F454860

General Info

Members Datasets Scaffolds Average Seq Length
496 359 389 155

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10075074|Ga0081455_100750741
Length 176
Sequence MNSSSIRQMLDGLCRAAEQRDGKTFASHFAEDGVYHDDFYGAFVGRERVAELINDWFHKDARALRWDMIEPAYDGGRLYVRYVFSYNSTLPEARDARAMFEGVAIMSLRDGKITEYREIISCGTAFVDMNFHPERIFKIFARKAAAMKMKPEVQRHLPTVEKTSREPRAGHRPEAP

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
7 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
8 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
12 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
13 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
14 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
15 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
16 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
17 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
18 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
19 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
20 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
21 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
22 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
23 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
24 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
25 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
26 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
27 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
28 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
29 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
30 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
31 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
32 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
33 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
34 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
35 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
36 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
37 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
38 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
39 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
40 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
41 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
42 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
43 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
44 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
45 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
46 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
47 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
48 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
49 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
50 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
51 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
52 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
53 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
54 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
55 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
56 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
57 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
58 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
59 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
60 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
61 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
62 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
63 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
64 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
65 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
66 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
67 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
68 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
69 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
70 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
71 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
72 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
73 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
74 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
75 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
76 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
77 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
78 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
79 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
80 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
81 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
82 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
83 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
84 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
85 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
86 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
87 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
88 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
89 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
90 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
91 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
92 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
93 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
104 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
105 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
106 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
107 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
108 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
109 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
112 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
113 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
114 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
119 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
120 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
121 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
127 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
128 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
131 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
132 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
157 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
220 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
224 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
322 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
323 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
324 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
327 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
328 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
331 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
332 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
333 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
334 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
337 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
338 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
339 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
340 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
341 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
