F454860
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 496 | 359 | 389 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10075074|Ga0081455_100750741 |
| Length | 176 |
| Sequence | MNSSSIRQMLDGLCRAAEQRDGKTFASHFAEDGVYHDDFYGAFVGRERVAELINDWFHKDARALRWDMIEPAYDGGRLYVRYVFSYNSTLPEARDARAMFEGVAIMSLRDGKITEYREIISCGTAFVDMNFHPERIFKIFARKAAAMKMKPEVQRHLPTVEKTSREPRAGHRPEAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 7 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 8 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 9 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 10 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 11 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 12 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 13 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 14 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 15 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 16 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 17 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 18 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 19 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 20 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 21 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 22 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 23 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 24 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 25 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 26 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 27 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 28 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 29 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 30 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 31 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 32 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 33 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 34 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 35 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 36 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 37 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 38 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 39 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 40 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 41 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 42 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 43 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 44 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 45 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 46 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 47 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 48 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 49 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 50 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 51 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 52 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 53 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 54 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 55 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 56 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 57 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 58 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 59 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 60 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 61 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 62 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 63 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 64 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 65 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 66 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 67 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 68 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 69 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 70 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 71 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 72 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 73 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 74 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 75 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 76 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 77 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 78 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 79 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 80 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 81 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 82 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 83 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 84 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 85 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 86 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 87 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 92 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 95 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 111 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 116 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 118 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 119 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 120 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 121 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 122 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 126 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 127 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 129 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 131 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 132 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 157 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 220 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 224 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 293 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 294 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 295 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 296 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 318 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 322 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 325 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 327 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 329 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 332 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 335 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 337 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 338 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 339 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 340 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 341 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 342 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 343 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 344 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 345 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 346 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 347 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 348 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 349 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 350 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 351 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 352 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 353 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 354 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 355 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 356 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 357 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 358 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 359 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.38 |
| Metatranscriptomes | 0.2 |
| Isolates | 21.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.9 |
| Nodule | 18.55 |
| Rhizoplane | 4.84 |
| Rhizosphere | 57.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10009574 | 3300003215 | Bacteria | 4479 |
| 2 | JGI25160J50197_1016063 | 3300003354 | Bacteria | 2427 |
| 3 | Ga0065165_1044635 | 3300005262 | Bacteria | 1295 |
| 4 | Ga0070658_10644524 | 3300005327 | Bacteria | 919 |
