421 Ga0501081_0000374 3300049743 Bacteria 24501
422 Ga0501081_0009435 3300049743 Bacteria 6359
423 Ga0501081_0012937 3300049743 Bacteria 5490
424 Ga0501081_0060894 3300049743 Bacteria 2616
425 Ga0501081_0083379 3300049743 Bacteria 2241
426 Ga0501081_0198260 3300049743 Bacteria 1455
427 Ga0501083_0119413 3300049744 Bacteria 1730
428 Ga0501083_0202396 3300049744 Bacteria 1295
429 Ga0501035_0012775 3300049822 Bacteria 7757
430 Ga0501035_0141307 3300049822 Bacteria 2093
431 Ga0501035_0411181 3300049822 Bacteria 1124
432 Ga0501045_0001738 3300049824 Bacteria 14681
433 Ga0501045_0039867 3300049824 Bacteria 3418
434 Ga0501045_0044109 3300049824 Bacteria 3248
435 Ga0501045_0046991 3300049824 Bacteria 3144
436 Ga0501045_0084338 3300049824 Bacteria 2344
437 nmdc:mga00v17_53303_c1 3300050491 Unclassified 2465
438 nmdc:mga0k408_2252_c1 3300050493 Bacteria 10295
439 nmdc:mga04h51_59366_c1 3300050495 Bacteria 1307
440 nmdc:mga07m45_28629_c1 3300050496 Bacteria 3075
441 nmdc:mga05p37_405225_c1 3300050507 Bacteria 1591
442 nmdc:mga05p37_57167_c1 3300050507 Bacteria 4804
443 nmdc:mga05p37_9320_c1 3300050507 Bacteria 11612
444 nmdc:mga09592_11033_c1 3300050508 Bacteria 7350
445 nmdc:mga09592_11415_c1 3300050508 Bacteria 7225
446 nmdc:mga09592_130303_c1 3300050508 Bacteria 2164
447 nmdc:mga09592_137667_c1 3300050508 Bacteria 2104
448 nmdc:mga09592_183405_c1 3300050508 Bacteria 1811
449 nmdc:mga0qj67_128266_c1 3300050509 Bacteria 2053
450 nmdc:mga0qj67_525747_c1 3300050509 Bacteria 950
451 nmdc:mga0qj67_947_c1 3300050509 Bacteria 19970
452 nmdc:mga06r32_133891_c1 3300050510 Bacteria 2453
453 nmdc:mga06r32_177493_c1 3300050510 Bacteria 2115
454 nmdc:mga06r32_832258_c1 3300050510 Bacteria 882
455 nmdc:mga08y16_110598_c1 3300050511 Bacteria 2861
456 nmdc:mga08y16_17353_c1 3300050511 Bacteria 7579
457 nmdc:mga08y16_19523_c1 3300050511 Bacteria 7146
458 nmdc:mga08y16_242465_c1 3300050511 Bacteria 1863
459 nmdc:mga08y16_2618_c1 3300050511 Bacteria 18485
460 nmdc:mga08y16_267869_c1 3300050511 Bacteria 1764
461 nmdc:mga08y16_46415_c1 3300050511 Bacteria 4548
462 nmdc:mga08y16_53688_c1 3300050511 Bacteria 4213
463 nmdc:mga0n895_146670_c1 3300050512 Bacteria 2390
464 nmdc:mga0n895_419450_c1 3300050512 Bacteria 1353
465 nmdc:mga0rr50_1703_c1 3300050513 Bacteria 12138
466 nmdc:mga0rr50_52229_c1 3300050513 Bacteria 3036
467 nmdc:mga08x19_130377_c1 3300050514 Bacteria 1691
468 nmdc:mga08x19_22530_c1 3300050514 Bacteria 3901
469 nmdc:mga08x19_36796_c1 3300050514 Bacteria 3101
470 nmdc:mga08x19_846_c1 3300050514 Bacteria 19420
471 nmdc:mga0a205_450804_c1 3300050515 Bacteria 1146
472 nmdc:mga0a205_53218_c1 3300050515 Bacteria 3907
473 Ga0495619_0094347 3300053085 Bacteria 2029
474 Ga0500652_111434 3300053131 Bacteria 1144