342 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
343 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
344 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
345 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
346 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
347 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
348 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
349 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
350 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
351 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
352 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
353 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
354 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
355 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
356 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
357 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
358 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
359 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.38
Metatranscriptomes 0.2
Isolates 21.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 18.55
Rhizoplane 4.84
Rhizosphere 57.66
Stem 0
Stem Tuber 0
Unclassified 7.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10009574 3300003215 Bacteria 4479
2 JGI25160J50197_1016063 3300003354 Bacteria 2427
3 Ga0065165_1044635 3300005262 Bacteria 1295
4 Ga0070658_10644524 3300005327 Bacteria 919
5 Ga0070676_11068179 3300005328 Bacteria 609
6 Ga0070683_100004460 3300005329 Bacteria 11548
7 Ga0070683_100015277 3300005329 Bacteria 6741
8 Ga0070670_102029085 3300005331 Bacteria 530
9 Ga0068869_100786664 3300005334 Bacteria 817
10 Ga0070680_100093595 3300005336 Bacteria 2490
11 Ga0070680_100922329 3300005336 Bacteria 754
12 Ga0070680_101109936 3300005336 Bacteria 684
13 Ga0070682_100026381 3300005337 Bacteria 3476
14 Ga0070682_100113038 3300005337 Bacteria 1813
15 Ga0068868_101064024 3300005338 Bacteria 743
16 Ga0068868_101185142 3300005338 Bacteria 706
17 Ga0070687_100695425 3300005343 Bacteria 710
18 Ga0070661_100165801 3300005344 Bacteria 1675
19 Ga0070675_101183243 3300005354 Bacteria 704
20 Ga0070671_100721331 3300005355 Bacteria 865
21 Ga0070673_100694647 3300005364 Bacteria 934
22 Ga0070713_100756320 3300005436 Bacteria 930
23 Ga0070708_100102378 3300005445 Bacteria 2624
24 Ga0070678_100016811 3300005456 Bacteria 4690
25 Ga0070678_101875862 3300005456 Bacteria 566
26 Ga0070681_10012145 3300005458 Bacteria 8543
27 Ga0070681_10015192 3300005458 Bacteria 7658
28 Ga0070681_10258669 3300005458 Bacteria 1653
29 Ga0070681_10322347 3300005458 Bacteria 1455
30 Ga0070706_100112399 3300005467 Bacteria 2535
31 Ga0070706_100310566 3300005467 Bacteria 1471
32 Ga0070698_100003587 3300005471 Bacteria 17059
33 Ga0070698_100830042 3300005471 Bacteria 869
34 Ga0070699_100409643 3300005518 Bacteria 1226
35 Ga0070679_100007272 3300005530 Bacteria 10338
36 Ga0070679_100030356 3300005530 Bacteria 5337
37 Ga0070684_100010952 3300005535 Bacteria 7209
38 Ga0070684_100072138 3300005535 Bacteria 3039
39 Ga0070697_100060057 3300005536 Bacteria 3098
40 Ga0070697_100294277 3300005536 Bacteria 1395
41 Ga0068853_100068121 3300005539 Bacteria 3093
42 Ga0068853_100094100 3300005539 Bacteria 2639
43 Ga0070672_101195000 3300005543 Unclassified 677
44 Ga0070693_100268717 3300005547 Unclassified 1137
45 Ga0070693_101009681 3300005547 Bacteria 630
46 Ga0070665_100033886 3300005548 Bacteria 5137
47 Ga0070665_100050153 3300005548 Bacteria 4188
48 Ga0070704_100599894 3300005549 Bacteria 968
49 Ga0068855_100088206 3300005563 Bacteria 3583
50 Ga0068855_101189030 3300005563 Unclassified 793
51 Ga0068855_101191090 3300005563 Bacteria 793
52 Ga0070664_100021866 3300005564 Bacteria 5273
53 Ga0068856_100140571 3300005614 Bacteria 2421
54 Ga0068856_100507118 3300005614 Bacteria 1227
55 Ga0068856_101023416 3300005614 Unclassified 844
56 Ga0068856_101203907 3300005614 Bacteria 774
57 Ga0068852_100024177 3300005616 Bacteria 4906
58 Ga0068852_100516385 3300005616 Bacteria 1191
59 Ga0068859_100149351 3300005617 Bacteria 2413
60 Ga0068859_100362051 3300005617 Bacteria 1545
61 Ga0068864_100960957 3300005618 Bacteria 846
62 Ga0068858_101573254 3300005842 Bacteria 649
63 Ga0068860_100224889 3300005843 Bacteria 1823
64 Ga0068862_101347585 3300005844 Bacteria 716
65 Ga0068862_101666537 3300005844 Bacteria 645
66 Ga0081455_10000165 3300005937 Bacteria 81987
67 Ga0081455_10033257 3300005937 Bacteria 4636
68 Ga0081455_10058499 3300005937 Bacteria 3261
69 Ga0081455_10075074 3300005937 Unclassified 2790
70 Ga0081540_1246509 3300005983 Bacteria 625
71 Ga0081539_10084052 3300005985 Bacteria 1665
72 Ga0070717_10893199 3300006028 Bacteria 809
73 Ga0075365_10020137 3300006038 Bacteria 4131
74 Ga0075365_10431562 3300006038 Bacteria 930
75 Ga0075365_10848082 3300006038 Bacteria 644
76 Ga0070712_101300145 3300006175 Bacteria 634
77 Ga0075367_10250652 3300006178 Bacteria 1110
78 Ga0075366_10535482 3300006195 Bacteria 725
79 Ga0097621_100294441 3300006237 Bacteria 1432
80 Ga0075370_10186488 3300006353 Bacteria 1221
81 Ga0075370_10435065 3300006353 Bacteria 789
82 Ga0097620_100149350 3300006931 Bacteria 2413
83 Ga0097620_100362044 3300006931 Bacteria 1545
84 Ga0099794_10020634 3300007265 Bacteria 2984
85 Ga0105240_10244910 3300009093 Bacteria 2076
86 Ga0105240_11099761 3300009093 Bacteria 846
87 Ga0111539_10739439 3300009094 Bacteria 1145
88 Ga0111539_12118668 3300009094 Bacteria 652
89 Ga0105247_10243317 3300009101 Bacteria 1227
90 Ga0105241_10109113 3300009174 Bacteria 2213
91 Ga0105248_10208966 3300009177 Bacteria 2199
92 Ga0105248_10831268 3300009177 Bacteria 1042
93 Ga0105248_10959623 3300009177 Bacteria 966
94 Ga0105237_10540997 3300009545 Bacteria 1171
95 Ga0105238_10102507 3300009551 Bacteria 2843
96 Ga0105238_10441049 3300009551 Bacteria 1298
97 Ga0105249_10061794 3300009553 Bacteria 3438
98 Ga0105249_11081298 3300009553 Bacteria 872
99 Ga0105239_11015610 3300010375 Bacteria 954
100 Ga0157370_10010808 3300013104 Bacteria 9594
101 Ga0157370_10614622 3300013104 Bacteria 994
102 Ga0157369_10055172 3300013105 Bacteria 4289
103 Ga0157369_11104129 3300013105 Unclassified 811
104 Ga0157369_11718432 3300013105 Bacteria 638
105 Ga0157374_10212779 3300013296 Bacteria 1896
106 Ga0157374_10859675 3300013296 Bacteria 924
107 Ga0163162_10605122 3300013306 Bacteria 1222
108 Ga0163162_10773392 3300013306 Bacteria 1078
109 Ga0163162_11432791 3300013306 Bacteria 786
110 Ga0157372_11332824 3300013307 Bacteria 828
111 Ga0157375_10705812 3300013308 Bacteria 1162
112 Ga0157375_12303677 3300013308 Bacteria 642
113 Ga0163163_12198306 3300014325 Bacteria 611
114 Ga0182008_10565434 3300014497 Bacteria 634
115 Ga0157379_10172963 3300014968 Bacteria 1950
116 Ga0157379_10756295 3300014968 Bacteria 915
117 Ga0182007_10236819 3300015262 Bacteria 650
118 Ga0206353_10077123 3300020082 Bacteria 682
119 Ga0213871_10005818 3300021441 Bacteria 2575
120 Ga0209677_101289 3300025253 Bacteria 11184
121 Ga0209758_1001177 3300025297 Bacteria 33138
122 Ga0209758_1006424 3300025297 Bacteria 8456
123 Ga0209758_1019339 3300025297 Bacteria 3288