| 5 | Ga0070676_11068179 | 3300005328 | Bacteria | 609 |
| 6 | Ga0070683_100004460 | 3300005329 | Bacteria | 11548 |
| 7 | Ga0070683_100015277 | 3300005329 | Bacteria | 6741 |
| 8 | Ga0070670_102029085 | 3300005331 | Bacteria | 530 |
| 9 | Ga0068869_100786664 | 3300005334 | Bacteria | 817 |
| 10 | Ga0070680_100093595 | 3300005336 | Bacteria | 2490 |
| 11 | Ga0070680_100922329 | 3300005336 | Bacteria | 754 |
| 12 | Ga0070680_101109936 | 3300005336 | Bacteria | 684 |
| 13 | Ga0070682_100026381 | 3300005337 | Bacteria | 3476 |
| 14 | Ga0070682_100113038 | 3300005337 | Bacteria | 1813 |
| 15 | Ga0068868_101064024 | 3300005338 | Bacteria | 743 |
| 16 | Ga0068868_101185142 | 3300005338 | Bacteria | 706 |
| 17 | Ga0070687_100695425 | 3300005343 | Bacteria | 710 |
| 18 | Ga0070661_100165801 | 3300005344 | Bacteria | 1675 |
| 19 | Ga0070675_101183243 | 3300005354 | Bacteria | 704 |
| 20 | Ga0070671_100721331 | 3300005355 | Bacteria | 865 |
| 21 | Ga0070673_100694647 | 3300005364 | Bacteria | 934 |
| 22 | Ga0070713_100756320 | 3300005436 | Bacteria | 930 |
| 23 | Ga0070708_100102378 | 3300005445 | Bacteria | 2624 |
| 24 | Ga0070678_100016811 | 3300005456 | Bacteria | 4690 |
| 25 | Ga0070678_101875862 | 3300005456 | Bacteria | 566 |
| 26 | Ga0070681_10012145 | 3300005458 | Bacteria | 8543 |
| 27 | Ga0070681_10015192 | 3300005458 | Bacteria | 7658 |
| 28 | Ga0070681_10258669 | 3300005458 | Bacteria | 1653 |
| 29 | Ga0070681_10322347 | 3300005458 | Bacteria | 1455 |
| 30 | Ga0070706_100112399 | 3300005467 | Bacteria | 2535 |
| 31 | Ga0070706_100310566 | 3300005467 | Bacteria | 1471 |
| 32 | Ga0070698_100003587 | 3300005471 | Bacteria | 17059 |
| 33 | Ga0070698_100830042 | 3300005471 | Bacteria | 869 |
| 34 | Ga0070699_100409643 | 3300005518 | Bacteria | 1226 |
| 35 | Ga0070679_100007272 | 3300005530 | Bacteria | 10338 |
| 36 | Ga0070679_100030356 | 3300005530 | Bacteria | 5337 |
| 37 | Ga0070684_100010952 | 3300005535 | Bacteria | 7209 |
| 38 | Ga0070684_100072138 | 3300005535 | Bacteria | 3039 |
| 39 | Ga0070697_100060057 | 3300005536 | Bacteria | 3098 |
| 40 | Ga0070697_100294277 | 3300005536 | Bacteria | 1395 |
| 41 | Ga0068853_100068121 | 3300005539 | Bacteria | 3093 |
| 42 | Ga0068853_100094100 | 3300005539 | Bacteria | 2639 |
| 43 | Ga0070672_101195000 | 3300005543 | Unclassified | 677 |
| 44 | Ga0070693_100268717 | 3300005547 | Unclassified | 1137 |
| 45 | Ga0070693_101009681 | 3300005547 | Bacteria | 630 |
| 46 | Ga0070665_100033886 | 3300005548 | Bacteria | 5137 |
| 47 | Ga0070665_100050153 | 3300005548 | Bacteria | 4188 |
| 48 | Ga0070704_100599894 | 3300005549 | Bacteria | 968 |
| 49 | Ga0068855_100088206 | 3300005563 | Bacteria | 3583 |
| 50 | Ga0068855_101189030 | 3300005563 | Unclassified | 793 |
| 51 | Ga0068855_101191090 | 3300005563 | Bacteria | 793 |
| 52 | Ga0070664_100021866 | 3300005564 | Bacteria | 5273 |
| 53 | Ga0068856_100140571 | 3300005614 | Bacteria | 2421 |
| 54 | Ga0068856_100507118 | 3300005614 | Bacteria | 1227 |
| 55 | Ga0068856_101023416 | 3300005614 | Unclassified | 844 |
| 56 | Ga0068856_101203907 | 3300005614 | Bacteria | 774 |
| 57 | Ga0068852_100024177 | 3300005616 | Bacteria | 4906 |
| 58 | Ga0068852_100516385 | 3300005616 | Bacteria | 1191 |
| 59 | Ga0068859_100149351 | 3300005617 | Bacteria | 2413 |
| 60 | Ga0068859_100362051 | 3300005617 | Bacteria | 1545 |
| 61 | Ga0068864_100960957 | 3300005618 | Bacteria | 846 |
| 62 | Ga0068858_101573254 | 3300005842 | Bacteria | 649 |
| 63 | Ga0068860_100224889 | 3300005843 | Bacteria | 1823 |
| 64 | Ga0068862_101347585 | 3300005844 | Bacteria | 716 |
| 65 | Ga0068862_101666537 | 3300005844 | Bacteria | 645 |
| 66 | Ga0081455_10000165 | 3300005937 | Bacteria | 81987 |
| 67 | Ga0081455_10033257 | 3300005937 | Bacteria | 4636 |
| 68 | Ga0081455_10058499 | 3300005937 | Bacteria | 3261 |
| 69 | Ga0081455_10075074 | 3300005937 | Unclassified | 2790 |
| 70 | Ga0081540_1246509 | 3300005983 | Bacteria | 625 |
| 71 | Ga0081539_10084052 | 3300005985 | Bacteria | 1665 |
| 72 | Ga0070717_10893199 | 3300006028 | Bacteria | 809 |
| 73 | Ga0075365_10020137 | 3300006038 | Bacteria | 4131 |
| 74 | Ga0075365_10431562 | 3300006038 | Bacteria | 930 |
| 75 | Ga0075365_10848082 | 3300006038 | Bacteria | 644 |
| 76 | Ga0070712_101300145 | 3300006175 | Bacteria | 634 |
| 77 | Ga0075367_10250652 | 3300006178 | Bacteria | 1110 |
| 78 | Ga0075366_10535482 | 3300006195 | Bacteria | 725 |
| 79 | Ga0097621_100294441 | 3300006237 | Bacteria | 1432 |
| 80 | Ga0075370_10186488 | 3300006353 | Bacteria | 1221 |
| 81 | Ga0075370_10435065 | 3300006353 | Bacteria | 789 |
| 82 | Ga0097620_100149350 | 3300006931 | Bacteria | 2413 |
| 83 | Ga0097620_100362044 | 3300006931 | Bacteria | 1545 |
| 84 | Ga0099794_10020634 | 3300007265 | Bacteria | 2984 |
| 85 | Ga0105240_10244910 | 3300009093 | Bacteria | 2076 |
| 86 | Ga0105240_11099761 | 3300009093 | Bacteria | 846 |
| 87 | Ga0111539_10739439 | 3300009094 | Bacteria | 1145 |
| 88 | Ga0111539_12118668 | 3300009094 | Bacteria | 652 |
| 89 | Ga0105247_10243317 | 3300009101 | Bacteria | 1227 |
| 90 | Ga0105241_10109113 | 3300009174 | Bacteria | 2213 |
| 91 | Ga0105248_10208966 | 3300009177 | Bacteria | 2199 |
| 92 | Ga0105248_10831268 | 3300009177 | Bacteria | 1042 |
| 93 | Ga0105248_10959623 | 3300009177 | Bacteria | 966 |
| 94 | Ga0105237_10540997 | 3300009545 | Bacteria | 1171 |
| 95 | Ga0105238_10102507 | 3300009551 | Bacteria | 2843 |
| 96 | Ga0105238_10441049 | 3300009551 | Bacteria | 1298 |
| 97 | Ga0105249_10061794 | 3300009553 | Bacteria | 3438 |
| 98 | Ga0105249_11081298 | 3300009553 | Bacteria | 872 |
| 99 | Ga0105239_11015610 | 3300010375 | Bacteria | 954 |
| 100 | Ga0157370_10010808 | 3300013104 | Bacteria | 9594 |
| 101 | Ga0157370_10614622 | 3300013104 | Bacteria | 994 |
| 102 | Ga0157369_10055172 | 3300013105 | Bacteria | 4289 |
| 103 | Ga0157369_11104129 | 3300013105 | Unclassified | 811 |
| 104 | Ga0157369_11718432 | 3300013105 | Bacteria | 638 |
| 105 | Ga0157374_10212779 | 3300013296 | Bacteria | 1896 |
| 106 | Ga0157374_10859675 | 3300013296 | Bacteria | 924 |
| 107 | Ga0163162_10605122 | 3300013306 | Bacteria | 1222 |
| 108 | Ga0163162_10773392 | 3300013306 | Bacteria | 1078 |
| 109 | Ga0163162_11432791 | 3300013306 | Bacteria | 786 |
| 110 | Ga0157372_11332824 | 3300013307 | Bacteria | 828 |
| 111 | Ga0157375_10705812 | 3300013308 | Bacteria | 1162 |
| 112 | Ga0157375_12303677 | 3300013308 | Bacteria | 642 |
| 113 | Ga0163163_12198306 | 3300014325 | Bacteria | 611 |
| 114 | Ga0182008_10565434 | 3300014497 | Bacteria | 634 |
| 115 | Ga0157379_10172963 | 3300014968 | Bacteria | 1950 |
| 116 | Ga0157379_10756295 | 3300014968 | Bacteria | 915 |
| 117 | Ga0182007_10236819 | 3300015262 | Bacteria | 650 |
| 118 | Ga0206353_10077123 | 3300020082 | Bacteria | 682 |
| 119 | Ga0213871_10005818 | 3300021441 | Bacteria | 2575 |
| 120 | Ga0209677_101289 | 3300025253 | Bacteria | 11184 |
| 121 | Ga0209758_1001177 | 3300025297 | Bacteria | 33138 |
| 122 | Ga0209758_1006424 | 3300025297 | Bacteria | 8456 |
| 123 | Ga0209758_1019339 | 3300025297 | Bacteria | 3288 |
| 124 | Ga0207426_1002219 | 3300025302 | Bacteria | 13027 |
| 125 | Ga0207426_1005323 | 3300025302 | Bacteria | 5915 |
| 126 | Ga0207426_1011734 | 3300025302 | Bacteria | 3320 |
| 127 | Ga0207426_1021850 | 3300025302 | Bacteria | 2205 |
| 128 | Ga0207426_1055766 | 3300025302 | Bacteria | 1156 |
| 129 | Ga0209257_1040726 | 3300025304 | Bacteria | 1383 |
| 130 | Ga0207710_10197174 | 3300025900 | Bacteria | 993 |
| 131 | Ga0207647_10124872 | 3300025904 | Bacteria | 1515 |
| 132 | Ga0207647_10398942 | 3300025904 | Bacteria | 775 |
| 133 | Ga0207645_10419753 | 3300025907 | Bacteria | 901 |
| 134 | Ga0207705_10795101 | 3300025909 | Bacteria | 734 |
| 135 | Ga0207684_10068738 | 3300025910 | Bacteria | 3010 |
| 136 | Ga0207684_10494629 | 3300025910 | Bacteria | 1048 |
| 137 | Ga0207654_10068048 | 3300025911 | Bacteria | 2106 |
| 138 | Ga0207654_10479673 | 3300025911 | Bacteria | 876 |
| 139 | Ga0207707_10000100 | 3300025912 | Bacteria | 85682 |
| 140 | Ga0207707_10013022 | 3300025912 | Bacteria | 7241 |
| 141 | Ga0207707_10653026 | 3300025912 | Bacteria | 886 |
| 142 | Ga0207695_10046470 | 3300025913 | Bacteria | 4602 |
| 143 | Ga0207660_10168390 | 3300025917 | Bacteria | 1695 |
| 144 | Ga0207662_10557783 | 3300025918 | Bacteria | 794 |
| 145 | Ga0207657_10404959 | 3300025919 | Bacteria | 1073 |
| 146 | Ga0207649_10089196 | 3300025920 | Bacteria | 2015 |