475 Ga0501084_0012919 3300054114 Bacteria 6913
476 Ga0501084_0030178 3300054114 Bacteria 4534
477 Ga0501084_0042596 3300054114 Bacteria 3797
478 Ga0501084_0097671 3300054114 Bacteria 2466
479 Ga0501084_0170255 3300054114 Bacteria 1838
480 Ga0501084_0215449 3300054114 Bacteria 1620
481 Ga0501084_0416066 3300054114 Unclassified 1136
482 Ga0501084_0656537 3300054114 Unclassified 885
483 Ga0501084_0681122 3300054114 Bacteria 867
484 Ga0501082_0016906 3300060353 Bacteria 6281
485 Ga0501082_0022625 3300060353 Bacteria 5414
486 Ga0501082_0043646 3300060353 Bacteria 3866
487 Ga0501082_0189392 3300060353 Bacteria 1790
488 Ga0501082_0189480 3300060353 Bacteria 1789
489 Ga0501082_0363153 3300060353 Unclassified 1263
490 Ga0530510_0000758 3300061734 Bacteria 20970
491 Ga0530510_0013587 3300061734 Bacteria 5727
492 Ga0530510_0079935 3300061734 Bacteria 2378
493 Ga0530510_0118173 3300061734 Bacteria 1945
494 Ga0530510_0231400 3300061734 Bacteria 1375
495 2512353001 2512047030 Bacteria 9031815
496 Ga0501034_0447528
497 Ga0065707_10119754
498 Ga0070690_100000209
499 Ga0070690_100077586
500 Ga0070690_100272785
501 Ga0068869_100003175
502 Ga0068869_100148356
503 Ga0070666_10032342
504 Ga0070680_100009242
505 Ga0070680_100236059
506 Ga0070682_100001825
507 Ga0068868_100000337
508 Ga0068868_100106470
509 Ga0070689_100003242
510 Ga0070689_100268563
511 Ga0070687_100000022
512 Ga0070687_100256815
513 Ga0070692_10001244
514 Ga0070692_10003785
515 Ga0070692_10054771
516 Ga0070692_10217417
517 Ga0070668_100029611
518 Ga0070668_100332554
519 Ga0070669_100002546
520 Ga0070669_100091916
521 Ga0070675_100035041
522 Ga0070675_100036744
523 Ga0070674_100044071
524 Ga0070674_100085673
525 Ga0070673_100098165
526 Ga0070688_100100342
527 Ga0070688_100143988
528 Ga0070659_100270827
529 Ga0070701_10000098
530 Ga0070701_10033816
531 Ga0070701_10084120
532 Ga0070701_10164763
533 Ga0070705_100000199
534 Ga0070705_100012156
535 Ga0070705_100128787
536 Ga0070705_100214805
537 Ga0070700_100000502
538 Ga0070700_100000624
539 Ga0070700_100058955
540 Ga0070694_100009600
541 Ga0070694_100280814
542 Ga0070663_100009645
543 Ga0070663_100150730
544 Ga0070678_100101737
545 Ga0070678_100528209
546 Ga0070662_100348956
547 Ga0070681_10001304
548 Ga0070681_10018326
549 Ga0068867_100000231
550 Ga0068867_100008572
551 Ga0068867_100075492
552 Ga0070679_100029290
553 Ga0070679_100062118
554 Ga0070697_100097925
555 Ga0068853_100081407
556 Ga0070672_100114912
557 Ga0070686_100000124
558 Ga0070686_100092808
559 Ga0070686_100158029
560 Ga0070686_100428135
561 Ga0070695_100000276
562 Ga0070695_100004953
563 Ga0070696_100000275
564 Ga0070696_100012541
565 Ga0070696_100029579
566 Ga0070693_100000130
567 Ga0070693_100160084
568 Ga0070704_100001666
569 Ga0070704_100117936
570 Ga0068855_100000977