124 Ga0207426_1002219 3300025302 Bacteria 13027
125 Ga0207426_1005323 3300025302 Bacteria 5915
126 Ga0207426_1011734 3300025302 Bacteria 3320
127 Ga0207426_1021850 3300025302 Bacteria 2205
128 Ga0207426_1055766 3300025302 Bacteria 1156
129 Ga0209257_1040726 3300025304 Bacteria 1383
130 Ga0207710_10197174 3300025900 Bacteria 993
131 Ga0207647_10124872 3300025904 Bacteria 1515
132 Ga0207647_10398942 3300025904 Bacteria 775
133 Ga0207645_10419753 3300025907 Bacteria 901
134 Ga0207705_10795101 3300025909 Bacteria 734
135 Ga0207684_10068738 3300025910 Bacteria 3010
136 Ga0207684_10494629 3300025910 Bacteria 1048
137 Ga0207654_10068048 3300025911 Bacteria 2106
138 Ga0207654_10479673 3300025911 Bacteria 876
139 Ga0207707_10000100 3300025912 Bacteria 85682
140 Ga0207707_10013022 3300025912 Bacteria 7241
141 Ga0207707_10653026 3300025912 Bacteria 886
142 Ga0207695_10046470 3300025913 Bacteria 4602
143 Ga0207660_10168390 3300025917 Bacteria 1695
144 Ga0207662_10557783 3300025918 Bacteria 794
145 Ga0207657_10404959 3300025919 Bacteria 1073
146 Ga0207649_10089196 3300025920 Bacteria 2015
147 Ga0207649_10395392 3300025920 Bacteria 1033
148 Ga0207652_10093647 3300025921 Bacteria 2644
149 Ga0207652_11650171 3300025921 Bacteria 545
150 Ga0207681_10166024 3300025923 Bacteria 1669
151 Ga0207694_10205995 3300025924 Bacteria 1601
152 Ga0207694_10574515 3300025924 Bacteria 947
153 Ga0207659_10576244 3300025926 Bacteria 958
154 Ga0207700_10029810 3300025928 Bacteria 3854
155 Ga0207644_10436196 3300025931 Bacteria 1075
156 Ga0207661_10006741 3300025944 Bacteria 8129
157 Ga0207661_10254048 3300025944 Bacteria 1563
158 Ga0207679_10040119 3300025945 Bacteria 3349
159 Ga0207667_10204442 3300025949 Bacteria 2025
160 Ga0207667_10981575 3300025949 Bacteria 833
161 Ga0207668_10970704 3300025972 Bacteria 758
162 Ga0207640_10905192 3300025981 Bacteria 771
163 Ga0207703_11049553 3300026035 Bacteria 782
164 Ga0207639_10075381 3300026041 Bacteria 2652
165 Ga0207678_10201664 3300026067 Bacteria 1701
166 Ga0207702_10325683 3300026078 Bacteria 1464
167 Ga0207702_10962770 3300026078 Unclassified 846
168 Ga0207702_11238975 3300026078 Bacteria 740
169 Ga0207641_12118935 3300026088 Bacteria 563
170 Ga0207648_10266981 3300026089 Bacteria 1528
171 Ga0207674_10073705 3300026116 Bacteria 3427
172 Ga0207675_100872184 3300026118 Bacteria 915
173 Ga0207683_10013541 3300026121 Bacteria 6959
174 Ga0207428_10597044 3300027907 Bacteria 796
175 Ga0268266_10035191 3300028379 Bacteria 4260
176 Ga0268266_10214817 3300028379 Bacteria 1765
177 Ga0268266_10318435 3300028379 Bacteria 1455
178 Ga0268265_10285532 3300028380 Bacteria 1479
179 Ga0268264_10772897 3300028381 Bacteria 958
180 Ga0268264_11350849 3300028381 Bacteria 723
181 Ga0265334_10003250 3300028573 Bacteria 7418
182 Ga0265340_10012237 3300031247 Bacteria 4534
183 Ga0307513_10037882 3300031456 Bacteria 5361
184 Ga0373936_0015383 3300035113 Bacteria 2933
185 Ga0373939_0018613 3300035114 Bacteria 1864
186 Ga0373960_0111342 3300035121 Bacteria 899
187 Ga0373943_0323985 3300035170 Bacteria 879
188 Ga0373942_0112015 3300035207 Bacteria 845
189 Ga0373931_0114934 3300035691 Bacteria 1531
190 Ga0373931_0241506 3300035691 Bacteria 1095
191 Ga0373931_0267543 3300035691 Bacteria 1045
192 Ga0373935_0950156 3300035692 Bacteria 638
193 Ga0373927_0432914 3300035695 Bacteria 868
194 Ga0373937_0685154 3300036401 Bacteria 971
195 Ga0373925_1269582 3300037068 Bacteria 604
196 Ga0395899_0009033 3300037312 Bacteria 7660
197 Ga0395899_0121221 3300037312 Bacteria 1873
198 Ga0395900_0001350 3300037418 Bacteria 29640
199 Ga0395900_0045645 3300037418 Bacteria 4513
200 Ga0395900_0405001 3300037418 Bacteria 1327
201 Ga0395898_0029321 3300037466 Bacteria 5514
202 Ga0395898_0265353 3300037466 Bacteria 1637
203 Ga0395905_0003532 3300037471 Bacteria 16666
204 Ga0395905_0161919 3300037471 Bacteria 2103
205 Ga0395905_0351338 3300037471 Bacteria 1366
206 Ga0395905_0367892 3300037471 Bacteria 1331
207 Ga0395905_0998986 3300037471 Bacteria 740
208 Ga0395901_0006638 3300038443 Bacteria 11691
209 Ga0395901_0008112 3300038443 Bacteria 10605
210 Ga0395901_0014435 3300038443 Bacteria 8038
211 Ga0395901_0150459 3300038443 Bacteria 2446
212 Ga0395901_0572247 3300038443 Bacteria 1142
213 Ga0436365_0296096 3300039437 Bacteria 2876
214 Ga0436360_0556698 3300039438 Bacteria 5831
215 Ga0436361_0603476 3300039447 Bacteria 7241
216 Ga0436363_0759156 3300039450 Bacteria 3134
217 Ga0436363_1716462 3300039450 Bacteria 599
218 Ga0439447_064844 3300041407 Bacteria 855
219 Ga0451787_242462 3300041441 Bacteria 613
220 Ga0451789_0651673 3300041443 Bacteria 1217
221 Ga0451793_0051564 3300041452 Bacteria 1653
222 Ga0451839_0317516 3300041496 Bacteria 705
223 Ga0451855_1417582 3300041511 Bacteria 799
224 Ga0451853_1625668 3300041512 Bacteria 1200
225 Ga0466967_0020928 3300045976 Bacteria 5299
226 Ga0495592_0195716 3300046454 Bacteria 1367
227 Ga0495629_0230874 3300046459 Bacteria 1275
228 Ga0495651_0008047 3300046462 Bacteria 8083
229 Ga0495651_0233100 3300046462 Bacteria 1267
230 Ga0495653_0638479 3300046463 Bacteria 651
231 Ga0495605_0163305 3300046474 Bacteria 988
232 Ga0495605_0183817 3300046474 Bacteria 918
233 Ga0495664_0015315 3300046477 Bacteria 4357
234 Ga0495664_0086875 3300046477 Bacteria 1879
235 Ga0495664_0573337 3300046477 Bacteria 672
236 Ga0495584_0193670 3300046491 Bacteria 1033
237 Ga0495584_0648246 3300046491 Bacteria 538
238 Ga0495607_0222291 3300046501 Bacteria 923
239 Ga0495583_0069993 3300046506 Bacteria 1544
240 Ga0495606_0067588 3300046507 Bacteria 2262
241 Ga0495606_0087674 3300046507 Bacteria 1920
242 Ga0495608_0536702 3300046511 Bacteria 706
243 Ga0495616_0053540 3300046513 Bacteria 2005
244 Ga0495618_0624477 3300046514 Bacteria 639
245 Ga0495628_0046301 3300046516 Bacteria 3455
246 Ga0495648_0007591 3300046524 Bacteria 8661
247 Ga0495648_0129425 3300046524 Bacteria 1344
248 Ga0495652_0026606 3300046529 Bacteria 5107
249 Ga0495652_0079832 3300046529 Bacteria 2704
250 Ga0495652_0572179 3300046529 Bacteria 774
251 Ga0495665_0150749 3300046531 Bacteria 1214
252 Ga0495640_0053549 3300046533 Bacteria 2766
253 Ga0495640_0384373 3300046533 Bacteria 863
254 Ga0495587_0020838 3300046536 Bacteria 4044
255 Ga0495622_0007520 3300046557 Bacteria 5054
256 Ga0495622_0030278 3300046557 Bacteria 2529
257 Ga0495667_0027440 3300046559 Bacteria 3837
258 Ga0495656_0160783 3300046615 Bacteria 1091
259 Ga0495668_0064460 3300046616 Bacteria 2017
260 Ga0495668_0387120 3300046616 Bacteria 768
261 Ga0495668_0599198 3300046616 Bacteria 609
262 Ga0495634_0022629 3300046642 Bacteria 4427
263 Ga0495625_0333583 3300046660 Bacteria 963
264 Ga0495635_0008534 3300046663 Bacteria 7156
265 Ga0495635_0110288 3300046663 Bacteria 1879
266 Ga0495659_0313178 3300046664 Bacteria 665
267 Ga0495661_0216643 3300046665 Bacteria 994
268 Ga0495588_0079618 3300046674 Bacteria 1710
269 Ga0495599_0292091 3300046678 Bacteria 985
270 Ga0495599_0722658 3300046678 Bacteria 573
271 Ga0495623_0003900 3300046679 Bacteria 9836
272 Ga0495646_0050416 3300046680 Bacteria 2523
273 Ga0495646_0243834 3300046680 Bacteria 965
274 Ga0495647_0130167 3300046681 Bacteria 1066