| 147 | Ga0207649_10395392 | 3300025920 | Bacteria | 1033 |
| 148 | Ga0207652_10093647 | 3300025921 | Bacteria | 2644 |
| 149 | Ga0207652_11650171 | 3300025921 | Bacteria | 545 |
| 150 | Ga0207681_10166024 | 3300025923 | Bacteria | 1669 |
| 151 | Ga0207694_10205995 | 3300025924 | Bacteria | 1601 |
| 152 | Ga0207694_10574515 | 3300025924 | Bacteria | 947 |
| 153 | Ga0207659_10576244 | 3300025926 | Bacteria | 958 |
| 154 | Ga0207700_10029810 | 3300025928 | Bacteria | 3854 |
| 155 | Ga0207644_10436196 | 3300025931 | Bacteria | 1075 |
| 156 | Ga0207661_10006741 | 3300025944 | Bacteria | 8129 |
| 157 | Ga0207661_10254048 | 3300025944 | Bacteria | 1563 |
| 158 | Ga0207679_10040119 | 3300025945 | Bacteria | 3349 |
| 159 | Ga0207667_10204442 | 3300025949 | Bacteria | 2025 |
| 160 | Ga0207667_10981575 | 3300025949 | Bacteria | 833 |
| 161 | Ga0207668_10970704 | 3300025972 | Bacteria | 758 |
| 162 | Ga0207640_10905192 | 3300025981 | Bacteria | 771 |
| 163 | Ga0207703_11049553 | 3300026035 | Bacteria | 782 |
| 164 | Ga0207639_10075381 | 3300026041 | Bacteria | 2652 |
| 165 | Ga0207678_10201664 | 3300026067 | Bacteria | 1701 |
| 166 | Ga0207702_10325683 | 3300026078 | Bacteria | 1464 |
| 167 | Ga0207702_10962770 | 3300026078 | Unclassified | 846 |
| 168 | Ga0207702_11238975 | 3300026078 | Bacteria | 740 |
| 169 | Ga0207641_12118935 | 3300026088 | Bacteria | 563 |
| 170 | Ga0207648_10266981 | 3300026089 | Bacteria | 1528 |
| 171 | Ga0207674_10073705 | 3300026116 | Bacteria | 3427 |
| 172 | Ga0207675_100872184 | 3300026118 | Bacteria | 915 |
| 173 | Ga0207683_10013541 | 3300026121 | Bacteria | 6959 |
| 174 | Ga0207428_10597044 | 3300027907 | Bacteria | 796 |
| 175 | Ga0268266_10035191 | 3300028379 | Bacteria | 4260 |
| 176 | Ga0268266_10214817 | 3300028379 | Bacteria | 1765 |
| 177 | Ga0268266_10318435 | 3300028379 | Bacteria | 1455 |
| 178 | Ga0268265_10285532 | 3300028380 | Bacteria | 1479 |
| 179 | Ga0268264_10772897 | 3300028381 | Bacteria | 958 |
| 180 | Ga0268264_11350849 | 3300028381 | Bacteria | 723 |
| 181 | Ga0265334_10003250 | 3300028573 | Bacteria | 7418 |
| 182 | Ga0265340_10012237 | 3300031247 | Bacteria | 4534 |
| 183 | Ga0307513_10037882 | 3300031456 | Bacteria | 5361 |
| 184 | Ga0373936_0015383 | 3300035113 | Bacteria | 2933 |
| 185 | Ga0373939_0018613 | 3300035114 | Bacteria | 1864 |
| 186 | Ga0373960_0111342 | 3300035121 | Bacteria | 899 |
| 187 | Ga0373943_0323985 | 3300035170 | Bacteria | 879 |
| 188 | Ga0373942_0112015 | 3300035207 | Bacteria | 845 |
| 189 | Ga0373931_0114934 | 3300035691 | Bacteria | 1531 |
| 190 | Ga0373931_0241506 | 3300035691 | Bacteria | 1095 |
| 191 | Ga0373931_0267543 | 3300035691 | Bacteria | 1045 |
| 192 | Ga0373935_0950156 | 3300035692 | Bacteria | 638 |
| 193 | Ga0373927_0432914 | 3300035695 | Bacteria | 868 |
| 194 | Ga0373937_0685154 | 3300036401 | Bacteria | 971 |
| 195 | Ga0373925_1269582 | 3300037068 | Bacteria | 604 |
| 196 | Ga0395899_0009033 | 3300037312 | Bacteria | 7660 |
| 197 | Ga0395899_0121221 | 3300037312 | Bacteria | 1873 |
| 198 | Ga0395900_0001350 | 3300037418 | Bacteria | 29640 |
| 199 | Ga0395900_0045645 | 3300037418 | Bacteria | 4513 |
| 200 | Ga0395900_0405001 | 3300037418 | Bacteria | 1327 |
| 201 | Ga0395898_0029321 | 3300037466 | Bacteria | 5514 |
| 202 | Ga0395898_0265353 | 3300037466 | Bacteria | 1637 |
| 203 | Ga0395905_0003532 | 3300037471 | Bacteria | 16666 |
| 204 | Ga0395905_0161919 | 3300037471 | Bacteria | 2103 |
| 205 | Ga0395905_0351338 | 3300037471 | Bacteria | 1366 |
| 206 | Ga0395905_0367892 | 3300037471 | Bacteria | 1331 |
| 207 | Ga0395905_0998986 | 3300037471 | Bacteria | 740 |
| 208 | Ga0395901_0006638 | 3300038443 | Bacteria | 11691 |
| 209 | Ga0395901_0008112 | 3300038443 | Bacteria | 10605 |
| 210 | Ga0395901_0014435 | 3300038443 | Bacteria | 8038 |
| 211 | Ga0395901_0150459 | 3300038443 | Bacteria | 2446 |
| 212 | Ga0395901_0572247 | 3300038443 | Bacteria | 1142 |
| 213 | Ga0436365_0296096 | 3300039437 | Bacteria | 2876 |
| 214 | Ga0436360_0556698 | 3300039438 | Bacteria | 5831 |
| 215 | Ga0436361_0603476 | 3300039447 | Bacteria | 7241 |
| 216 | Ga0436363_0759156 | 3300039450 | Bacteria | 3134 |
| 217 | Ga0436363_1716462 | 3300039450 | Bacteria | 599 |
| 218 | Ga0439447_064844 | 3300041407 | Bacteria | 855 |
| 219 | Ga0451787_242462 | 3300041441 | Bacteria | 613 |
| 220 | Ga0451789_0651673 | 3300041443 | Bacteria | 1217 |
| 221 | Ga0451793_0051564 | 3300041452 | Bacteria | 1653 |
| 222 | Ga0451839_0317516 | 3300041496 | Bacteria | 705 |
| 223 | Ga0451855_1417582 | 3300041511 | Bacteria | 799 |
| 224 | Ga0451853_1625668 | 3300041512 | Bacteria | 1200 |
| 225 | Ga0466967_0020928 | 3300045976 | Bacteria | 5299 |
| 226 | Ga0495592_0195716 | 3300046454 | Bacteria | 1367 |
| 227 | Ga0495629_0230874 | 3300046459 | Bacteria | 1275 |
| 228 | Ga0495651_0008047 | 3300046462 | Bacteria | 8083 |
| 229 | Ga0495651_0233100 | 3300046462 | Bacteria | 1267 |
| 230 | Ga0495653_0638479 | 3300046463 | Bacteria | 651 |
| 231 | Ga0495605_0163305 | 3300046474 | Bacteria | 988 |
| 232 | Ga0495605_0183817 | 3300046474 | Bacteria | 918 |
| 233 | Ga0495664_0015315 | 3300046477 | Bacteria | 4357 |
| 234 | Ga0495664_0086875 | 3300046477 | Bacteria | 1879 |
| 235 | Ga0495664_0573337 | 3300046477 | Bacteria | 672 |
| 236 | Ga0495584_0193670 | 3300046491 | Bacteria | 1033 |
| 237 | Ga0495584_0648246 | 3300046491 | Bacteria | 538 |
| 238 | Ga0495607_0222291 | 3300046501 | Bacteria | 923 |
| 239 | Ga0495583_0069993 | 3300046506 | Bacteria | 1544 |
| 240 | Ga0495606_0067588 | 3300046507 | Bacteria | 2262 |
| 241 | Ga0495606_0087674 | 3300046507 | Bacteria | 1920 |
| 242 | Ga0495608_0536702 | 3300046511 | Bacteria | 706 |
| 243 | Ga0495616_0053540 | 3300046513 | Bacteria | 2005 |
| 244 | Ga0495618_0624477 | 3300046514 | Bacteria | 639 |
| 245 | Ga0495628_0046301 | 3300046516 | Bacteria | 3455 |
| 246 | Ga0495648_0007591 | 3300046524 | Bacteria | 8661 |
| 247 | Ga0495648_0129425 | 3300046524 | Bacteria | 1344 |
| 248 | Ga0495652_0026606 | 3300046529 | Bacteria | 5107 |
| 249 | Ga0495652_0079832 | 3300046529 | Bacteria | 2704 |
| 250 | Ga0495652_0572179 | 3300046529 | Bacteria | 774 |
| 251 | Ga0495665_0150749 | 3300046531 | Bacteria | 1214 |
| 252 | Ga0495640_0053549 | 3300046533 | Bacteria | 2766 |
| 253 | Ga0495640_0384373 | 3300046533 | Bacteria | 863 |
| 254 | Ga0495587_0020838 | 3300046536 | Bacteria | 4044 |
| 255 | Ga0495622_0007520 | 3300046557 | Bacteria | 5054 |
| 256 | Ga0495622_0030278 | 3300046557 | Bacteria | 2529 |
| 257 | Ga0495667_0027440 | 3300046559 | Bacteria | 3837 |
| 258 | Ga0495656_0160783 | 3300046615 | Bacteria | 1091 |
| 259 | Ga0495668_0064460 | 3300046616 | Bacteria | 2017 |
| 260 | Ga0495668_0387120 | 3300046616 | Bacteria | 768 |
| 261 | Ga0495668_0599198 | 3300046616 | Bacteria | 609 |
| 262 | Ga0495634_0022629 | 3300046642 | Bacteria | 4427 |
| 263 | Ga0495625_0333583 | 3300046660 | Bacteria | 963 |
| 264 | Ga0495635_0008534 | 3300046663 | Bacteria | 7156 |
| 265 | Ga0495635_0110288 | 3300046663 | Bacteria | 1879 |
| 266 | Ga0495659_0313178 | 3300046664 | Bacteria | 665 |
| 267 | Ga0495661_0216643 | 3300046665 | Bacteria | 994 |
| 268 | Ga0495588_0079618 | 3300046674 | Bacteria | 1710 |
| 269 | Ga0495599_0292091 | 3300046678 | Bacteria | 985 |
| 270 | Ga0495599_0722658 | 3300046678 | Bacteria | 573 |
| 271 | Ga0495623_0003900 | 3300046679 | Bacteria | 9836 |
| 272 | Ga0495646_0050416 | 3300046680 | Bacteria | 2523 |
| 273 | Ga0495646_0243834 | 3300046680 | Bacteria | 965 |
| 274 | Ga0495647_0130167 | 3300046681 | Bacteria | 1066 |
| 275 | Ga0495613_0066962 | 3300046689 | Bacteria | 2621 |
| 276 | Ga0495624_0067530 | 3300046690 | Bacteria | 2230 |
| 277 | Ga0495671_0015307 | 3300046692 | Bacteria | 4113 |
| 278 | Ga0495649_0109077 | 3300046694 | Bacteria | 1468 |
| 279 | Ga0495649_0654016 | 3300046694 | Bacteria | 517 |
| 280 | Ga0495589_0124536 | 3300046794 | Bacteria | 1240 |
| 281 | Ga0495600_0038537 | 3300046809 | Bacteria | 3110 |
| 282 | Ga0495660_0208416 | 3300046810 | Bacteria | 929 |
| 283 | Ga0495581_0077806 | 3300047315 | Bacteria | 1920 |
| 284 | Ga0495604_0016427 | 3300047317 | Bacteria | 5916 |
| 285 | Ga0495604_0021055 | 3300047317 | Bacteria | 5203 |
| 286 | Ga0495604_0240720 | 3300047317 | Bacteria | 1237 |
| 287 | Ga0495636_0187048 | 3300047318 | Bacteria | 942 |
| 288 | Ga0495674_0166415 | 3300047319 | Bacteria | 1842 |
| 289 | Ga0495674_0185262 | 3300047319 | Bacteria | 1732 |