571 Ga0068854_100000985
572 Ga0070702_100000042
573 Ga0070702_100049059
574 Ga0068859_100001713
575 Ga0068859_100080690
576 Ga0068859_100082734
577 Ga0068859_100293811
578 Ga0068866_10002281
579 Ga0068866_10010911
580 Ga0068866_10030132
581 Ga0068861_100001131
582 Ga0068861_100209144
583 Ga0068870_10090263
584 Ga0068870_10141881
585 Ga0068863_100072529
586 Ga0068858_100009148
587 Ga0068858_100030162
588 Ga0068860_100023675
589 Ga0068860_100049478
590 Ga0068860_100369357
591 Ga0068862_100002640
592 Ga0068862_100164362
593 Ga0081539_10000521
594 Ga0070717_10264613
595 Ga0075365_10099875
596 Ga0075368_10030183
597 Ga0075364_10230261
598 Ga0070715_10027065
599 Ga0070715_10072264
600 Ga0070716_100043648
601 Ga0075362_10029548
602 Ga0075367_10002115
603 Ga0075366_10001918
604 Ga0097621_100007905
605 Ga0097621_100107167
606 Ga0075370_10018222
607 Ga0075428_100038490
608 Ga0075428_100039971
609 Ga0075431_100267412
610 Ga0075433_10019220
611 Ga0075433_10156816
612 Ga0075434_100027688
613 Ga0075434_100060617
614 Ga0075434_100177410
615 Ga0075434_100441354
616 Ga0075429_100033906
617 Ga0075429_100038593
618 Ga0075429_100039625
619 Ga0068865_100000673
620 Ga0068865_100023055
621 Ga0075436_100000476
622 Ga0075436_100026213
623 Ga0075436_100064863
624 Ga0075436_100068710
625 Ga0075436_100346827
626 Ga0097620_100001713
627 Ga0097620_100080689
628 Ga0097620_100082729
629 Ga0097620_100293845
630 Ga0075435_100001047
631 Ga0075435_100009969
632 Ga0075435_100264191
633 Ga0099794_10008179
634 Ga0099795_10008643
635 Ga0111539_10004200
636 Ga0111539_10015906
637 Ga0111539_10035841
638 Ga0111539_10083302
639 Ga0111539_10232247
640 Ga0111539_10414838
641 Ga0105245_10000216
642 Ga0114129_10029481
643 Ga0114129_10084872
644 Ga0114129_10310916
645 Ga0105243_10000351
646 Ga0105243_10047342
647 Ga0105243_10613600
648 Ga0105241_10012938
649 Ga0105242_10000213
650 Ga0105248_10052791
651 Ga0105249_10000741
652 Ga0157378_10000354
653 Ga0157378_10833179
654 Ga0163162_10166945
655 Ga0157375_10053730
656 Ga0157375_10095572
657 Ga0157375_10244736
658 Ga0157375_10800205
659 Ga0157380_10025130
660 Ga0157380_10046562
661 Ga0157380_10088117
662 Ga0157377_10178672
663 Ga0157379_10104290
664 Ga0157379_10195423
665 Ga0157379_10299714
666 Ga0157376_10012315
667 Ga0163161_10123955
668 Ga0207656_10037447
669 Ga0207653_10009134
670 Ga0207642_10001235
671 Ga0207642_10074946
672 Ga0207685_10018405
673 Ga0207645_10051580
674 Ga0207645_10082132
675 Ga0207643_10084226
676 Ga0207707_10010483
677 Ga0207707_10016998
678 Ga0207660_10000599
679 Ga0207662_10000021
680 Ga0207662_10066545
681 Ga0207662_10105283
682 Ga0207652_10007317
683 Ga0207652_10279032
684 Ga0207681_10001820
685 Ga0207681_10101486
686 Ga0207659_10036363
687 Ga0207659_10058652
688 Ga0207659_10063528