275 Ga0495613_0066962 3300046689 Bacteria 2621
276 Ga0495624_0067530 3300046690 Bacteria 2230
277 Ga0495671_0015307 3300046692 Bacteria 4113
278 Ga0495649_0109077 3300046694 Bacteria 1468
279 Ga0495649_0654016 3300046694 Bacteria 517
280 Ga0495589_0124536 3300046794 Bacteria 1240
281 Ga0495600_0038537 3300046809 Bacteria 3110
282 Ga0495660_0208416 3300046810 Bacteria 929
283 Ga0495581_0077806 3300047315 Bacteria 1920
284 Ga0495604_0016427 3300047317 Bacteria 5916
285 Ga0495604_0021055 3300047317 Bacteria 5203
286 Ga0495604_0240720 3300047317 Bacteria 1237
287 Ga0495636_0187048 3300047318 Bacteria 942
288 Ga0495674_0166415 3300047319 Bacteria 1842
289 Ga0495674_0185262 3300047319 Bacteria 1732
290 Ga0495674_1448394 3300047319 Bacteria 510
291 Ga0495676_0047026 3300047321 Bacteria 3494
292 Ga0495676_1056225 3300047321 Bacteria 517
293 Ga0495675_0002868 3300047444 Bacteria 10339
294 Ga0495677_0201950 3300047445 Bacteria 773
295 Ga0495685_072604 3300047447 Bacteria 1151
296 Ga0495684_0406505 3300047471 Bacteria 954
297 Ga0495684_0474483 3300047471 Bacteria 865
298 Ga0495686_0207557 3300047472 Bacteria 1121
299 Ga0495593_0077057 3300047673 Bacteria 1727
300 Ga0495593_0269918 3300047673 Bacteria 851
301 Ga0495602_0006250 3300048088 Bacteria 12494
302 Ga0495602_0065373 3300048088 Bacteria 3139
303 Ga0496101_0533869 3300048904 Bacteria 927
304 Ga0496102_0163600 3300048905 Bacteria 2093
305 Ga0496104_0005317 3300048907 Bacteria 11262
306 Ga0496104_0264481 3300048907 Bacteria 1632
307 Ga0496104_0718501 3300048907 Bacteria 907
308 Ga0496105_0008712 3300048908 Bacteria 7893
309 Ga0496105_0357564 3300048908 Bacteria 1165
310 Ga0496105_0567770 3300048908 Bacteria 884
311 Ga0496106_0122703 3300048909 Bacteria 2032
312 Ga0496108_0924164 3300048911 Bacteria 748
313 Ga0496109_0280152 3300048912 Bacteria 1571
314 Ga0496110_1352616 3300048913 Bacteria 621
315 Ga0496111_0081497 3300048914 Bacteria 2362
316 Ga0496112_0075249 3300048915 Bacteria 3339
317 Ga0496112_0307551 3300048915 Bacteria 1530
318 Ga0496113_0022521 3300048916 Bacteria 4458
319 Ga0496113_0058728 3300048916 Bacteria 2895
320 Ga0496114_0070345 3300048917 Bacteria 2939
321 Ga0496114_0296409 3300048917 Bacteria 1427
322 Ga0496115_0219527 3300048918 Bacteria 1569
323 Ga0496115_0451303 3300048918 Bacteria 1038
324 Ga0496116_0115080 3300048919 Bacteria 1570
325 Ga0496117_0260714 3300048920 Bacteria 940
326 Ga0496118_0136851 3300048921 Bacteria 1561
327 Ga0496118_0312475 3300048921 Bacteria 857
328 Ga0496119_0014481 3300048922 Bacteria 6168
329 Ga0496120_0008272 3300048923 Bacteria 7592
330 Ga0496121_0360062 3300048924 Bacteria 966
331 Ga0496121_0396984 3300048924 Bacteria 904
332 Ga0496126_0059143 3300048929 Bacteria 3452
333 Ga0496126_0085867 3300048929 Bacteria 2774
334 Ga0496126_0112120 3300048929 Bacteria 2375
335 Ga0496126_0297636 3300048929 Bacteria 1332
336 Ga0496126_0516056 3300048929 Bacteria 953
337 Ga0496126_0618248 3300048929 Bacteria 851
338 Ga0495682_0017444 3300049460 Bacteria 2709
339 Ga0501034_0000663 3300049571 Bacteria 52410
340 Ga0501034_0002763 3300049571 Bacteria 20594
341 Ga0501043_0905724 3300049579 Unclassified 632
342 Ga0501047_0217546 3300049581 Bacteria 1767
343 Ga0501068_0402493 3300049584 Bacteria 883
344 Ga0501072_0148521 3300049588 Bacteria 1869
345 Ga0501072_1249641 3300049588 Bacteria 576
346 Ga0501074_0338734 3300049590 Bacteria 1068
347 nmdc:mga03683_426860_c1 3300050489 Bacteria 635
348 nmdc:mga03683_566761_c1 3300050489 Bacteria 554
349 nmdc:mga00v17_560377_c1 3300050491 Bacteria 738
350 nmdc:mga0yw44_1147092_c1 3300050492 Bacteria 525
351 nmdc:mga0yw44_36677_c1 3300050492 Bacteria 2890
352 nmdc:mga0k408_182657_c1 3300050493 Bacteria 1251
353 nmdc:mga06z11_124099_c1 3300050494 Bacteria 1443
354 nmdc:mga06z11_433666_c1 3300050494 Bacteria 793
355 nmdc:mga07m45_360689_c1 3300050496 Bacteria 844
356 nmdc:mga07m45_375105_c1 3300050496 Bacteria 826
357 nmdc:mga0qj67_1272946_c1 3300050509 Bacteria 570
358 nmdc:mga08x19_1323_c1 3300050514 Bacteria 15368
359 nmdc:mga0sz30_30277_c1 3300050516 Bacteria 2236
360 Ga0500635_0189461 3300053080 Bacteria 797
361 Ga0495619_0053857 3300053085 Bacteria 2662
362 Ga0495619_0489933 3300053085 Bacteria 846
363 Ga0500578_0038187 3300053086 Bacteria 3085
364 Ga0500578_0060200 3300053086 Bacteria 2426
365 Ga0500644_0099855 3300053088 Bacteria 1101
366 Ga0500647_0031022 3300053091 Bacteria 2541
367 Ga0500566_0001036 3300053094 Bacteria 16076
368 Ga0500566_0058910 3300053094 Bacteria 2179
369 Ga0500566_0266563 3300053094 Bacteria 824
370 Ga0500557_000113 3300053105 Bacteria 22739
371 Ga0500572_015020 3300053111 Bacteria 1945
372 Ga0500595_030924 3300053119 Bacteria 1799
373 Ga0500595_125441 3300053119 Bacteria 724
374 Ga0500607_128499 3300053121 Bacteria 1212
375 Ga0500608_228945 3300053122 Bacteria 743
376 Ga0500614_019819 3300053123 Bacteria 1545
377 Ga0500642_0000056 3300053130 Bacteria 67746
378 Ga0500652_119262 3300053131 Bacteria 1103
379 Ga0500559_0127453 3300053136 Bacteria 1187
380 Ga0500559_0381043 3300053136 Bacteria 657
381 Ga0500585_270576 3300053144 Bacteria 529
382 Ga0500590_130673 3300053148 Bacteria 1162
383 Ga0500590_161864 3300053148 Bacteria 996
384 Ga0500619_247555 3300053154 Bacteria 587
385 Ga0500620_172761 3300053155 Bacteria 746
386 Ga0500638_206402 3300053162 Bacteria 826
387 Ga0500636_0002161 3300053177 Bacteria 10852
388 Ga0500636_0374347 3300053177 Bacteria 670
389 Ga0500625_000216 3300053729 Bacteria 13088

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0572179 Ga0495652_0572179_155_598 147
2 3300046681 Ga0495647_0130167 Ga0495647_0130167_356_799 147
3 3300047319 Ga0495674_0166415 Ga0495674_0166415_1268_1711 147
4 3300053085 Ga0495619_0053857 Ga0495619_0053857_566_1009 147
5 3300009174 Ga0105241_10109113 Ga0105241_101091131 148
6 3300009177 Ga0105248_10208966 Ga0105248_102089662 150
7 3300009545 Ga0105237_10540997 Ga0105237_105409972 150
8 3300026078 Ga0207702_11238975 Ga0207702_112389752 150
9 3300035692 Ga0373935_0950156 Ga0373935_0950156_19_474 150
10 3300039437 Ga0436365_0296096 Ga0436365_0296096_1242_1697 150
11 3300039450 Ga0436363_0759156 Ga0436363_0759156_1334_1789 150
12 3300046462 Ga0495651_0233100 Ga0495651_0233100_774_1229 150
13 3300046477 Ga0495664_0573337 Ga0495664_0573337_203_658 150
14 3300046615 Ga0495656_0160783 Ga0495656_0160783_264_719 150
15 3300046694 Ga0495649_0654016 Ga0495649_0654016_29_481 150
16 3300047319 Ga0495674_1448394 Ga0495674_1448394_14_466 150
17 3300047321 Ga0495676_1056225 Ga0495676_1056225_54_506 150
18 3300047445 Ga0495677_0201950 Ga0495677_0201950_25_480 150
19 3300048929 Ga0496126_0297636 Ga0496126_0297636_869_1321 150
20 3300050496 nmdc:mga07m45_360689_c1 nmdc:mga07m45_360689_c1_339_791 150
21 3300050514 nmdc:mga08x19_1323_c1 nmdc:mga08x19_1323_c1_13048_13506 150
22 3300053119 Ga0500595_125441 Ga0500595_125441_17_469 150
23 iso_pu_bacteria 2508501009 2508539085 150
24 iso_pu_bacteria 2935777560 2935782203 150
25 iso_pu_bacteria 8016603502 8016606658 150
26 iso_pu_bacteria 8016613128 8016618554 150
27 iso_pu_bacteria 8019538911 8019540642 150
28 iso_pu_bacteria 2508501042 2508695446 151