| 290 | Ga0495674_1448394 | 3300047319 | Bacteria | 510 |
| 291 | Ga0495676_0047026 | 3300047321 | Bacteria | 3494 |
| 292 | Ga0495676_1056225 | 3300047321 | Bacteria | 517 |
| 293 | Ga0495675_0002868 | 3300047444 | Bacteria | 10339 |
| 294 | Ga0495677_0201950 | 3300047445 | Bacteria | 773 |
| 295 | Ga0495685_072604 | 3300047447 | Bacteria | 1151 |
| 296 | Ga0495684_0406505 | 3300047471 | Bacteria | 954 |
| 297 | Ga0495684_0474483 | 3300047471 | Bacteria | 865 |
| 298 | Ga0495686_0207557 | 3300047472 | Bacteria | 1121 |
| 299 | Ga0495593_0077057 | 3300047673 | Bacteria | 1727 |
| 300 | Ga0495593_0269918 | 3300047673 | Bacteria | 851 |
| 301 | Ga0495602_0006250 | 3300048088 | Bacteria | 12494 |
| 302 | Ga0495602_0065373 | 3300048088 | Bacteria | 3139 |
| 303 | Ga0496101_0533869 | 3300048904 | Bacteria | 927 |
| 304 | Ga0496102_0163600 | 3300048905 | Bacteria | 2093 |
| 305 | Ga0496104_0005317 | 3300048907 | Bacteria | 11262 |
| 306 | Ga0496104_0264481 | 3300048907 | Bacteria | 1632 |
| 307 | Ga0496104_0718501 | 3300048907 | Bacteria | 907 |
| 308 | Ga0496105_0008712 | 3300048908 | Bacteria | 7893 |
| 309 | Ga0496105_0357564 | 3300048908 | Bacteria | 1165 |
| 310 | Ga0496105_0567770 | 3300048908 | Bacteria | 884 |
| 311 | Ga0496106_0122703 | 3300048909 | Bacteria | 2032 |
| 312 | Ga0496108_0924164 | 3300048911 | Bacteria | 748 |
| 313 | Ga0496109_0280152 | 3300048912 | Bacteria | 1571 |
| 314 | Ga0496110_1352616 | 3300048913 | Bacteria | 621 |
| 315 | Ga0496111_0081497 | 3300048914 | Bacteria | 2362 |
| 316 | Ga0496112_0075249 | 3300048915 | Bacteria | 3339 |
| 317 | Ga0496112_0307551 | 3300048915 | Bacteria | 1530 |
| 318 | Ga0496113_0022521 | 3300048916 | Bacteria | 4458 |
| 319 | Ga0496113_0058728 | 3300048916 | Bacteria | 2895 |
| 320 | Ga0496114_0070345 | 3300048917 | Bacteria | 2939 |
| 321 | Ga0496114_0296409 | 3300048917 | Bacteria | 1427 |
| 322 | Ga0496115_0219527 | 3300048918 | Bacteria | 1569 |
| 323 | Ga0496115_0451303 | 3300048918 | Bacteria | 1038 |
| 324 | Ga0496116_0115080 | 3300048919 | Bacteria | 1570 |
| 325 | Ga0496117_0260714 | 3300048920 | Bacteria | 940 |
| 326 | Ga0496118_0136851 | 3300048921 | Bacteria | 1561 |
| 327 | Ga0496118_0312475 | 3300048921 | Bacteria | 857 |
| 328 | Ga0496119_0014481 | 3300048922 | Bacteria | 6168 |
| 329 | Ga0496120_0008272 | 3300048923 | Bacteria | 7592 |
| 330 | Ga0496121_0360062 | 3300048924 | Bacteria | 966 |
| 331 | Ga0496121_0396984 | 3300048924 | Bacteria | 904 |
| 332 | Ga0496126_0059143 | 3300048929 | Bacteria | 3452 |
| 333 | Ga0496126_0085867 | 3300048929 | Bacteria | 2774 |
| 334 | Ga0496126_0112120 | 3300048929 | Bacteria | 2375 |
| 335 | Ga0496126_0297636 | 3300048929 | Bacteria | 1332 |
| 336 | Ga0496126_0516056 | 3300048929 | Bacteria | 953 |
| 337 | Ga0496126_0618248 | 3300048929 | Bacteria | 851 |
| 338 | Ga0495682_0017444 | 3300049460 | Bacteria | 2709 |
| 339 | Ga0501034_0000663 | 3300049571 | Bacteria | 52410 |
| 340 | Ga0501034_0002763 | 3300049571 | Bacteria | 20594 |
| 341 | Ga0501043_0905724 | 3300049579 | Unclassified | 632 |
| 342 | Ga0501047_0217546 | 3300049581 | Bacteria | 1767 |
| 343 | Ga0501068_0402493 | 3300049584 | Bacteria | 883 |
| 344 | Ga0501072_0148521 | 3300049588 | Bacteria | 1869 |
| 345 | Ga0501072_1249641 | 3300049588 | Bacteria | 576 |
| 346 | Ga0501074_0338734 | 3300049590 | Bacteria | 1068 |
| 347 | nmdc:mga03683_426860_c1 | 3300050489 | Bacteria | 635 |
| 348 | nmdc:mga03683_566761_c1 | 3300050489 | Bacteria | 554 |
| 349 | nmdc:mga00v17_560377_c1 | 3300050491 | Bacteria | 738 |
| 350 | nmdc:mga0yw44_1147092_c1 | 3300050492 | Bacteria | 525 |
| 351 | nmdc:mga0yw44_36677_c1 | 3300050492 | Bacteria | 2890 |
| 352 | nmdc:mga0k408_182657_c1 | 3300050493 | Bacteria | 1251 |
| 353 | nmdc:mga06z11_124099_c1 | 3300050494 | Bacteria | 1443 |
| 354 | nmdc:mga06z11_433666_c1 | 3300050494 | Bacteria | 793 |
| 355 | nmdc:mga07m45_360689_c1 | 3300050496 | Bacteria | 844 |
| 356 | nmdc:mga07m45_375105_c1 | 3300050496 | Bacteria | 826 |
| 357 | nmdc:mga0qj67_1272946_c1 | 3300050509 | Bacteria | 570 |
| 358 | nmdc:mga08x19_1323_c1 | 3300050514 | Bacteria | 15368 |
| 359 | nmdc:mga0sz30_30277_c1 | 3300050516 | Bacteria | 2236 |
| 360 | Ga0500635_0189461 | 3300053080 | Bacteria | 797 |
| 361 | Ga0495619_0053857 | 3300053085 | Bacteria | 2662 |
| 362 | Ga0495619_0489933 | 3300053085 | Bacteria | 846 |
| 363 | Ga0500578_0038187 | 3300053086 | Bacteria | 3085 |
| 364 | Ga0500578_0060200 | 3300053086 | Bacteria | 2426 |
| 365 | Ga0500644_0099855 | 3300053088 | Bacteria | 1101 |
| 366 | Ga0500647_0031022 | 3300053091 | Bacteria | 2541 |
| 367 | Ga0500566_0001036 | 3300053094 | Bacteria | 16076 |
| 368 | Ga0500566_0058910 | 3300053094 | Bacteria | 2179 |
| 369 | Ga0500566_0266563 | 3300053094 | Bacteria | 824 |
| 370 | Ga0500557_000113 | 3300053105 | Bacteria | 22739 |
| 371 | Ga0500572_015020 | 3300053111 | Bacteria | 1945 |
| 372 | Ga0500595_030924 | 3300053119 | Bacteria | 1799 |
| 373 | Ga0500595_125441 | 3300053119 | Bacteria | 724 |
| 374 | Ga0500607_128499 | 3300053121 | Bacteria | 1212 |
| 375 | Ga0500608_228945 | 3300053122 | Bacteria | 743 |
| 376 | Ga0500614_019819 | 3300053123 | Bacteria | 1545 |
| 377 | Ga0500642_0000056 | 3300053130 | Bacteria | 67746 |
| 378 | Ga0500652_119262 | 3300053131 | Bacteria | 1103 |
| 379 | Ga0500559_0127453 | 3300053136 | Bacteria | 1187 |
| 380 | Ga0500559_0381043 | 3300053136 | Bacteria | 657 |
| 381 | Ga0500585_270576 | 3300053144 | Bacteria | 529 |
| 382 | Ga0500590_130673 | 3300053148 | Bacteria | 1162 |
| 383 | Ga0500590_161864 | 3300053148 | Bacteria | 996 |
| 384 | Ga0500619_247555 | 3300053154 | Bacteria | 587 |
| 385 | Ga0500620_172761 | 3300053155 | Bacteria | 746 |
| 386 | Ga0500638_206402 | 3300053162 | Bacteria | 826 |
| 387 | Ga0500636_0002161 | 3300053177 | Bacteria | 10852 |
| 388 | Ga0500636_0374347 | 3300053177 | Bacteria | 670 |
| 389 | Ga0500625_000216 | 3300053729 | Bacteria | 13088 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046529 | Ga0495652_0572179 | Ga0495652_0572179_155_598 | 147 |
| 2 | 3300046681 | Ga0495647_0130167 | Ga0495647_0130167_356_799 | 147 |
| 3 | 3300047319 | Ga0495674_0166415 | Ga0495674_0166415_1268_1711 | 147 |
| 4 | 3300053085 | Ga0495619_0053857 | Ga0495619_0053857_566_1009 | 147 |
| 5 | 3300009174 | Ga0105241_10109113 | Ga0105241_101091131 | 148 |
| 6 | 3300009177 | Ga0105248_10208966 | Ga0105248_102089662 | 150 |
| 7 | 3300009545 | Ga0105237_10540997 | Ga0105237_105409972 | 150 |
| 8 | 3300026078 | Ga0207702_11238975 | Ga0207702_112389752 | 150 |
| 9 | 3300035692 | Ga0373935_0950156 | Ga0373935_0950156_19_474 | 150 |
| 10 | 3300039437 | Ga0436365_0296096 | Ga0436365_0296096_1242_1697 | 150 |
| 11 | 3300039450 | Ga0436363_0759156 | Ga0436363_0759156_1334_1789 | 150 |
| 12 | 3300046462 | Ga0495651_0233100 | Ga0495651_0233100_774_1229 | 150 |
| 13 | 3300046477 | Ga0495664_0573337 | Ga0495664_0573337_203_658 | 150 |
| 14 | 3300046615 | Ga0495656_0160783 | Ga0495656_0160783_264_719 | 150 |
| 15 | 3300046694 | Ga0495649_0654016 | Ga0495649_0654016_29_481 | 150 |
| 16 | 3300047319 | Ga0495674_1448394 | Ga0495674_1448394_14_466 | 150 |
| 17 | 3300047321 | Ga0495676_1056225 | Ga0495676_1056225_54_506 | 150 |
| 18 | 3300047445 | Ga0495677_0201950 | Ga0495677_0201950_25_480 | 150 |
| 19 | 3300048929 | Ga0496126_0297636 | Ga0496126_0297636_869_1321 | 150 |
| 20 | 3300050496 | nmdc:mga07m45_360689_c1 | nmdc:mga07m45_360689_c1_339_791 | 150 |
| 21 | 3300050514 | nmdc:mga08x19_1323_c1 | nmdc:mga08x19_1323_c1_13048_13506 | 150 |
| 22 | 3300053119 | Ga0500595_125441 | Ga0500595_125441_17_469 | 150 |
| 23 | iso_pu_bacteria | 2508501009 | 2508539085 | 150 |
| 24 | iso_pu_bacteria | 2935777560 | 2935782203 | 150 |
| 25 | iso_pu_bacteria | 8016603502 | 8016606658 | 150 |
| 26 | iso_pu_bacteria | 8016613128 | 8016618554 | 150 |
| 27 | iso_pu_bacteria | 8019538911 | 8019540642 | 150 |
| 28 | iso_pu_bacteria | 2508501042 | 2508695446 | 151 |
| 29 | iso_pu_bacteria | 2511231028 | 2511400862 | 151 |
| 30 | iso_pu_bacteria | 2513237098 | 2513674658 | 151 |
| 31 | iso_pu_bacteria | 2513237137 | 2513860495 | 151 |
| 32 | iso_pu_bacteria | 2515154112 | 2515625582 | 151 |
| 33 | iso_pu_bacteria | 2517093001 | 2517107102 | 151 |
| 34 | iso_pu_bacteria | 2524023205 | 2524436005 | 151 |
| 35 | iso_pu_bacteria | 2524023210 | 2524467775 | 151 |
| 36 | iso_pu_bacteria | 2528768022 | 2528851276 | 151 |
| 37 | iso_pu_bacteria | 2744054633 | 2745081602 | 151 |