689 Ga0207687_10000136
690 Ga0207690_10149759
691 Ga0207706_10075159
692 Ga0207686_10000345
693 Ga0207686_10187681
694 Ga0207709_10000272
695 Ga0207670_10000515
696 Ga0207670_10161005
697 Ga0207669_10051590
698 Ga0207704_10000208
699 Ga0207704_10001065
700 Ga0207704_10024392
701 Ga0207665_10178942
702 Ga0207691_10010489
703 Ga0207691_10100562
704 Ga0207689_10000170
705 Ga0207689_10005668
706 Ga0207689_10024559
707 Ga0207689_10157827
708 Ga0207689_10180464
709 Ga0207661_10791243
710 Ga0207667_10001513
711 Ga0207712_10005705
712 Ga0207668_10032696
713 Ga0207668_10130997
714 Ga0207640_10004757
715 Ga0207658_10050799
716 Ga0207677_10001117
717 Ga0207703_10022469
718 Ga0207703_10026523
719 Ga0207639_10530644
720 Ga0207678_10060632
721 Ga0207678_10284039
722 Ga0207708_10004610
723 Ga0207708_10096918
724 Ga0207708_10419429
725 Ga0207648_10000152
726 Ga0207648_10000930
727 Ga0207648_10005280
728 Ga0207648_10292068
729 Ga0207676_10033646
730 Ga0207676_10430415
731 Ga0207675_100000086
732 Ga0207675_100007091
733 Ga0207683_10133062
734 Ga0209996_1022504
735 Ga0210000_1005724
736 Ga0209999_1013551
737 Ga0209588_1001440
738 Ga0209971_1012700
739 Ga0209813_10010469
740 Ga0207428_10001849
741 Ga0207428_10004629
742 Ga0207428_10028665
743 Ga0268265_10000621
744 Ga0268265_10711130
745 Ga0268264_10001005
746 Ga0268264_10057050
747 Ga0268264_10385598
748 Ga0307508_10198664
749 Ga0307514_10016026
750 Ga0307406_10031759
751 Ga0307412_10048041
752 Ga0307409_100061485
753 Ga0307416_100264976
754 Ga0307414_10244678
755 Ga0307414_10384741
756 Ga0373926_0030687
757 Ga0373934_0000350
758 Ga0373949_0000037
759 Ga0373936_0036334
760 Ga0373936_0060577
761 Ga0373941_0002769
762 Ga0373953_0034032
763 Ga0373954_0000008
764 Ga0373956_0000078
765 Ga0373957_0019871
766 Ga0373957_0072904
767 Ga0373960_0046660
768 Ga0373943_0045096
769 Ga0373955_0039316
770 Ga0373955_0054388
771 Ga0373955_0135257
772 Ga0373942_0070106
773 Ga0373931_0001153
774 Ga0373931_0004785
775 Ga0373931_0025028
776 Ga0373931_0026390
777 Ga0373931_0143976
778 Ga0373935_0033987
779 Ga0373933_0000380
780 Ga0373933_0051199
781 Ga0373933_0075895
782 Ga0373947_0003038
783 Ga0373937_0000480
784 Ga0373937_0070207
785 Ga0373937_0122950
786 Ga0373937_0168680
787 Ga0373937_0294770
788 Ga0373937_0326304
789 Ga0373925_0056696
790 Ga0436361_0875743
791 Ga0451807_0190102
792 Ga0439451_016177
793 Ga0439435_0013935
794 Ga0439444_0003529
795 Ga0439460_0009939
796 Ga0439460_0026813
797 Ga0451577_0013166
798 Ga0466969_0034974
799 Ga0453684_0346168
800 Ga0466967_0035530
801 Ga0495592_0002686
802 Ga0495651_0052414
803 Ga0495651_0381748
804 Ga0495653_0042692
805 Ga0495580_0088280
806 Ga0495580_0126261
807 Ga0495664_0213676
808 Ga0495594_0105502
809 Ga0495594_0119740
810 Ga0495596_0000264