29 iso_pu_bacteria 2511231028 2511400862 151
30 iso_pu_bacteria 2513237098 2513674658 151
31 iso_pu_bacteria 2513237137 2513860495 151
32 iso_pu_bacteria 2515154112 2515625582 151
33 iso_pu_bacteria 2517093001 2517107102 151
34 iso_pu_bacteria 2524023205 2524436005 151
35 iso_pu_bacteria 2524023210 2524467775 151
36 iso_pu_bacteria 2528768022 2528851276 151
37 iso_pu_bacteria 2744054633 2745081602 151
38 iso_pu_bacteria 2791355196 2793064869 151
39 iso_pu_bacteria 2824661429 2824663830 151
40 iso_pu_bacteria 2824704595 2824709954 151
41 iso_pu_bacteria 2824753945 2824757706 151
42 iso_pu_bacteria 2824763712 2824768782 151
43 iso_pu_bacteria 2874590934 2874597151 151
44 iso_pu_bacteria 2874645413 2874646957 151
45 iso_pu_bacteria 2876771140 2876777615 151
46 iso_pu_bacteria 2876818435 2876825697 151
47 iso_pu_bacteria 2879074833 2879076176 151
48 iso_pu_bacteria 2879099564 2879108636 151
49 iso_pu_bacteria 2879127579 2879130983 151
50 iso_pu_bacteria 2879142872 2879148782 151
51 iso_pu_bacteria 2885409591 2885413947 151
52 iso_pu_bacteria 2888388044 2888390757 151
53 iso_pu_bacteria 2903768456 2903775693 151
54 iso_pu_bacteria 2904711408 2904713092 151
55 iso_pu_bacteria 2922368715 2922378704 151
56 iso_pu_bacteria 2929615660 2929618515 151
57 iso_pu_bacteria 2929624759 2929628800 151
58 iso_pu_bacteria 2932784394 2932786703 151
59 iso_pu_bacteria 2932794094 2932794399 151
60 iso_pu_bacteria 2932801729 2932806683 151
61 iso_pu_bacteria 2932809354 2932812253 151
62 iso_pu_bacteria 2932818245 2932823244 151
63 iso_pu_bacteria 2932828146 2932829916 151
64 iso_pu_bacteria 2933577622 2933580773 151
65 iso_pu_bacteria 2935616580 2935618434 151
66 iso_pu_bacteria 2935638405 2935641168 151
67 iso_pu_bacteria 2935648319 2935653685 151
68 iso_pu_bacteria 2935656913 2935662434 151
69 iso_pu_bacteria 2935665750 2935670084 151
70 iso_pu_bacteria 2935675223 2935679063 151
71 iso_pu_bacteria 2935684952 2935689937 151
72 iso_pu_bacteria 2935694250 2935698458 151
73 iso_pu_bacteria 2935703347 2935707600 151
74 iso_pu_bacteria 2935713505 2935717456 151
75 iso_pu_bacteria 2935722832 2935723874 151
76 iso_pu_bacteria 2935732158 2935740083 151
77 iso_pu_bacteria 2935741537 2935749346 151
78 iso_pu_bacteria 2935750917 2935757291 151
79 iso_pu_bacteria 2935760218 2935763623 151
80 iso_pu_bacteria 2935769743 2935773338 151
81 iso_pu_bacteria 2935785616 2935789164 151
82 iso_pu_bacteria 2935793552 2935797101 151
83 iso_pu_bacteria 2935801545 2935804012 151
84 iso_pu_bacteria 2935810662 2935815106 151
85 iso_pu_bacteria 2935827899 2935830899 151
86 iso_pu_bacteria 2935837841 2935841509 151
87 iso_pu_bacteria 2935855204 2935862471 151
88 iso_pu_bacteria 2935864058 2935866601 151
89 iso_pu_bacteria 2935873716 2935874908 151
90 iso_pu_bacteria 2935883170 2935888454 151
91 iso_pu_bacteria 2935975950 2935977621 151
92 iso_pu_bacteria 2935984226 2935985104 151
93 iso_pu_bacteria 2935992306 2935994414 151
94 iso_pu_bacteria 2936002035 2936004608 151
95 iso_pu_bacteria 2936011229 2936016736 151
96 iso_pu_bacteria 2936019824 2936025369 151
97 iso_pu_bacteria 2936028420 2936034211 151
98 iso_pu_bacteria 2936037263 2936043173 151
99 iso_pu_bacteria 2936046547 2936052268 151
100 iso_pu_bacteria 2936055302 2936056273 151
101 iso_pu_bacteria 2940556831 2940563204 151
102 iso_pu_bacteria 2941531003 2941535592 151
103 iso_pu_bacteria 2941538514 2941543121 151
104 iso_pu_bacteria 3005587118 3005593153 151
105 iso_pu_bacteria 3005594810 3005594941 151
106 iso_pu_bacteria 3005710791 3005710918 151
107 iso_pu_bacteria 8016511872 8016518276 151
108 iso_pu_bacteria 8016522445 8016526052 151
109 iso_pu_bacteria 8016530956 8016539660 151
110 iso_pu_bacteria 8016539877 8016543961 151
111 iso_pu_bacteria 8016548790 8016549343 151
112 iso_pu_bacteria 8016557553 8016557770 151
113 iso_pu_bacteria 8016566248 8016569362 151
114 iso_pu_bacteria 8016575299 8016581984 151
115 iso_pu_bacteria 8016595262 8016595795 151
116 iso_pu_bacteria 8016622563 8016623287 151
117 iso_pu_bacteria 8016630954 8016635716 151
118 iso_pu_bacteria 8017057580 8017058377 151
119 iso_pu_bacteria 8019530166 8019530938 151
120 iso_pu_bacteria 8019547302 8019550306 151
121 iso_pu_bacteria 8019619141 8019622884 151
122 iso_pu_bacteria 8019629233 8019630226 151
123 iso_pu_bacteria 8019659431 8019667058 151
124 iso_pu_bacteria 8019668869 8019676847 151
125 iso_pu_bacteria 8055742211 8055742365 151
126 iso_pu_bacteria 2824679649 2824682681 152
127 iso_pu_bacteria 2874628541 2874628889 152
128 iso_pu_bacteria 2922393267 2922398927 152
129 iso_pu_bacteria 8019648815 8019652567 152
130 3300013105 Ga0157369_11718432 Ga0157369_117184321 154
131 3300028381 Ga0268264_10772897 Ga0268264_107728971 154
132 3300046477 Ga0495664_0086875 Ga0495664_0086875_337_801 154
133 3300046513 Ga0495616_0053540 Ga0495616_0053540_77_541 154
134 3300047317 Ga0495604_0240720 Ga0495604_0240720_495_959 154
135 3300003354 JGI25160J50197_1016063 JGI25160J50197_10160633 155
136 3300005262 Ga0065165_1044635 Ga0065165_10446351 155
137 3300005327 Ga0070658_10644524 Ga0070658_106445242 155
138 3300005328 Ga0070676_11068179 Ga0070676_110681791 155
139 3300005329 Ga0070683_100015277 Ga0070683_1000152775 155
140 3300005331 Ga0070670_102029085 Ga0070670_1020290851 155
141 3300005334 Ga0068869_100786664 Ga0068869_1007866642 155
142 3300005336 Ga0070680_100093595 Ga0070680_1000935953 155
143 3300005336 Ga0070680_100922329 Ga0070680_1009223291 155
144 3300005336 Ga0070680_101109936 Ga0070680_1011099362 155
145 3300005337 Ga0070682_100026381 Ga0070682_1000263812 155
146 3300005337 Ga0070682_100113038 Ga0070682_1001130382 155
147 3300005338 Ga0068868_101064024 Ga0068868_1010640241 155
148 3300005338 Ga0068868_101185142 Ga0068868_1011851421 155
149 3300005343 Ga0070687_100695425 Ga0070687_1006954251 155
150 3300005344 Ga0070661_100165801 Ga0070661_1001658012 155
151 3300005354 Ga0070675_101183243 Ga0070675_1011832431 155
152 3300005355 Ga0070671_100721331 Ga0070671_1007213312 155
153 3300005364 Ga0070673_100694647 Ga0070673_1006946472 155
154 3300005436 Ga0070713_100756320 Ga0070713_1007563201 155
155 3300005445 Ga0070708_100102378 Ga0070708_1001023783 155
156 3300005456 Ga0070678_100016811 Ga0070678_1000168118 155
157 3300005456 Ga0070678_101875862 Ga0070678_1018758621 155
158 3300005458 Ga0070681_10012145 Ga0070681_100121458 155
159 3300005458 Ga0070681_10258669 Ga0070681_102586693 155
160 3300005458 Ga0070681_10322347 Ga0070681_103223472 155
161 3300005467 Ga0070706_100310566 Ga0070706_1003105662 155
162 3300005471 Ga0070698_100830042 Ga0070698_1008300422 155
163 3300005518 Ga0070699_100409643 Ga0070699_1004096431 155
164 3300005530 Ga0070679_100030356 Ga0070679_1000303562 155
165 3300005535 Ga0070684_100072138 Ga0070684_1000721384 155
166 3300005536 Ga0070697_100060057 Ga0070697_1000600573 155
167 3300005539 Ga0068853_100068121 Ga0068853_1000681213 155
168 3300005539 Ga0068853_100094100 Ga0068853_1000941004 155
169 3300005547 Ga0070693_101009681 Ga0070693_1010096811 155
170 3300005548 Ga0070665_100033886 Ga0070665_1000338867 155
171 3300005548 Ga0070665_100050153 Ga0070665_1000501533 155