| 38 | iso_pu_bacteria | 2791355196 | 2793064869 | 151 |
| 39 | iso_pu_bacteria | 2824661429 | 2824663830 | 151 |
| 40 | iso_pu_bacteria | 2824704595 | 2824709954 | 151 |
| 41 | iso_pu_bacteria | 2824753945 | 2824757706 | 151 |
| 42 | iso_pu_bacteria | 2824763712 | 2824768782 | 151 |
| 43 | iso_pu_bacteria | 2874590934 | 2874597151 | 151 |
| 44 | iso_pu_bacteria | 2874645413 | 2874646957 | 151 |
| 45 | iso_pu_bacteria | 2876771140 | 2876777615 | 151 |
| 46 | iso_pu_bacteria | 2876818435 | 2876825697 | 151 |
| 47 | iso_pu_bacteria | 2879074833 | 2879076176 | 151 |
| 48 | iso_pu_bacteria | 2879099564 | 2879108636 | 151 |
| 49 | iso_pu_bacteria | 2879127579 | 2879130983 | 151 |
| 50 | iso_pu_bacteria | 2879142872 | 2879148782 | 151 |
| 51 | iso_pu_bacteria | 2885409591 | 2885413947 | 151 |
| 52 | iso_pu_bacteria | 2888388044 | 2888390757 | 151 |
| 53 | iso_pu_bacteria | 2903768456 | 2903775693 | 151 |
| 54 | iso_pu_bacteria | 2904711408 | 2904713092 | 151 |
| 55 | iso_pu_bacteria | 2922368715 | 2922378704 | 151 |
| 56 | iso_pu_bacteria | 2929615660 | 2929618515 | 151 |
| 57 | iso_pu_bacteria | 2929624759 | 2929628800 | 151 |
| 58 | iso_pu_bacteria | 2932784394 | 2932786703 | 151 |
| 59 | iso_pu_bacteria | 2932794094 | 2932794399 | 151 |
| 60 | iso_pu_bacteria | 2932801729 | 2932806683 | 151 |
| 61 | iso_pu_bacteria | 2932809354 | 2932812253 | 151 |
| 62 | iso_pu_bacteria | 2932818245 | 2932823244 | 151 |
| 63 | iso_pu_bacteria | 2932828146 | 2932829916 | 151 |
| 64 | iso_pu_bacteria | 2933577622 | 2933580773 | 151 |
| 65 | iso_pu_bacteria | 2935616580 | 2935618434 | 151 |
| 66 | iso_pu_bacteria | 2935638405 | 2935641168 | 151 |
| 67 | iso_pu_bacteria | 2935648319 | 2935653685 | 151 |
| 68 | iso_pu_bacteria | 2935656913 | 2935662434 | 151 |
| 69 | iso_pu_bacteria | 2935665750 | 2935670084 | 151 |
| 70 | iso_pu_bacteria | 2935675223 | 2935679063 | 151 |
| 71 | iso_pu_bacteria | 2935684952 | 2935689937 | 151 |
| 72 | iso_pu_bacteria | 2935694250 | 2935698458 | 151 |
| 73 | iso_pu_bacteria | 2935703347 | 2935707600 | 151 |
| 74 | iso_pu_bacteria | 2935713505 | 2935717456 | 151 |
| 75 | iso_pu_bacteria | 2935722832 | 2935723874 | 151 |
| 76 | iso_pu_bacteria | 2935732158 | 2935740083 | 151 |
| 77 | iso_pu_bacteria | 2935741537 | 2935749346 | 151 |
| 78 | iso_pu_bacteria | 2935750917 | 2935757291 | 151 |
| 79 | iso_pu_bacteria | 2935760218 | 2935763623 | 151 |
| 80 | iso_pu_bacteria | 2935769743 | 2935773338 | 151 |
| 81 | iso_pu_bacteria | 2935785616 | 2935789164 | 151 |
| 82 | iso_pu_bacteria | 2935793552 | 2935797101 | 151 |
| 83 | iso_pu_bacteria | 2935801545 | 2935804012 | 151 |
| 84 | iso_pu_bacteria | 2935810662 | 2935815106 | 151 |
| 85 | iso_pu_bacteria | 2935827899 | 2935830899 | 151 |
| 86 | iso_pu_bacteria | 2935837841 | 2935841509 | 151 |
| 87 | iso_pu_bacteria | 2935855204 | 2935862471 | 151 |
| 88 | iso_pu_bacteria | 2935864058 | 2935866601 | 151 |
| 89 | iso_pu_bacteria | 2935873716 | 2935874908 | 151 |
| 90 | iso_pu_bacteria | 2935883170 | 2935888454 | 151 |
| 91 | iso_pu_bacteria | 2935975950 | 2935977621 | 151 |
| 92 | iso_pu_bacteria | 2935984226 | 2935985104 | 151 |
| 93 | iso_pu_bacteria | 2935992306 | 2935994414 | 151 |
| 94 | iso_pu_bacteria | 2936002035 | 2936004608 | 151 |
| 95 | iso_pu_bacteria | 2936011229 | 2936016736 | 151 |
| 96 | iso_pu_bacteria | 2936019824 | 2936025369 | 151 |
| 97 | iso_pu_bacteria | 2936028420 | 2936034211 | 151 |
| 98 | iso_pu_bacteria | 2936037263 | 2936043173 | 151 |
| 99 | iso_pu_bacteria | 2936046547 | 2936052268 | 151 |
| 100 | iso_pu_bacteria | 2936055302 | 2936056273 | 151 |
| 101 | iso_pu_bacteria | 2940556831 | 2940563204 | 151 |
| 102 | iso_pu_bacteria | 2941531003 | 2941535592 | 151 |
| 103 | iso_pu_bacteria | 2941538514 | 2941543121 | 151 |
| 104 | iso_pu_bacteria | 3005587118 | 3005593153 | 151 |
| 105 | iso_pu_bacteria | 3005594810 | 3005594941 | 151 |
| 106 | iso_pu_bacteria | 3005710791 | 3005710918 | 151 |
| 107 | iso_pu_bacteria | 8016511872 | 8016518276 | 151 |
| 108 | iso_pu_bacteria | 8016522445 | 8016526052 | 151 |
| 109 | iso_pu_bacteria | 8016530956 | 8016539660 | 151 |
| 110 | iso_pu_bacteria | 8016539877 | 8016543961 | 151 |
| 111 | iso_pu_bacteria | 8016548790 | 8016549343 | 151 |
| 112 | iso_pu_bacteria | 8016557553 | 8016557770 | 151 |
| 113 | iso_pu_bacteria | 8016566248 | 8016569362 | 151 |
| 114 | iso_pu_bacteria | 8016575299 | 8016581984 | 151 |
| 115 | iso_pu_bacteria | 8016595262 | 8016595795 | 151 |
| 116 | iso_pu_bacteria | 8016622563 | 8016623287 | 151 |
| 117 | iso_pu_bacteria | 8016630954 | 8016635716 | 151 |
| 118 | iso_pu_bacteria | 8017057580 | 8017058377 | 151 |
| 119 | iso_pu_bacteria | 8019530166 | 8019530938 | 151 |
| 120 | iso_pu_bacteria | 8019547302 | 8019550306 | 151 |
| 121 | iso_pu_bacteria | 8019619141 | 8019622884 | 151 |
| 122 | iso_pu_bacteria | 8019629233 | 8019630226 | 151 |
| 123 | iso_pu_bacteria | 8019659431 | 8019667058 | 151 |
| 124 | iso_pu_bacteria | 8019668869 | 8019676847 | 151 |
| 125 | iso_pu_bacteria | 8055742211 | 8055742365 | 151 |
| 126 | iso_pu_bacteria | 2824679649 | 2824682681 | 152 |
| 127 | iso_pu_bacteria | 2874628541 | 2874628889 | 152 |
| 128 | iso_pu_bacteria | 2922393267 | 2922398927 | 152 |
| 129 | iso_pu_bacteria | 8019648815 | 8019652567 | 152 |
| 130 | 3300013105 | Ga0157369_11718432 | Ga0157369_117184321 | 154 |
| 131 | 3300028381 | Ga0268264_10772897 | Ga0268264_107728971 | 154 |
| 132 | 3300046477 | Ga0495664_0086875 | Ga0495664_0086875_337_801 | 154 |
| 133 | 3300046513 | Ga0495616_0053540 | Ga0495616_0053540_77_541 | 154 |
| 134 | 3300047317 | Ga0495604_0240720 | Ga0495604_0240720_495_959 | 154 |
| 135 | 3300003354 | JGI25160J50197_1016063 | JGI25160J50197_10160633 | 155 |
| 136 | 3300005262 | Ga0065165_1044635 | Ga0065165_10446351 | 155 |
| 137 | 3300005327 | Ga0070658_10644524 | Ga0070658_106445242 | 155 |
| 138 | 3300005328 | Ga0070676_11068179 | Ga0070676_110681791 | 155 |
| 139 | 3300005329 | Ga0070683_100015277 | Ga0070683_1000152775 | 155 |
| 140 | 3300005331 | Ga0070670_102029085 | Ga0070670_1020290851 | 155 |
| 141 | 3300005334 | Ga0068869_100786664 | Ga0068869_1007866642 | 155 |
| 142 | 3300005336 | Ga0070680_100093595 | Ga0070680_1000935953 | 155 |
| 143 | 3300005336 | Ga0070680_100922329 | Ga0070680_1009223291 | 155 |
| 144 | 3300005336 | Ga0070680_101109936 | Ga0070680_1011099362 | 155 |
| 145 | 3300005337 | Ga0070682_100026381 | Ga0070682_1000263812 | 155 |
| 146 | 3300005337 | Ga0070682_100113038 | Ga0070682_1001130382 | 155 |
| 147 | 3300005338 | Ga0068868_101064024 | Ga0068868_1010640241 | 155 |
| 148 | 3300005338 | Ga0068868_101185142 | Ga0068868_1011851421 | 155 |
| 149 | 3300005343 | Ga0070687_100695425 | Ga0070687_1006954251 | 155 |
| 150 | 3300005344 | Ga0070661_100165801 | Ga0070661_1001658012 | 155 |
| 151 | 3300005354 | Ga0070675_101183243 | Ga0070675_1011832431 | 155 |
| 152 | 3300005355 | Ga0070671_100721331 | Ga0070671_1007213312 | 155 |
| 153 | 3300005364 | Ga0070673_100694647 | Ga0070673_1006946472 | 155 |
| 154 | 3300005436 | Ga0070713_100756320 | Ga0070713_1007563201 | 155 |
| 155 | 3300005445 | Ga0070708_100102378 | Ga0070708_1001023783 | 155 |
| 156 | 3300005456 | Ga0070678_100016811 | Ga0070678_1000168118 | 155 |
| 157 | 3300005456 | Ga0070678_101875862 | Ga0070678_1018758621 | 155 |
| 158 | 3300005458 | Ga0070681_10012145 | Ga0070681_100121458 | 155 |
| 159 | 3300005458 | Ga0070681_10258669 | Ga0070681_102586693 | 155 |
| 160 | 3300005458 | Ga0070681_10322347 | Ga0070681_103223472 | 155 |
| 161 | 3300005467 | Ga0070706_100310566 | Ga0070706_1003105662 | 155 |
| 162 | 3300005471 | Ga0070698_100830042 | Ga0070698_1008300422 | 155 |
| 163 | 3300005518 | Ga0070699_100409643 | Ga0070699_1004096431 | 155 |
| 164 | 3300005530 | Ga0070679_100030356 | Ga0070679_1000303562 | 155 |
| 165 | 3300005535 | Ga0070684_100072138 | Ga0070684_1000721384 | 155 |
| 166 | 3300005536 | Ga0070697_100060057 | Ga0070697_1000600573 | 155 |
| 167 | 3300005539 | Ga0068853_100068121 | Ga0068853_1000681213 | 155 |
| 168 | 3300005539 | Ga0068853_100094100 | Ga0068853_1000941004 | 155 |
| 169 | 3300005547 | Ga0070693_101009681 | Ga0070693_1010096811 | 155 |
| 170 | 3300005548 | Ga0070665_100033886 | Ga0070665_1000338867 | 155 |
| 171 | 3300005548 | Ga0070665_100050153 | Ga0070665_1000501533 | 155 |
| 172 | 3300005549 | Ga0070704_100599894 | Ga0070704_1005998941 | 155 |
| 173 | 3300005563 | Ga0068855_100088206 | Ga0068855_1000882064 | 155 |