811 Ga0495608_0034065
812 Ga0495608_0066041
813 Ga0495610_0002057
814 Ga0495618_0004445
815 Ga0495628_0007077
816 Ga0495628_0039547
817 Ga0495628_0142589
818 Ga0495630_0019473
819 Ga0495652_0001265
820 Ga0495652_0234849
821 Ga0495665_0067077
822 Ga0495640_0136952
823 Ga0495640_0182817
824 Ga0495586_0092729
825 Ga0495587_0064708
826 Ga0495645_0000794
827 Ga0495645_0147471
828 Ga0495667_0052490
829 Ga0495667_0237031
830 Ga0495634_0058666
831 Ga0495635_0267570
832 Ga0495657_0086826
833 Ga0495657_0119967
834 Ga0495599_0005019
835 Ga0495623_0322233
836 Ga0495647_0007402
837 Ga0495658_0044560
838 Ga0495658_0184490
839 Ga0495669_0009137
840 Ga0495600_0013643
841 Ga0495604_0099913
842 Ga0495636_0029769
843 Ga0495674_0084217
844 Ga0495672_0005287
845 Ga0495680_0034493
846 Ga0495680_0074298
847 Ga0495680_0184362
848 Ga0495675_0031666
849 Ga0495684_0043762
850 Ga0495614_0143933
851 Ga0495626_0000318
852 Ga0501298_014324
853 Ga0501031_0160980
854 Ga0501032_0288030
855 Ga0501033_0274028
856 Ga0501036_0043050
857 Ga0501036_0090491
858 Ga0501037_0240482
859 Ga0501038_0004050
860 Ga0501038_0117029
861 Ga0501039_0003537
862 Ga0501039_0030363
863 Ga0501039_0035542
864 Ga0501039_0064348
865 Ga0501039_0441326
866 Ga0501040_0020845
867 Ga0501040_0042815
868 Ga0501040_0043451
869 Ga0501040_0147586
870 Ga0501040_0158537
871 Ga0501041_0016114
872 Ga0501042_0005155
873 Ga0501042_0049006
874 Ga0501042_0123901
875 Ga0501042_0291768
876 Ga0501042_0511496
877 Ga0501043_0057675
878 Ga0501046_0003307
879 Ga0501046_0033079
880 Ga0501046_0072498
881 Ga0501048_0014107
882 Ga0501048_0175361
883 Ga0501068_0192991
884 Ga0501070_0069441
885 Ga0501071_0003385
886 Ga0501071_0119052
887 Ga0501071_0130561
888 Ga0501071_0132568
889 Ga0501071_0407373
890 Ga0501072_0026482
891 Ga0501072_0047737
892 Ga0501072_0129678
893 Ga0501072_0347278
894 Ga0501074_0026973
895 Ga0501075_0001333
896 Ga0501075_0004318
897 Ga0501075_0017205
898 Ga0501075_0090391
899 Ga0501075_0094584
900 Ga0501076_0008800
901 Ga0501076_0010212
902 Ga0501076_0013043
903 Ga0501076_0018912
904 Ga0501076_0103468
905 Ga0501076_0150945
906 Ga0501076_0313820
907 Ga0501077_0001012
908 Ga0501077_0016229
909 Ga0501077_0085543
910 Ga0501079_0013489
911 Ga0501079_0015069
912 Ga0501079_0175819
913 Ga0501079_0280668
914 Ga0501080_0016538
915 Ga0501080_0204030
916 Ga0501081_0000374
917 Ga0501081_0009435
918 Ga0501081_0012937
919 Ga0501081_0060894
920 Ga0501081_0083379
921 Ga0501081_0198260
922 Ga0501083_0119413
923 Ga0501083_0202396
924 Ga0501035_0012775
925 Ga0501035_0141307
926 Ga0501035_0411181
927 Ga0501045_0001738
928 Ga0501045_0039867
929 Ga0501045_0044109
930 Ga0501045_0046991
931 Ga0501045_0084338
932 nmdc:mga00v17_53303_c1
933 nmdc:mga0k408_2252_c1
934 nmdc:mga04h51_59366_c1