172 3300005549 Ga0070704_100599894 Ga0070704_1005998941 155
173 3300005563 Ga0068855_100088206 Ga0068855_1000882064 155
174 3300005563 Ga0068855_101191090 Ga0068855_1011910902 155
175 3300005564 Ga0070664_100021866 Ga0070664_1000218662 155
176 3300005614 Ga0068856_100140571 Ga0068856_1001405713 155
177 3300005614 Ga0068856_100507118 Ga0068856_1005071182 155
178 3300005614 Ga0068856_101203907 Ga0068856_1012039071 155
179 3300005616 Ga0068852_100024177 Ga0068852_1000241774 155
180 3300005616 Ga0068852_100516385 Ga0068852_1005163852 155
181 3300005617 Ga0068859_100149351 Ga0068859_1001493512 155
182 3300005617 Ga0068859_100362051 Ga0068859_1003620513 155
183 3300005618 Ga0068864_100960957 Ga0068864_1009609572 155
184 3300005842 Ga0068858_101573254 Ga0068858_1015732541 155
185 3300005843 Ga0068860_100224889 Ga0068860_1002248891 155
186 3300005844 Ga0068862_101347585 Ga0068862_1013475851 155
187 3300005844 Ga0068862_101666537 Ga0068862_1016665371 155
188 3300005937 Ga0081455_10000165 Ga0081455_1000016566 155
189 3300005937 Ga0081455_10033257 Ga0081455_100332573 155
190 3300005937 Ga0081455_10058499 Ga0081455_100584994 155
191 3300005983 Ga0081540_1246509 Ga0081540_12465091 155
192 3300005985 Ga0081539_10084052 Ga0081539_100840523 155
193 3300006028 Ga0070717_10893199 Ga0070717_108931991 155
194 3300006038 Ga0075365_10020137 Ga0075365_100201375 155
195 3300006038 Ga0075365_10431562 Ga0075365_104315621 155
196 3300006175 Ga0070712_101300145 Ga0070712_1013001451 155
197 3300006178 Ga0075367_10250652 Ga0075367_102506522 155
198 3300006195 Ga0075366_10535482 Ga0075366_105354821 155
199 3300006237 Ga0097621_100294441 Ga0097621_1002944411 155
200 3300006353 Ga0075370_10186488 Ga0075370_101864882 155
201 3300006353 Ga0075370_10435065 Ga0075370_104350652 155
202 3300006931 Ga0097620_100149350 Ga0097620_1001493502 155
203 3300006931 Ga0097620_100362044 Ga0097620_1003620443 155
204 3300007265 Ga0099794_10020634 Ga0099794_100206343 155
205 3300009093 Ga0105240_10244910 Ga0105240_102449103 155
206 3300009094 Ga0111539_10739439 Ga0111539_107394392 155
207 3300009094 Ga0111539_12118668 Ga0111539_121186682 155
208 3300009101 Ga0105247_10243317 Ga0105247_102433172 155
209 3300009177 Ga0105248_10831268 Ga0105248_108312682 155
210 3300009177 Ga0105248_10959623 Ga0105248_109596232 155
211 3300009551 Ga0105238_10441049 Ga0105238_104410492 155
212 3300009553 Ga0105249_10061794 Ga0105249_100617941 155
213 3300009553 Ga0105249_11081298 Ga0105249_110812982 155
214 3300010375 Ga0105239_11015610 Ga0105239_110156101 155
215 3300013104 Ga0157370_10010808 Ga0157370_1001080810 155
216 3300013306 Ga0163162_10605122 Ga0163162_106051221 155
217 3300013306 Ga0163162_11432791 Ga0163162_114327912 155
218 3300013308 Ga0157375_12303677 Ga0157375_123036772 155
219 3300014497 Ga0182008_10565434 Ga0182008_105654341 155
220 3300014968 Ga0157379_10172963 Ga0157379_101729631 155
221 3300015262 Ga0182007_10236819 Ga0182007_102368192 155
222 3300020082 Ga0206353_10077123 Ga0206353_100771231 155
223 3300021441 Ga0213871_10005818 Ga0213871_100058185 155
224 3300025253 Ga0209677_101289 Ga0209677_1012896 155
225 3300025297 Ga0209758_1006424 Ga0209758_10064242 155
226 3300025297 Ga0209758_1019339 Ga0209758_10193392 155
227 3300025302 Ga0207426_1011734 Ga0207426_10117343 155
228 3300025302 Ga0207426_1021850 Ga0207426_10218502 155
229 3300025302 Ga0207426_1055766 Ga0207426_10557662 155
230 3300025304 Ga0209257_1040726 Ga0209257_10407262 155
231 3300025900 Ga0207710_10197174 Ga0207710_101971742 155
232 3300025904 Ga0207647_10124872 Ga0207647_101248722 155
233 3300025904 Ga0207647_10398942 Ga0207647_103989421 155
234 3300025907 Ga0207645_10419753 Ga0207645_104197532 155
235 3300025909 Ga0207705_10795101 Ga0207705_107951012 155
236 3300025910 Ga0207684_10494629 Ga0207684_104946292 155
237 3300025911 Ga0207654_10068048 Ga0207654_100680482 155
238 3300025911 Ga0207654_10479673 Ga0207654_104796732 155
239 3300025912 Ga0207707_10000100 Ga0207707_1000010076 155
240 3300025912 Ga0207707_10653026 Ga0207707_106530262 155
241 3300025913 Ga0207695_10046470 Ga0207695_100464707 155
242 3300025917 Ga0207660_10168390 Ga0207660_101683902 155
243 3300025918 Ga0207662_10557783 Ga0207662_105577832 155
244 3300025919 Ga0207657_10404959 Ga0207657_104049592 155
245 3300025920 Ga0207649_10089196 Ga0207649_100891962 155
246 3300025920 Ga0207649_10395392 Ga0207649_103953922 155
247 3300025921 Ga0207652_11650171 Ga0207652_116501711 155
248 3300025923 Ga0207681_10166024 Ga0207681_101660242 155
249 3300025924 Ga0207694_10205995 Ga0207694_102059951 155
250 3300025924 Ga0207694_10574515 Ga0207694_105745152 155
251 3300025926 Ga0207659_10576244 Ga0207659_105762442 155
252 3300025928 Ga0207700_10029810 Ga0207700_100298102 155
253 3300025931 Ga0207644_10436196 Ga0207644_104361962 155
254 3300025944 Ga0207661_10254048 Ga0207661_102540482 155
255 3300025945 Ga0207679_10040119 Ga0207679_100401194 155
256 3300025949 Ga0207667_10204442 Ga0207667_102044423 155
257 3300025949 Ga0207667_10981575 Ga0207667_109815751 155
258 3300025972 Ga0207668_10970704 Ga0207668_109707042 155
259 3300025981 Ga0207640_10905192 Ga0207640_109051921 155
260 3300026035 Ga0207703_11049553 Ga0207703_110495531 155
261 3300026041 Ga0207639_10075381 Ga0207639_100753811 155
262 3300026067 Ga0207678_10201664 Ga0207678_102016642 155
263 3300026078 Ga0207702_10325683 Ga0207702_103256832 155
264 3300026088 Ga0207641_12118935 Ga0207641_121189351 155
265 3300026089 Ga0207648_10266981 Ga0207648_102669812 155
266 3300026116 Ga0207674_10073705 Ga0207674_100737055 155
267 3300026118 Ga0207675_100872184 Ga0207675_1008721842 155
268 3300026121 Ga0207683_10013541 Ga0207683_100135416 155
269 3300027907 Ga0207428_10597044 Ga0207428_105970441 155
270 3300028379 Ga0268266_10035191 Ga0268266_100351916 155
271 3300028379 Ga0268266_10214817 Ga0268266_102148172 155
272 3300028379 Ga0268266_10318435 Ga0268266_103184352 155
273 3300028380 Ga0268265_10285532 Ga0268265_102855322 155
274 3300028381 Ga0268264_11350849 Ga0268264_113508491 155
275 3300028573 Ga0265334_10003250 Ga0265334_100032506 155
276 3300031247 Ga0265340_10012237 Ga0265340_100122373 155
277 3300031456 Ga0307513_10037882 Ga0307513_100378822 155
278 3300035113 Ga0373936_0015383 Ga0373936_0015383_2433_2900 155
279 3300035114 Ga0373939_0018613 Ga0373939_0018613_942_1409 155
280 3300035121 Ga0373960_0111342 Ga0373960_0111342_186_653 155
281 3300035207 Ga0373942_0112015 Ga0373942_0112015_25_492 155
282 3300035691 Ga0373931_0114934 Ga0373931_0114934_575_1042 155
283 3300035691 Ga0373931_0241506 Ga0373931_0241506_309_776 155
284 3300035691 Ga0373931_0267543 Ga0373931_0267543_236_706 155
285 3300035695 Ga0373927_0432914 Ga0373927_0432914_380_850 155
286 3300036401 Ga0373937_0685154 Ga0373937_0685154_434_901 155
287 3300037068 Ga0373925_1269582 Ga0373925_1269582_108_575 155
288 3300037418 Ga0395900_0405001 Ga0395900_0405001_178_648 155
289 3300037466 Ga0395898_0265353 Ga0395898_0265353_863_1333 155
290 3300037471 Ga0395905_0161919 Ga0395905_0161919_821_1288 155
291 3300037471 Ga0395905_0351338 Ga0395905_0351338_642_1112 155
292 3300037471 Ga0395905_0367892 Ga0395905_0367892_250_717 155