| 174 | 3300005563 | Ga0068855_101191090 | Ga0068855_1011910902 | 155 |
| 175 | 3300005564 | Ga0070664_100021866 | Ga0070664_1000218662 | 155 |
| 176 | 3300005614 | Ga0068856_100140571 | Ga0068856_1001405713 | 155 |
| 177 | 3300005614 | Ga0068856_100507118 | Ga0068856_1005071182 | 155 |
| 178 | 3300005614 | Ga0068856_101203907 | Ga0068856_1012039071 | 155 |
| 179 | 3300005616 | Ga0068852_100024177 | Ga0068852_1000241774 | 155 |
| 180 | 3300005616 | Ga0068852_100516385 | Ga0068852_1005163852 | 155 |
| 181 | 3300005617 | Ga0068859_100149351 | Ga0068859_1001493512 | 155 |
| 182 | 3300005617 | Ga0068859_100362051 | Ga0068859_1003620513 | 155 |
| 183 | 3300005618 | Ga0068864_100960957 | Ga0068864_1009609572 | 155 |
| 184 | 3300005842 | Ga0068858_101573254 | Ga0068858_1015732541 | 155 |
| 185 | 3300005843 | Ga0068860_100224889 | Ga0068860_1002248891 | 155 |
| 186 | 3300005844 | Ga0068862_101347585 | Ga0068862_1013475851 | 155 |
| 187 | 3300005844 | Ga0068862_101666537 | Ga0068862_1016665371 | 155 |
| 188 | 3300005937 | Ga0081455_10000165 | Ga0081455_1000016566 | 155 |
| 189 | 3300005937 | Ga0081455_10033257 | Ga0081455_100332573 | 155 |
| 190 | 3300005937 | Ga0081455_10058499 | Ga0081455_100584994 | 155 |
| 191 | 3300005983 | Ga0081540_1246509 | Ga0081540_12465091 | 155 |
| 192 | 3300005985 | Ga0081539_10084052 | Ga0081539_100840523 | 155 |
| 193 | 3300006028 | Ga0070717_10893199 | Ga0070717_108931991 | 155 |
| 194 | 3300006038 | Ga0075365_10020137 | Ga0075365_100201375 | 155 |
| 195 | 3300006038 | Ga0075365_10431562 | Ga0075365_104315621 | 155 |
| 196 | 3300006175 | Ga0070712_101300145 | Ga0070712_1013001451 | 155 |
| 197 | 3300006178 | Ga0075367_10250652 | Ga0075367_102506522 | 155 |
| 198 | 3300006195 | Ga0075366_10535482 | Ga0075366_105354821 | 155 |
| 199 | 3300006237 | Ga0097621_100294441 | Ga0097621_1002944411 | 155 |
| 200 | 3300006353 | Ga0075370_10186488 | Ga0075370_101864882 | 155 |
| 201 | 3300006353 | Ga0075370_10435065 | Ga0075370_104350652 | 155 |
| 202 | 3300006931 | Ga0097620_100149350 | Ga0097620_1001493502 | 155 |
| 203 | 3300006931 | Ga0097620_100362044 | Ga0097620_1003620443 | 155 |
| 204 | 3300007265 | Ga0099794_10020634 | Ga0099794_100206343 | 155 |
| 205 | 3300009093 | Ga0105240_10244910 | Ga0105240_102449103 | 155 |
| 206 | 3300009094 | Ga0111539_10739439 | Ga0111539_107394392 | 155 |
| 207 | 3300009094 | Ga0111539_12118668 | Ga0111539_121186682 | 155 |
| 208 | 3300009101 | Ga0105247_10243317 | Ga0105247_102433172 | 155 |
| 209 | 3300009177 | Ga0105248_10831268 | Ga0105248_108312682 | 155 |
| 210 | 3300009177 | Ga0105248_10959623 | Ga0105248_109596232 | 155 |
| 211 | 3300009551 | Ga0105238_10441049 | Ga0105238_104410492 | 155 |
| 212 | 3300009553 | Ga0105249_10061794 | Ga0105249_100617941 | 155 |
| 213 | 3300009553 | Ga0105249_11081298 | Ga0105249_110812982 | 155 |
| 214 | 3300010375 | Ga0105239_11015610 | Ga0105239_110156101 | 155 |
| 215 | 3300013104 | Ga0157370_10010808 | Ga0157370_1001080810 | 155 |
| 216 | 3300013306 | Ga0163162_10605122 | Ga0163162_106051221 | 155 |
| 217 | 3300013306 | Ga0163162_11432791 | Ga0163162_114327912 | 155 |
| 218 | 3300013308 | Ga0157375_12303677 | Ga0157375_123036772 | 155 |
| 219 | 3300014497 | Ga0182008_10565434 | Ga0182008_105654341 | 155 |
| 220 | 3300014968 | Ga0157379_10172963 | Ga0157379_101729631 | 155 |
| 221 | 3300015262 | Ga0182007_10236819 | Ga0182007_102368192 | 155 |
| 222 | 3300020082 | Ga0206353_10077123 | Ga0206353_100771231 | 155 |
| 223 | 3300021441 | Ga0213871_10005818 | Ga0213871_100058185 | 155 |
| 224 | 3300025253 | Ga0209677_101289 | Ga0209677_1012896 | 155 |
| 225 | 3300025297 | Ga0209758_1006424 | Ga0209758_10064242 | 155 |
| 226 | 3300025297 | Ga0209758_1019339 | Ga0209758_10193392 | 155 |
| 227 | 3300025302 | Ga0207426_1011734 | Ga0207426_10117343 | 155 |
| 228 | 3300025302 | Ga0207426_1021850 | Ga0207426_10218502 | 155 |
| 229 | 3300025302 | Ga0207426_1055766 | Ga0207426_10557662 | 155 |
| 230 | 3300025304 | Ga0209257_1040726 | Ga0209257_10407262 | 155 |
| 231 | 3300025900 | Ga0207710_10197174 | Ga0207710_101971742 | 155 |
| 232 | 3300025904 | Ga0207647_10124872 | Ga0207647_101248722 | 155 |
| 233 | 3300025904 | Ga0207647_10398942 | Ga0207647_103989421 | 155 |
| 234 | 3300025907 | Ga0207645_10419753 | Ga0207645_104197532 | 155 |
| 235 | 3300025909 | Ga0207705_10795101 | Ga0207705_107951012 | 155 |
| 236 | 3300025910 | Ga0207684_10494629 | Ga0207684_104946292 | 155 |
| 237 | 3300025911 | Ga0207654_10068048 | Ga0207654_100680482 | 155 |
| 238 | 3300025911 | Ga0207654_10479673 | Ga0207654_104796732 | 155 |
| 239 | 3300025912 | Ga0207707_10000100 | Ga0207707_1000010076 | 155 |
| 240 | 3300025912 | Ga0207707_10653026 | Ga0207707_106530262 | 155 |
| 241 | 3300025913 | Ga0207695_10046470 | Ga0207695_100464707 | 155 |
| 242 | 3300025917 | Ga0207660_10168390 | Ga0207660_101683902 | 155 |
| 243 | 3300025918 | Ga0207662_10557783 | Ga0207662_105577832 | 155 |
| 244 | 3300025919 | Ga0207657_10404959 | Ga0207657_104049592 | 155 |
| 245 | 3300025920 | Ga0207649_10089196 | Ga0207649_100891962 | 155 |
| 246 | 3300025920 | Ga0207649_10395392 | Ga0207649_103953922 | 155 |
| 247 | 3300025921 | Ga0207652_11650171 | Ga0207652_116501711 | 155 |
| 248 | 3300025923 | Ga0207681_10166024 | Ga0207681_101660242 | 155 |
| 249 | 3300025924 | Ga0207694_10205995 | Ga0207694_102059951 | 155 |
| 250 | 3300025924 | Ga0207694_10574515 | Ga0207694_105745152 | 155 |
| 251 | 3300025926 | Ga0207659_10576244 | Ga0207659_105762442 | 155 |
| 252 | 3300025928 | Ga0207700_10029810 | Ga0207700_100298102 | 155 |
| 253 | 3300025931 | Ga0207644_10436196 | Ga0207644_104361962 | 155 |
| 254 | 3300025944 | Ga0207661_10254048 | Ga0207661_102540482 | 155 |
| 255 | 3300025945 | Ga0207679_10040119 | Ga0207679_100401194 | 155 |
| 256 | 3300025949 | Ga0207667_10204442 | Ga0207667_102044423 | 155 |
| 257 | 3300025949 | Ga0207667_10981575 | Ga0207667_109815751 | 155 |
| 258 | 3300025972 | Ga0207668_10970704 | Ga0207668_109707042 | 155 |
| 259 | 3300025981 | Ga0207640_10905192 | Ga0207640_109051921 | 155 |
| 260 | 3300026035 | Ga0207703_11049553 | Ga0207703_110495531 | 155 |
| 261 | 3300026041 | Ga0207639_10075381 | Ga0207639_100753811 | 155 |
| 262 | 3300026067 | Ga0207678_10201664 | Ga0207678_102016642 | 155 |
| 263 | 3300026078 | Ga0207702_10325683 | Ga0207702_103256832 | 155 |
| 264 | 3300026088 | Ga0207641_12118935 | Ga0207641_121189351 | 155 |
| 265 | 3300026089 | Ga0207648_10266981 | Ga0207648_102669812 | 155 |
| 266 | 3300026116 | Ga0207674_10073705 | Ga0207674_100737055 | 155 |
| 267 | 3300026118 | Ga0207675_100872184 | Ga0207675_1008721842 | 155 |
| 268 | 3300026121 | Ga0207683_10013541 | Ga0207683_100135416 | 155 |
| 269 | 3300027907 | Ga0207428_10597044 | Ga0207428_105970441 | 155 |
| 270 | 3300028379 | Ga0268266_10035191 | Ga0268266_100351916 | 155 |
| 271 | 3300028379 | Ga0268266_10214817 | Ga0268266_102148172 | 155 |
| 272 | 3300028379 | Ga0268266_10318435 | Ga0268266_103184352 | 155 |
| 273 | 3300028380 | Ga0268265_10285532 | Ga0268265_102855322 | 155 |
| 274 | 3300028381 | Ga0268264_11350849 | Ga0268264_113508491 | 155 |
| 275 | 3300028573 | Ga0265334_10003250 | Ga0265334_100032506 | 155 |
| 276 | 3300031247 | Ga0265340_10012237 | Ga0265340_100122373 | 155 |
| 277 | 3300031456 | Ga0307513_10037882 | Ga0307513_100378822 | 155 |
| 278 | 3300035113 | Ga0373936_0015383 | Ga0373936_0015383_2433_2900 | 155 |
| 279 | 3300035114 | Ga0373939_0018613 | Ga0373939_0018613_942_1409 | 155 |
| 280 | 3300035121 | Ga0373960_0111342 | Ga0373960_0111342_186_653 | 155 |
| 281 | 3300035207 | Ga0373942_0112015 | Ga0373942_0112015_25_492 | 155 |
| 282 | 3300035691 | Ga0373931_0114934 | Ga0373931_0114934_575_1042 | 155 |
| 283 | 3300035691 | Ga0373931_0241506 | Ga0373931_0241506_309_776 | 155 |
| 284 | 3300035691 | Ga0373931_0267543 | Ga0373931_0267543_236_706 | 155 |
| 285 | 3300035695 | Ga0373927_0432914 | Ga0373927_0432914_380_850 | 155 |
| 286 | 3300036401 | Ga0373937_0685154 | Ga0373937_0685154_434_901 | 155 |
| 287 | 3300037068 | Ga0373925_1269582 | Ga0373925_1269582_108_575 | 155 |
| 288 | 3300037418 | Ga0395900_0405001 | Ga0395900_0405001_178_648 | 155 |
| 289 | 3300037466 | Ga0395898_0265353 | Ga0395898_0265353_863_1333 | 155 |
| 290 | 3300037471 | Ga0395905_0161919 | Ga0395905_0161919_821_1288 | 155 |
| 291 | 3300037471 | Ga0395905_0351338 | Ga0395905_0351338_642_1112 | 155 |
| 292 | 3300037471 | Ga0395905_0367892 | Ga0395905_0367892_250_717 | 155 |