935 nmdc:mga07m45_28629_c1
936 nmdc:mga05p37_405225_c1
937 nmdc:mga05p37_57167_c1
938 nmdc:mga05p37_9320_c1
939 nmdc:mga09592_11033_c1
940 nmdc:mga09592_11415_c1
941 nmdc:mga09592_130303_c1
942 nmdc:mga09592_137667_c1
943 nmdc:mga09592_183405_c1
944 nmdc:mga0qj67_128266_c1
945 nmdc:mga0qj67_525747_c1
946 nmdc:mga0qj67_947_c1
947 nmdc:mga06r32_133891_c1
948 nmdc:mga06r32_177493_c1
949 nmdc:mga06r32_832258_c1
950 nmdc:mga08y16_110598_c1
951 nmdc:mga08y16_17353_c1
952 nmdc:mga08y16_19523_c1
953 nmdc:mga08y16_242465_c1
954 nmdc:mga08y16_2618_c1
955 nmdc:mga08y16_267869_c1
956 nmdc:mga08y16_46415_c1
957 nmdc:mga08y16_53688_c1
958 nmdc:mga0n895_146670_c1
959 nmdc:mga0n895_419450_c1
960 nmdc:mga0rr50_1703_c1
961 nmdc:mga0rr50_52229_c1
962 nmdc:mga08x19_130377_c1
963 nmdc:mga08x19_22530_c1
964 nmdc:mga08x19_36796_c1
965 nmdc:mga08x19_846_c1
966 nmdc:mga0a205_450804_c1
967 nmdc:mga0a205_53218_c1
968 Ga0495619_0094347
969 Ga0500652_111434
970 Ga0501084_0012919
971 Ga0501084_0030178
972 Ga0501084_0042596
973 Ga0501084_0097671
974 Ga0501084_0170255
975 Ga0501084_0215449
976 Ga0501084_0416066
977 Ga0501084_0656537
978 Ga0501084_0681122
979 Ga0501082_0016906
980 Ga0501082_0022625
981 Ga0501082_0043646
982 Ga0501082_0189392
983 Ga0501082_0189480
984 Ga0501082_0363153
985 Ga0530510_0000758
986 Ga0530510_0013587
987 Ga0530510_0079935
988 Ga0530510_0118173
989 Ga0530510_0231400
990 2512353001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

6

277

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.9788 3 276
3wku-assembly1.cif.gz_B crystal structure of the anaerobic desb-gallate complex 0.9767 3 276
3wpm-assembly1.cif.gz_A crystal structure of the anaerobic desb-gallate complex by co-crystallization 0.9757 3 276
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.9714 3 276
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.9714 3 276
ID Description Score Start End Superfamily
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9714 3 276 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9712 3 276 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9609 3 276 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9231 3 276 3.40.830.10
af_P0ABR9_4_309_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.7971 7 273 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A2V3RAS0-F1-model_v4 deleted 0.9846 1 276
AF-D8MMI7-F1-model_v4 Protocatechuate 4,5-dioxygenase (EC 1.13.11.8) 0.9835 1 276 GO:0008198
GO:0018579
AF-A0A2I5TBJ8-F1-model_v4 Protocatechuate 3,4-dioxygenase (EC 1.13.11.8) 0.983 1 276 GO:0008198
GO:0018579
AF-A0A7C2JVF1-F1-model_v4 Gallate dioxygenase (EC 1.13.11.57) 0.983 1 251 GO:0008198
GO:0036238
AF-N2J7J0-F1-model_v4 Protocatechuate 4,5-dioxygenase, alpha subunit 0.9826 1 276 GO:0008198
GO:0051213

Map