293 3300037471 Ga0395905_0998986 Ga0395905_0998986_130_600 155
294 3300038443 Ga0395901_0006638 Ga0395901_0006638_4134_4604 155
295 3300038443 Ga0395901_0572247 Ga0395901_0572247_381_851 155
296 3300039438 Ga0436360_0556698 Ga0436360_0556698_1673_2140 155
297 3300039447 Ga0436361_0603476 Ga0436361_0603476_2170_2637 155
298 3300039450 Ga0436363_1716462 Ga0436363_1716462_78_545 155
299 3300041407 Ga0439447_064844 Ga0439447_064844_23_490 155
300 3300041441 Ga0451787_242462 Ga0451787_242462_87_554 155
301 3300041443 Ga0451789_0651673 Ga0451789_0651673_316_813 155
302 3300041452 Ga0451793_0051564 Ga0451793_0051564_776_1243 155
303 3300041511 Ga0451855_1417582 Ga0451855_1417582_57_524 155
304 3300041512 Ga0451853_1625668 Ga0451853_1625668_583_1050 155
305 3300045976 Ga0466967_0020928 Ga0466967_0020928_3203_3670 155
306 3300046454 Ga0495592_0195716 Ga0495592_0195716_444_911 155
307 3300046459 Ga0495629_0230874 Ga0495629_0230874_528_995 155
308 3300046462 Ga0495651_0008047 Ga0495651_0008047_3511_3978 155
309 3300046463 Ga0495653_0638479 Ga0495653_0638479_63_530 155
310 3300046474 Ga0495605_0163305 Ga0495605_0163305_353_820 155
311 3300046474 Ga0495605_0183817 Ga0495605_0183817_62_529 155
312 3300046477 Ga0495664_0015315 Ga0495664_0015315_1817_2284 155
313 3300046491 Ga0495584_0193670 Ga0495584_0193670_251_721 155
314 3300046491 Ga0495584_0648246 Ga0495584_0648246_44_511 155
315 3300046501 Ga0495607_0222291 Ga0495607_0222291_205_675 155
316 3300046506 Ga0495583_0069993 Ga0495583_0069993_479_946 155
317 3300046507 Ga0495606_0067588 Ga0495606_0067588_292_759 155
318 3300046507 Ga0495606_0087674 Ga0495606_0087674_799_1269 155
319 3300046511 Ga0495608_0536702 Ga0495608_0536702_110_577 155
320 3300046514 Ga0495618_0624477 Ga0495618_0624477_149_616 155
321 3300046516 Ga0495628_0046301 Ga0495628_0046301_2005_2472 155
322 3300046524 Ga0495648_0007591 Ga0495648_0007591_6668_7135 155
323 3300046524 Ga0495648_0129425 Ga0495648_0129425_799_1266 155
324 3300046529 Ga0495652_0026606 Ga0495652_0026606_3281_3748 155
325 3300046529 Ga0495652_0079832 Ga0495652_0079832_1534_2001 155
326 3300046531 Ga0495665_0150749 Ga0495665_0150749_66_536 155
327 3300046533 Ga0495640_0053549 Ga0495640_0053549_1392_1859 155
328 3300046533 Ga0495640_0384373 Ga0495640_0384373_142_609 155
329 3300046536 Ga0495587_0020838 Ga0495587_0020838_3240_3707 155
330 3300046557 Ga0495622_0007520 Ga0495622_0007520_3510_3977 155
331 3300046557 Ga0495622_0030278 Ga0495622_0030278_1357_1827 155
332 3300046559 Ga0495667_0027440 Ga0495667_0027440_118_585 155
333 3300046616 Ga0495668_0064460 Ga0495668_0064460_506_973 155
334 3300046616 Ga0495668_0387120 Ga0495668_0387120_212_679 155
335 3300046616 Ga0495668_0599198 Ga0495668_0599198_94_561 155
336 3300046642 Ga0495634_0022629 Ga0495634_0022629_450_917 155
337 3300046660 Ga0495625_0333583 Ga0495625_0333583_244_714 155
338 3300046663 Ga0495635_0008534 Ga0495635_0008534_6285_6752 155
339 3300046663 Ga0495635_0110288 Ga0495635_0110288_428_895 155
340 3300046664 Ga0495659_0313178 Ga0495659_0313178_68_538 155
341 3300046665 Ga0495661_0216643 Ga0495661_0216643_328_795 155
342 3300046674 Ga0495588_0079618 Ga0495588_0079618_314_781 155
343 3300046678 Ga0495599_0292091 Ga0495599_0292091_118_585 155
344 3300046678 Ga0495599_0722658 Ga0495599_0722658_61_528 155
345 3300046679 Ga0495623_0003900 Ga0495623_0003900_3711_4178 155
346 3300046680 Ga0495646_0050416 Ga0495646_0050416_1155_1622 155
347 3300046680 Ga0495646_0243834 Ga0495646_0243834_447_917 155
348 3300046689 Ga0495613_0066962 Ga0495613_0066962_1626_2093 155
349 3300046690 Ga0495624_0067530 Ga0495624_0067530_1655_2125 155
350 3300046694 Ga0495649_0109077 Ga0495649_0109077_219_686 155
351 3300046809 Ga0495600_0038537 Ga0495600_0038537_148_615 155
352 3300047315 Ga0495581_0077806 Ga0495581_0077806_1138_1605 155
353 3300047317 Ga0495604_0016427 Ga0495604_0016427_5064_5531 155
354 3300047317 Ga0495604_0021055 Ga0495604_0021055_442_909 155
355 3300047318 Ga0495636_0187048 Ga0495636_0187048_69_536 155
356 3300047319 Ga0495674_0185262 Ga0495674_0185262_149_616 155
357 3300047321 Ga0495676_0047026 Ga0495676_0047026_603_1070 155
358 3300047444 Ga0495675_0002868 Ga0495675_0002868_9687_10154 155
359 3300047447 Ga0495685_072604 Ga0495685_072604_319_789 155
360 3300047471 Ga0495684_0406505 Ga0495684_0406505_148_615 155
361 3300047471 Ga0495684_0474483 Ga0495684_0474483_75_542 155
362 3300047472 Ga0495686_0207557 Ga0495686_0207557_632_1099 155
363 3300047673 Ga0495593_0077057 Ga0495593_0077057_405_872 155
364 3300047673 Ga0495593_0269918 Ga0495593_0269918_356_823 155
365 3300048088 Ga0495602_0006250 Ga0495602_0006250_5471_5938 155
366 3300048088 Ga0495602_0065373 Ga0495602_0065373_142_609 155
367 3300048904 Ga0496101_0533869 Ga0496101_0533869_42_509 155
368 3300048905 Ga0496102_0163600 Ga0496102_0163600_581_1048 155
369 3300048907 Ga0496104_0005317 Ga0496104_0005317_260_727 155
370 3300048907 Ga0496104_0264481 Ga0496104_0264481_611_1081 155
371 3300048907 Ga0496104_0718501 Ga0496104_0718501_121_588 155
372 3300048908 Ga0496105_0008712 Ga0496105_0008712_2932_3399 155
373 3300048908 Ga0496105_0567770 Ga0496105_0567770_167_637 155
374 3300048909 Ga0496106_0122703 Ga0496106_0122703_1009_1476 155
375 3300048911 Ga0496108_0924164 Ga0496108_0924164_186_653 155
376 3300048912 Ga0496109_0280152 Ga0496109_0280152_939_1409 155
377 3300048913 Ga0496110_1352616 Ga0496110_1352616_37_507 155
378 3300048914 Ga0496111_0081497 Ga0496111_0081497_1781_2251 155
379 3300048915 Ga0496112_0075249 Ga0496112_0075249_582_1052 155
380 3300048915 Ga0496112_0307551 Ga0496112_0307551_318_785 155
381 3300048916 Ga0496113_0022521 Ga0496113_0022521_2703_3170 155
382 3300048916 Ga0496113_0058728 Ga0496113_0058728_509_979 155
383 3300048917 Ga0496114_0070345 Ga0496114_0070345_1454_1921 155
384 3300048917 Ga0496114_0296409 Ga0496114_0296409_524_991 155
385 3300048918 Ga0496115_0219527 Ga0496115_0219527_889_1359 155
386 3300048918 Ga0496115_0451303 Ga0496115_0451303_253_720 155
387 3300048919 Ga0496116_0115080 Ga0496116_0115080_993_1460 155
388 3300048920 Ga0496117_0260714 Ga0496117_0260714_70_537 155
389 3300048921 Ga0496118_0136851 Ga0496118_0136851_212_679 155
390 3300048921 Ga0496118_0312475 Ga0496118_0312475_102_569 155
391 3300048922 Ga0496119_0014481 Ga0496119_0014481_2141_2608 155
392 3300048923 Ga0496120_0008272 Ga0496120_0008272_4950_5417 155
393 3300048924 Ga0496121_0360062 Ga0496121_0360062_478_945 155
394 3300048924 Ga0496121_0396984 Ga0496121_0396984_266_733 155
395 3300048929 Ga0496126_0059143 Ga0496126_0059143_2886_3353 155
396 3300048929 Ga0496126_0085867 Ga0496126_0085867_611_1078 155
397 3300048929 Ga0496126_0112120 Ga0496126_0112120_1836_2303 155
398 3300048929 Ga0496126_0516056 Ga0496126_0516056_384_851 155
399 3300048929 Ga0496126_0618248 Ga0496126_0618248_206_676 155
400 3300049460 Ga0495682_0017444 Ga0495682_0017444_1418_1885 155
401 3300049571 Ga0501034_0000663 Ga0501034_0000663_36784_37251 155
402 3300049571 Ga0501034_0002763 Ga0501034_0002763_8969_9451 155
403 3300049581 Ga0501047_0217546 Ga0501047_0217546_1251_1718 155
404 3300049584 Ga0501068_0402493 Ga0501068_0402493_92_559 155
405 3300049588 Ga0501072_0148521 Ga0501072_0148521_1256_1723 155
406 3300049588 Ga0501072_1249641 Ga0501072_1249641_66_548 155
407 3300049590 Ga0501074_0338734 Ga0501074_0338734_571_1038 155
408 3300050489 nmdc:mga03683_426860_c1 nmdc:mga03683_426860_c1_113_580 155
409 3300050489 nmdc:mga03683_566761_c1 nmdc:mga03683_566761_c1_49_516 155
410 3300050491 nmdc:mga00v17_560377_c1 nmdc:mga00v17_560377_c1_255_722 155
411 3300050492 nmdc:mga0yw44_1147092_c1 nmdc:mga0yw44_1147092_c1_39_506 155
412 3300050492 nmdc:mga0yw44_36677_c1 nmdc:mga0yw44_36677_c1_65_532 155
413 3300050493 nmdc:mga0k408_182657_c1 nmdc:mga0k408_182657_c1_612_1079 155
414 3300050494 nmdc:mga06z11_124099_c1 nmdc:mga06z11_124099_c1_789_1256 155
415 3300050494 nmdc:mga06z11_433666_c1 nmdc:mga06z11_433666_c1_60_527 155
416 3300050496 nmdc:mga07m45_375105_c1 nmdc:mga07m45_375105_c1_278_745 155
417 3300050509 nmdc:mga0qj67_1272946_c1 nmdc:mga0qj67_1272946_c1_26_496 155
418 3300050516 nmdc:mga0sz30_30277_c1 nmdc:mga0sz30_30277_c1_1632_2099 155
419 3300053080 Ga0500635_0189461 Ga0500635_0189461_320_787 155
420 3300053085 Ga0495619_0489933 Ga0495619_0489933_127_594 155
421 3300053086 Ga0500578_0038187 Ga0500578_0038187_317_784 155
422 3300053086 Ga0500578_0060200 Ga0500578_0060200_1861_2328 155
423 3300053088 Ga0500644_0099855 Ga0500644_0099855_14_481 155
424 3300053091 Ga0500647_0031022 Ga0500647_0031022_1268_1735 155
425 3300053094 Ga0500566_0001036 Ga0500566_0001036_6661_7128 155
426 3300053094 Ga0500566_0058910 Ga0500566_0058910_1308_1775 155
427 3300053105 Ga0500557_000113 Ga0500557_000113_7100_7567 155
428 3300053111 Ga0500572_015020 Ga0500572_015020_667_1134 155
429 3300053119 Ga0500595_030924 Ga0500595_030924_980_1447 155
430 3300053121 Ga0500607_128499 Ga0500607_128499_315_782 155
431 3300053122 Ga0500608_228945 Ga0500608_228945_41_508 155
432 3300053123 Ga0500614_019819 Ga0500614_019819_657_1124 155
433 3300053130 Ga0500642_0000056 Ga0500642_0000056_36604_37071 155
434 3300053136 Ga0500559_0127453 Ga0500559_0127453_37_504 155
435 3300053136 Ga0500559_0381043 Ga0500559_0381043_42_509 155
436 3300053144 Ga0500585_270576 Ga0500585_270576_18_485 155
437 3300053148 Ga0500590_130673 Ga0500590_130673_363_830 155
438 3300053148 Ga0500590_161864 Ga0500590_161864_332_799 155
439 3300053154 Ga0500619_247555 Ga0500619_247555_45_512 155
440 3300053155 Ga0500620_172761 Ga0500620_172761_121_588 155
441 3300053162 Ga0500638_206402 Ga0500638_206402_71_538 155
442 3300053177 Ga0500636_0002161 Ga0500636_0002161_7225_7692 155
443 3300053177 Ga0500636_0374347 Ga0500636_0374347_99_569 155
444 3300053729 Ga0500625_000216 Ga0500625_000216_10039_10506 155
445 3300003215 JGI25153J46596_10009574 JGI25153J46596_100095744 156
446 3300005329 Ga0070683_100004460 Ga0070683_1000044607 156
447 3300005458 Ga0070681_10015192 Ga0070681_100151925 156
448 3300005467 Ga0070706_100112399 Ga0070706_1001123992 156
449 3300005471 Ga0070698_100003587 Ga0070698_10000358710 156
450 3300005530 Ga0070679_100007272 Ga0070679_1000072725 156
451 3300005535 Ga0070684_100010952 Ga0070684_1000109523 156
452 3300005536 Ga0070697_100294277 Ga0070697_1002942772 156
453 3300005543 Ga0070672_101195000 Ga0070672_1011950002 156
454 3300005547 Ga0070693_100268717 Ga0070693_1002687172 156
455 3300005563 Ga0068855_101189030 Ga0068855_1011890301 156
456 3300005614 Ga0068856_101023416 Ga0068856_1010234162 156
457 3300005937 Ga0081455_10075074 Ga0081455_100750741 156
458 3300006038 Ga0075365_10848082 Ga0075365_108480821 156
459 3300009093 Ga0105240_11099761 Ga0105240_110997611 156
460 3300009551 Ga0105238_10102507 Ga0105238_101025072 156
461 3300013104 Ga0157370_10614622 Ga0157370_106146222 156
462 3300013105 Ga0157369_10055172 Ga0157369_100551724 156
463 3300013105 Ga0157369_11104129 Ga0157369_111041292 156
464 3300013296 Ga0157374_10212779 Ga0157374_102127792 156
465 3300013296 Ga0157374_10859675 Ga0157374_108596752 156
466 3300013306 Ga0163162_10773392 Ga0163162_107733922 156
467 3300013307 Ga0157372_11332824 Ga0157372_113328242 156
468 3300013308 Ga0157375_10705812 Ga0157375_107058121 156
469 3300014325 Ga0163163_12198306 Ga0163163_121983061 156
470 3300014968 Ga0157379_10756295 Ga0157379_107562952 156
471 3300025297 Ga0209758_1001177 Ga0209758_10011776 156
472 3300025302 Ga0207426_1002219 Ga0207426_10022193 156
473 3300025302 Ga0207426_1005323 Ga0207426_10053234 156
474 3300025910 Ga0207684_10068738 Ga0207684_100687384 156
475 3300025912 Ga0207707_10013022 Ga0207707_100130222 156
476 3300025921 Ga0207652_10093647 Ga0207652_100936472 156
477 3300025944 Ga0207661_10006741 Ga0207661_100067416 156
478 3300026078 Ga0207702_10962770 Ga0207702_109627702 156
479 3300035170 Ga0373943_0323985 Ga0373943_0323985_57_554 156
480 3300037312 Ga0395899_0009033 Ga0395899_0009033_4090_4587 156
481 3300037312 Ga0395899_0121221 Ga0395899_0121221_514_1011 156
482 3300037418 Ga0395900_0001350 Ga0395900_0001350_7167_7664 156
483 3300037418 Ga0395900_0045645 Ga0395900_0045645_2326_2823 156
484 3300037466 Ga0395898_0029321 Ga0395898_0029321_1087_1584 156
485 3300037471 Ga0395905_0003532 Ga0395905_0003532_155_625 156
486 3300038443 Ga0395901_0008112 Ga0395901_0008112_9475_9972 156
487 3300038443 Ga0395901_0014435 Ga0395901_0014435_3884_4381 156
488 3300038443 Ga0395901_0150459 Ga0395901_0150459_1126_1596 156
489 3300041496 Ga0451839_0317516 Ga0451839_0317516_66_545 156
490 3300046692 Ga0495671_0015307 Ga0495671_0015307_215_703 156
491 3300046794 Ga0495589_0124536 Ga0495589_0124536_383_865 156
492 3300046810 Ga0495660_0208416 Ga0495660_0208416_181_663 156
493 3300048908 Ga0496105_0357564 Ga0496105_0357564_243_725 156
494 3300049579 Ga0501043_0905724 Ga0501043_0905724_130_612 156
495 3300053094 Ga0500566_0266563 Ga0500566_0266563_212_712 156
496 3300053131 Ga0500652_119262 Ga0500652_119262_455_961 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

10

116

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dre-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) 0.8788 2 122
3ov4-assembly2.cif.gz_D crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8729 2 122
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8694 2 122
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.8669 13 119
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8667 2 122
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8874 13 119 3.10.450.50
4hvnB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8733 7 130 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8729 2 122 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.85 2 119 3.10.450.50
af_A0A1D8PLG7_12_136_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8436 3 119 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2H9V4T9-F1-model_v4 deleted 0.9974 5 139
AF-A0A562S659-F1-model_v4 Ketosteroid isomerase-like protein 0.9937 4 156 GO:0016853
AF-A0A0D7PAZ9-F1-model_v4 Polyketide cyclase 0.9935 4 156
AF-A0A0R3BI51-F1-model_v4 Polyketide cyclase 0.9927 4 156
AF-A0A0R3BN22-F1-model_v4 deleted 0.9915 4 156

Feature Viewer

pLDDT pTM Quality
94.92 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map