| 293 | 3300037471 | Ga0395905_0998986 | Ga0395905_0998986_130_600 | 155 |
| 294 | 3300038443 | Ga0395901_0006638 | Ga0395901_0006638_4134_4604 | 155 |
| 295 | 3300038443 | Ga0395901_0572247 | Ga0395901_0572247_381_851 | 155 |
| 296 | 3300039438 | Ga0436360_0556698 | Ga0436360_0556698_1673_2140 | 155 |
| 297 | 3300039447 | Ga0436361_0603476 | Ga0436361_0603476_2170_2637 | 155 |
| 298 | 3300039450 | Ga0436363_1716462 | Ga0436363_1716462_78_545 | 155 |
| 299 | 3300041407 | Ga0439447_064844 | Ga0439447_064844_23_490 | 155 |
| 300 | 3300041441 | Ga0451787_242462 | Ga0451787_242462_87_554 | 155 |
| 301 | 3300041443 | Ga0451789_0651673 | Ga0451789_0651673_316_813 | 155 |
| 302 | 3300041452 | Ga0451793_0051564 | Ga0451793_0051564_776_1243 | 155 |
| 303 | 3300041511 | Ga0451855_1417582 | Ga0451855_1417582_57_524 | 155 |
| 304 | 3300041512 | Ga0451853_1625668 | Ga0451853_1625668_583_1050 | 155 |
| 305 | 3300045976 | Ga0466967_0020928 | Ga0466967_0020928_3203_3670 | 155 |
| 306 | 3300046454 | Ga0495592_0195716 | Ga0495592_0195716_444_911 | 155 |
| 307 | 3300046459 | Ga0495629_0230874 | Ga0495629_0230874_528_995 | 155 |
| 308 | 3300046462 | Ga0495651_0008047 | Ga0495651_0008047_3511_3978 | 155 |
| 309 | 3300046463 | Ga0495653_0638479 | Ga0495653_0638479_63_530 | 155 |
| 310 | 3300046474 | Ga0495605_0163305 | Ga0495605_0163305_353_820 | 155 |
| 311 | 3300046474 | Ga0495605_0183817 | Ga0495605_0183817_62_529 | 155 |
| 312 | 3300046477 | Ga0495664_0015315 | Ga0495664_0015315_1817_2284 | 155 |
| 313 | 3300046491 | Ga0495584_0193670 | Ga0495584_0193670_251_721 | 155 |
| 314 | 3300046491 | Ga0495584_0648246 | Ga0495584_0648246_44_511 | 155 |
| 315 | 3300046501 | Ga0495607_0222291 | Ga0495607_0222291_205_675 | 155 |
| 316 | 3300046506 | Ga0495583_0069993 | Ga0495583_0069993_479_946 | 155 |
| 317 | 3300046507 | Ga0495606_0067588 | Ga0495606_0067588_292_759 | 155 |
| 318 | 3300046507 | Ga0495606_0087674 | Ga0495606_0087674_799_1269 | 155 |
| 319 | 3300046511 | Ga0495608_0536702 | Ga0495608_0536702_110_577 | 155 |
| 320 | 3300046514 | Ga0495618_0624477 | Ga0495618_0624477_149_616 | 155 |
| 321 | 3300046516 | Ga0495628_0046301 | Ga0495628_0046301_2005_2472 | 155 |
| 322 | 3300046524 | Ga0495648_0007591 | Ga0495648_0007591_6668_7135 | 155 |
| 323 | 3300046524 | Ga0495648_0129425 | Ga0495648_0129425_799_1266 | 155 |
| 324 | 3300046529 | Ga0495652_0026606 | Ga0495652_0026606_3281_3748 | 155 |
| 325 | 3300046529 | Ga0495652_0079832 | Ga0495652_0079832_1534_2001 | 155 |
| 326 | 3300046531 | Ga0495665_0150749 | Ga0495665_0150749_66_536 | 155 |
| 327 | 3300046533 | Ga0495640_0053549 | Ga0495640_0053549_1392_1859 | 155 |
| 328 | 3300046533 | Ga0495640_0384373 | Ga0495640_0384373_142_609 | 155 |
| 329 | 3300046536 | Ga0495587_0020838 | Ga0495587_0020838_3240_3707 | 155 |
| 330 | 3300046557 | Ga0495622_0007520 | Ga0495622_0007520_3510_3977 | 155 |
| 331 | 3300046557 | Ga0495622_0030278 | Ga0495622_0030278_1357_1827 | 155 |
| 332 | 3300046559 | Ga0495667_0027440 | Ga0495667_0027440_118_585 | 155 |
| 333 | 3300046616 | Ga0495668_0064460 | Ga0495668_0064460_506_973 | 155 |
| 334 | 3300046616 | Ga0495668_0387120 | Ga0495668_0387120_212_679 | 155 |
| 335 | 3300046616 | Ga0495668_0599198 | Ga0495668_0599198_94_561 | 155 |
| 336 | 3300046642 | Ga0495634_0022629 | Ga0495634_0022629_450_917 | 155 |
| 337 | 3300046660 | Ga0495625_0333583 | Ga0495625_0333583_244_714 | 155 |
| 338 | 3300046663 | Ga0495635_0008534 | Ga0495635_0008534_6285_6752 | 155 |
| 339 | 3300046663 | Ga0495635_0110288 | Ga0495635_0110288_428_895 | 155 |
| 340 | 3300046664 | Ga0495659_0313178 | Ga0495659_0313178_68_538 | 155 |
| 341 | 3300046665 | Ga0495661_0216643 | Ga0495661_0216643_328_795 | 155 |
| 342 | 3300046674 | Ga0495588_0079618 | Ga0495588_0079618_314_781 | 155 |
| 343 | 3300046678 | Ga0495599_0292091 | Ga0495599_0292091_118_585 | 155 |
| 344 | 3300046678 | Ga0495599_0722658 | Ga0495599_0722658_61_528 | 155 |
| 345 | 3300046679 | Ga0495623_0003900 | Ga0495623_0003900_3711_4178 | 155 |
| 346 | 3300046680 | Ga0495646_0050416 | Ga0495646_0050416_1155_1622 | 155 |
| 347 | 3300046680 | Ga0495646_0243834 | Ga0495646_0243834_447_917 | 155 |
| 348 | 3300046689 | Ga0495613_0066962 | Ga0495613_0066962_1626_2093 | 155 |
| 349 | 3300046690 | Ga0495624_0067530 | Ga0495624_0067530_1655_2125 | 155 |
| 350 | 3300046694 | Ga0495649_0109077 | Ga0495649_0109077_219_686 | 155 |
| 351 | 3300046809 | Ga0495600_0038537 | Ga0495600_0038537_148_615 | 155 |
| 352 | 3300047315 | Ga0495581_0077806 | Ga0495581_0077806_1138_1605 | 155 |
| 353 | 3300047317 | Ga0495604_0016427 | Ga0495604_0016427_5064_5531 | 155 |
| 354 | 3300047317 | Ga0495604_0021055 | Ga0495604_0021055_442_909 | 155 |
| 355 | 3300047318 | Ga0495636_0187048 | Ga0495636_0187048_69_536 | 155 |
| 356 | 3300047319 | Ga0495674_0185262 | Ga0495674_0185262_149_616 | 155 |
| 357 | 3300047321 | Ga0495676_0047026 | Ga0495676_0047026_603_1070 | 155 |
| 358 | 3300047444 | Ga0495675_0002868 | Ga0495675_0002868_9687_10154 | 155 |
| 359 | 3300047447 | Ga0495685_072604 | Ga0495685_072604_319_789 | 155 |
| 360 | 3300047471 | Ga0495684_0406505 | Ga0495684_0406505_148_615 | 155 |
| 361 | 3300047471 | Ga0495684_0474483 | Ga0495684_0474483_75_542 | 155 |
| 362 | 3300047472 | Ga0495686_0207557 | Ga0495686_0207557_632_1099 | 155 |
| 363 | 3300047673 | Ga0495593_0077057 | Ga0495593_0077057_405_872 | 155 |
| 364 | 3300047673 | Ga0495593_0269918 | Ga0495593_0269918_356_823 | 155 |
| 365 | 3300048088 | Ga0495602_0006250 | Ga0495602_0006250_5471_5938 | 155 |
| 366 | 3300048088 | Ga0495602_0065373 | Ga0495602_0065373_142_609 | 155 |
| 367 | 3300048904 | Ga0496101_0533869 | Ga0496101_0533869_42_509 | 155 |
| 368 | 3300048905 | Ga0496102_0163600 | Ga0496102_0163600_581_1048 | 155 |
| 369 | 3300048907 | Ga0496104_0005317 | Ga0496104_0005317_260_727 | 155 |
| 370 | 3300048907 | Ga0496104_0264481 | Ga0496104_0264481_611_1081 | 155 |
| 371 | 3300048907 | Ga0496104_0718501 | Ga0496104_0718501_121_588 | 155 |
| 372 | 3300048908 | Ga0496105_0008712 | Ga0496105_0008712_2932_3399 | 155 |
| 373 | 3300048908 | Ga0496105_0567770 | Ga0496105_0567770_167_637 | 155 |
| 374 | 3300048909 | Ga0496106_0122703 | Ga0496106_0122703_1009_1476 | 155 |
| 375 | 3300048911 | Ga0496108_0924164 | Ga0496108_0924164_186_653 | 155 |
| 376 | 3300048912 | Ga0496109_0280152 | Ga0496109_0280152_939_1409 | 155 |
| 377 | 3300048913 | Ga0496110_1352616 | Ga0496110_1352616_37_507 | 155 |
| 378 | 3300048914 | Ga0496111_0081497 | Ga0496111_0081497_1781_2251 | 155 |
| 379 | 3300048915 | Ga0496112_0075249 | Ga0496112_0075249_582_1052 | 155 |
| 380 | 3300048915 | Ga0496112_0307551 | Ga0496112_0307551_318_785 | 155 |
| 381 | 3300048916 | Ga0496113_0022521 | Ga0496113_0022521_2703_3170 | 155 |
| 382 | 3300048916 | Ga0496113_0058728 | Ga0496113_0058728_509_979 | 155 |
| 383 | 3300048917 | Ga0496114_0070345 | Ga0496114_0070345_1454_1921 | 155 |
| 384 | 3300048917 | Ga0496114_0296409 | Ga0496114_0296409_524_991 | 155 |
| 385 | 3300048918 | Ga0496115_0219527 | Ga0496115_0219527_889_1359 | 155 |
| 386 | 3300048918 | Ga0496115_0451303 | Ga0496115_0451303_253_720 | 155 |
| 387 | 3300048919 | Ga0496116_0115080 | Ga0496116_0115080_993_1460 | 155 |
| 388 | 3300048920 | Ga0496117_0260714 | Ga0496117_0260714_70_537 | 155 |
| 389 | 3300048921 | Ga0496118_0136851 | Ga0496118_0136851_212_679 | 155 |
| 390 | 3300048921 | Ga0496118_0312475 | Ga0496118_0312475_102_569 | 155 |
| 391 | 3300048922 | Ga0496119_0014481 | Ga0496119_0014481_2141_2608 | 155 |
| 392 | 3300048923 | Ga0496120_0008272 | Ga0496120_0008272_4950_5417 | 155 |
| 393 | 3300048924 | Ga0496121_0360062 | Ga0496121_0360062_478_945 | 155 |
| 394 | 3300048924 | Ga0496121_0396984 | Ga0496121_0396984_266_733 | 155 |
| 395 | 3300048929 | Ga0496126_0059143 | Ga0496126_0059143_2886_3353 | 155 |
| 396 | 3300048929 | Ga0496126_0085867 | Ga0496126_0085867_611_1078 | 155 |
| 397 | 3300048929 | Ga0496126_0112120 | Ga0496126_0112120_1836_2303 | 155 |
| 398 | 3300048929 | Ga0496126_0516056 | Ga0496126_0516056_384_851 | 155 |
| 399 | 3300048929 | Ga0496126_0618248 | Ga0496126_0618248_206_676 | 155 |
| 400 | 3300049460 | Ga0495682_0017444 | Ga0495682_0017444_1418_1885 | 155 |
| 401 | 3300049571 | Ga0501034_0000663 | Ga0501034_0000663_36784_37251 | 155 |
| 402 | 3300049571 | Ga0501034_0002763 | Ga0501034_0002763_8969_9451 | 155 |
| 403 | 3300049581 | Ga0501047_0217546 | Ga0501047_0217546_1251_1718 | 155 |
| 404 | 3300049584 | Ga0501068_0402493 | Ga0501068_0402493_92_559 | 155 |
| 405 | 3300049588 | Ga0501072_0148521 | Ga0501072_0148521_1256_1723 | 155 |
| 406 | 3300049588 | Ga0501072_1249641 | Ga0501072_1249641_66_548 | 155 |
| 407 | 3300049590 | Ga0501074_0338734 | Ga0501074_0338734_571_1038 | 155 |
| 408 | 3300050489 | nmdc:mga03683_426860_c1 | nmdc:mga03683_426860_c1_113_580 | 155 |
| 409 | 3300050489 | nmdc:mga03683_566761_c1 | nmdc:mga03683_566761_c1_49_516 | 155 |
| 410 | 3300050491 | nmdc:mga00v17_560377_c1 | nmdc:mga00v17_560377_c1_255_722 | 155 |
| 411 | 3300050492 | nmdc:mga0yw44_1147092_c1 | nmdc:mga0yw44_1147092_c1_39_506 | 155 |
| 412 | 3300050492 | nmdc:mga0yw44_36677_c1 | nmdc:mga0yw44_36677_c1_65_532 | 155 |
| 413 | 3300050493 | nmdc:mga0k408_182657_c1 | nmdc:mga0k408_182657_c1_612_1079 | 155 |
| 414 | 3300050494 | nmdc:mga06z11_124099_c1 | nmdc:mga06z11_124099_c1_789_1256 | 155 |
| 415 | 3300050494 | nmdc:mga06z11_433666_c1 | nmdc:mga06z11_433666_c1_60_527 | 155 |
| 416 | 3300050496 | nmdc:mga07m45_375105_c1 | nmdc:mga07m45_375105_c1_278_745 | 155 |
| 417 | 3300050509 | nmdc:mga0qj67_1272946_c1 | nmdc:mga0qj67_1272946_c1_26_496 | 155 |
| 418 | 3300050516 | nmdc:mga0sz30_30277_c1 | nmdc:mga0sz30_30277_c1_1632_2099 | 155 |
| 419 | 3300053080 | Ga0500635_0189461 | Ga0500635_0189461_320_787 | 155 |
| 420 | 3300053085 | Ga0495619_0489933 | Ga0495619_0489933_127_594 | 155 |
| 421 | 3300053086 | Ga0500578_0038187 | Ga0500578_0038187_317_784 | 155 |
| 422 | 3300053086 | Ga0500578_0060200 | Ga0500578_0060200_1861_2328 | 155 |
| 423 | 3300053088 | Ga0500644_0099855 | Ga0500644_0099855_14_481 | 155 |
| 424 | 3300053091 | Ga0500647_0031022 | Ga0500647_0031022_1268_1735 | 155 |
| 425 | 3300053094 | Ga0500566_0001036 | Ga0500566_0001036_6661_7128 | 155 |
| 426 | 3300053094 | Ga0500566_0058910 | Ga0500566_0058910_1308_1775 | 155 |
| 427 | 3300053105 | Ga0500557_000113 | Ga0500557_000113_7100_7567 | 155 |
| 428 | 3300053111 | Ga0500572_015020 | Ga0500572_015020_667_1134 | 155 |
| 429 | 3300053119 | Ga0500595_030924 | Ga0500595_030924_980_1447 | 155 |
| 430 | 3300053121 | Ga0500607_128499 | Ga0500607_128499_315_782 | 155 |
| 431 | 3300053122 | Ga0500608_228945 | Ga0500608_228945_41_508 | 155 |
| 432 | 3300053123 | Ga0500614_019819 | Ga0500614_019819_657_1124 | 155 |
| 433 | 3300053130 | Ga0500642_0000056 | Ga0500642_0000056_36604_37071 | 155 |
| 434 | 3300053136 | Ga0500559_0127453 | Ga0500559_0127453_37_504 | 155 |
| 435 | 3300053136 | Ga0500559_0381043 | Ga0500559_0381043_42_509 | 155 |
| 436 | 3300053144 | Ga0500585_270576 | Ga0500585_270576_18_485 | 155 |
| 437 | 3300053148 | Ga0500590_130673 | Ga0500590_130673_363_830 | 155 |
| 438 | 3300053148 | Ga0500590_161864 | Ga0500590_161864_332_799 | 155 |
| 439 | 3300053154 | Ga0500619_247555 | Ga0500619_247555_45_512 | 155 |
| 440 | 3300053155 | Ga0500620_172761 | Ga0500620_172761_121_588 | 155 |
| 441 | 3300053162 | Ga0500638_206402 | Ga0500638_206402_71_538 | 155 |
| 442 | 3300053177 | Ga0500636_0002161 | Ga0500636_0002161_7225_7692 | 155 |
| 443 | 3300053177 | Ga0500636_0374347 | Ga0500636_0374347_99_569 | 155 |
| 444 | 3300053729 | Ga0500625_000216 | Ga0500625_000216_10039_10506 | 155 |
| 445 | 3300003215 | JGI25153J46596_10009574 | JGI25153J46596_100095744 | 156 |
| 446 | 3300005329 | Ga0070683_100004460 | Ga0070683_1000044607 | 156 |
| 447 | 3300005458 | Ga0070681_10015192 | Ga0070681_100151925 | 156 |
| 448 | 3300005467 | Ga0070706_100112399 | Ga0070706_1001123992 | 156 |
| 449 | 3300005471 | Ga0070698_100003587 | Ga0070698_10000358710 | 156 |
| 450 | 3300005530 | Ga0070679_100007272 | Ga0070679_1000072725 | 156 |
| 451 | 3300005535 | Ga0070684_100010952 | Ga0070684_1000109523 | 156 |
| 452 | 3300005536 | Ga0070697_100294277 | Ga0070697_1002942772 | 156 |
| 453 | 3300005543 | Ga0070672_101195000 | Ga0070672_1011950002 | 156 |
| 454 | 3300005547 | Ga0070693_100268717 | Ga0070693_1002687172 | 156 |
| 455 | 3300005563 | Ga0068855_101189030 | Ga0068855_1011890301 | 156 |
| 456 | 3300005614 | Ga0068856_101023416 | Ga0068856_1010234162 | 156 |
| 457 | 3300005937 | Ga0081455_10075074 | Ga0081455_100750741 | 156 |
| 458 | 3300006038 | Ga0075365_10848082 | Ga0075365_108480821 | 156 |
| 459 | 3300009093 | Ga0105240_11099761 | Ga0105240_110997611 | 156 |
| 460 | 3300009551 | Ga0105238_10102507 | Ga0105238_101025072 | 156 |
| 461 | 3300013104 | Ga0157370_10614622 | Ga0157370_106146222 | 156 |
| 462 | 3300013105 | Ga0157369_10055172 | Ga0157369_100551724 | 156 |
| 463 | 3300013105 | Ga0157369_11104129 | Ga0157369_111041292 | 156 |
| 464 | 3300013296 | Ga0157374_10212779 | Ga0157374_102127792 | 156 |
| 465 | 3300013296 | Ga0157374_10859675 | Ga0157374_108596752 | 156 |
| 466 | 3300013306 | Ga0163162_10773392 | Ga0163162_107733922 | 156 |
| 467 | 3300013307 | Ga0157372_11332824 | Ga0157372_113328242 | 156 |
| 468 | 3300013308 | Ga0157375_10705812 | Ga0157375_107058121 | 156 |
| 469 | 3300014325 | Ga0163163_12198306 | Ga0163163_121983061 | 156 |
| 470 | 3300014968 | Ga0157379_10756295 | Ga0157379_107562952 | 156 |
| 471 | 3300025297 | Ga0209758_1001177 | Ga0209758_10011776 | 156 |
| 472 | 3300025302 | Ga0207426_1002219 | Ga0207426_10022193 | 156 |
| 473 | 3300025302 | Ga0207426_1005323 | Ga0207426_10053234 | 156 |
| 474 | 3300025910 | Ga0207684_10068738 | Ga0207684_100687384 | 156 |
| 475 | 3300025912 | Ga0207707_10013022 | Ga0207707_100130222 | 156 |
| 476 | 3300025921 | Ga0207652_10093647 | Ga0207652_100936472 | 156 |
| 477 | 3300025944 | Ga0207661_10006741 | Ga0207661_100067416 | 156 |
| 478 | 3300026078 | Ga0207702_10962770 | Ga0207702_109627702 | 156 |
| 479 | 3300035170 | Ga0373943_0323985 | Ga0373943_0323985_57_554 | 156 |
| 480 | 3300037312 | Ga0395899_0009033 | Ga0395899_0009033_4090_4587 | 156 |
| 481 | 3300037312 | Ga0395899_0121221 | Ga0395899_0121221_514_1011 | 156 |
| 482 | 3300037418 | Ga0395900_0001350 | Ga0395900_0001350_7167_7664 | 156 |
| 483 | 3300037418 | Ga0395900_0045645 | Ga0395900_0045645_2326_2823 | 156 |
| 484 | 3300037466 | Ga0395898_0029321 | Ga0395898_0029321_1087_1584 | 156 |
| 485 | 3300037471 | Ga0395905_0003532 | Ga0395905_0003532_155_625 | 156 |
| 486 | 3300038443 | Ga0395901_0008112 | Ga0395901_0008112_9475_9972 | 156 |
| 487 | 3300038443 | Ga0395901_0014435 | Ga0395901_0014435_3884_4381 | 156 |
| 488 | 3300038443 | Ga0395901_0150459 | Ga0395901_0150459_1126_1596 | 156 |
| 489 | 3300041496 | Ga0451839_0317516 | Ga0451839_0317516_66_545 | 156 |
| 490 | 3300046692 | Ga0495671_0015307 | Ga0495671_0015307_215_703 | 156 |
| 491 | 3300046794 | Ga0495589_0124536 | Ga0495589_0124536_383_865 | 156 |
| 492 | 3300046810 | Ga0495660_0208416 | Ga0495660_0208416_181_663 | 156 |
| 493 | 3300048908 | Ga0496105_0357564 | Ga0496105_0357564_243_725 | 156 |
| 494 | 3300049579 | Ga0501043_0905724 | Ga0501043_0905724_130_612 | 156 |
| 495 | 3300053094 | Ga0500566_0266563 | Ga0500566_0266563_212_712 | 156 |
| 496 | 3300053131 | Ga0500652_119262 | Ga0500652_119262_455_961 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dre-assembly1.cif.gz_A-2 | crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) | 0.8788 | 2 | 122 |
| 3ov4-assembly2.cif.gz_D | crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin | 0.8729 | 2 | 122 |
| 6uad-assembly1.cif.gz_A | ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 | 0.8694 | 2 | 122 |
| 2imj-assembly2.cif.gz_D | x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. | 0.8669 | 13 | 119 |
| 3ov4-assembly2.cif.gz_C | crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin | 0.8667 | 2 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2imjD01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8874 | 13 | 119 | 3.10.450.50 |
| 4hvnB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8733 | 7 | 130 | 3.10.450.50 |
| 3ov4D00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8729 | 2 | 122 | 3.10.450.50 |
| af_Q10083_1_118_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.85 | 2 | 119 | 3.10.450.50 |
| af_A0A1D8PLG7_12_136_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8436 | 3 | 119 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H9V4T9-F1-model_v4 | deleted | 0.9974 | 5 | 139 |
|
| AF-A0A562S659-F1-model_v4 | Ketosteroid isomerase-like protein | 0.9937 | 4 | 156 |
GO:0016853
|
| AF-A0A0D7PAZ9-F1-model_v4 | Polyketide cyclase | 0.9935 | 4 | 156 |
|
| AF-A0A0R3BI51-F1-model_v4 | Polyketide cyclase | 0.9927 | 4 | 156 |
|
| AF-A0A0R3BN22-F1-model_v4 | deleted | 0.9915 | 4 | 156 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar