F454873

General Info

Members Datasets Scaffolds Average Seq Length
496 277 992 251

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100001144|Ga0075436_10000114420
Length 280
Sequence MTPSPTLPKGEGANVASVFAVHDAVEIAHVSGFPTLLYKEVLRFWKVSFQTVGAPVLSALLYLVVFAHALASHVQAFPGVSYAQFLVPGLAMMSMLQNAFANSSSSLIQSKVTGNIVFILLPPLAPGEIFLAYLLAAMVRALTVGLGVFAATLWLVPVPVAHPLWAVAFAVVGSGLTAALGIVAGIWADKFDQLAAFQNFIVMPLTFLAGVFYSIHSLPDFWREVSALNPFFYAIDGFRYGFFGQSDVAPWKSLGIASAAFAALSFVTLLLLRRGYKLRH

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
80 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
95 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
168 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
271 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
272 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 2831864461 Roseateles noduli HZ7 Isolate Nodule
277 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.2
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 0.81
Rhizoplane 2.02
Rhizosphere 87.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100001144 3300006914 Bacteria 17940
2 JGI25157J39369_1000008 3300002741 Bacteria 211083
3 JGI25164J39214_1009284 3300002772 Bacteria 970
4 Ga0055539_1000255 3300003752 Bacteria 34096
5 Ga0055539_1002525 3300003752 Bacteria 2754
6 Ga0055533_1000040 3300003756 Bacteria 242927
7 Ga0055525_1001111 3300003759 Bacteria 6611
8 Ga0055524_1003013 3300003775 Bacteria 8348
9 Ga0055531_10012214 3300003794 Bacteria 4059
10 Ga0055531_10021335 3300003794 Bacteria 2515
11 Ga0055543_1007099 3300004625 Bacteria 2624
12 Ga0065165_1000170 3300005262 Bacteria 115389
13 Ga0065712_10155511 3300005290 Bacteria 1338
14 Ga0070658_10006355 3300005327 Bacteria 9576
15 Ga0070658_10014011 3300005327 Bacteria 6437
16 Ga0070658_10033248 3300005327 Bacteria 4148
17 Ga0070658_10079682 3300005327 Bacteria 2690
18 Ga0070658_10483932 3300005327 Bacteria 1068
19 Ga0070690_100000183 3300005330 Bacteria 32306
20 Ga0070690_100029916 3300005330 Bacteria 3382
21 Ga0070690_100084572 3300005330 Bacteria 2080
22 Ga0070690_100344691 3300005330 Bacteria 1080
23 Ga0068869_100000139 3300005334 Bacteria 35367
24 Ga0070680_100000688 3300005336 Bacteria 23463
25 Ga0070682_100012632 3300005337 Bacteria 4845
26 Ga0068868_100000115 3300005338 Bacteria 50197
27 Ga0068868_100027450 3300005338 Bacteria 4344
28 Ga0068868_100159375 3300005338 Bacteria 1863
29 Ga0068868_100299781 3300005338 Bacteria 1365
30 Ga0068868_100533858 3300005338 Bacteria 1032
31 Ga0070660_100137106 3300005339 Bacteria 1961
32 Ga0070689_100007131 3300005340 Bacteria 7790
33 Ga0070689_100085043 3300005340 Bacteria 2487
34 Ga0070689_100810509 3300005340 Bacteria 824
35 Ga0070691_10003942 3300005341 Bacteria 6715
36 Ga0070687_100000091 3300005343 Bacteria 29810
37 Ga0070661_100091837 3300005344 Bacteria 2249
38 Ga0070692_10004059 3300005345 Bacteria 6050
39 Ga0070692_10259597 3300005345 Bacteria 1044
40 Ga0070669_100298527 3300005353 Bacteria 1295
41 Ga0070675_100095331 3300005354 Bacteria 2498
42 Ga0070674_100123837 3300005356 Bacteria 1917
43 Ga0070674_100296351 3300005356 Bacteria 1288
44 Ga0070673_100071889 3300005364 Bacteria 2781
45 Ga0070673_100340997 3300005364 Bacteria 1328
46 Ga0070659_100086431 3300005366 Bacteria 2509
47 Ga0070659_100442998 3300005366 Bacteria 1101
48 Ga0070709_10086810 3300005434 Bacteria 2055
49 Ga0070714_100002634 3300005435 Bacteria 13211
50 Ga0070714_100013921 3300005435 Bacteria 6453
51 Ga0070713_100000699 3300005436 Bacteria 21563
52 Ga0070701_10000914 3300005438 Bacteria 10687
53 Ga0070705_100000441 3300005440 Bacteria 23797
54 Ga0070694_100000133 3300005444 Bacteria 37050
55 Ga0070663_100153268 3300005455 Bacteria 1769
56 Ga0070678_100184465 3300005456 Bacteria 1711
57 Ga0070681_10005855 3300005458 Bacteria 11898
58 Ga0068867_100000084 3300005459 Bacteria 58558
59 Ga0070685_10042714 3300005466 Bacteria 2588
60 Ga0070706_100312511 3300005467 Bacteria 1466
61 Ga0070707_100681467 3300005468 Bacteria 991
62 Ga0070698_100095641 3300005471 Bacteria 2948
63 Ga0070699_100408565 3300005518 Bacteria 1228
64 Ga0070679_100011828 3300005530 Bacteria 8324
65 Ga0070679_100011998 3300005530 Bacteria 8270
66 Ga0070679_100148650 3300005530 Bacteria 2320
67 Ga0070679_100273446 3300005530 Bacteria 1643
68 Ga0070684_100114451 3300005535 Bacteria 2421
69 Ga0070684_100287551 3300005535 Bacteria 1507
70 Ga0068853_100355395 3300005539 Bacteria 1364
71 Ga0070686_100000193 3300005544 Bacteria 42276
72 Ga0070686_100214780 3300005544 Bacteria 1387
73 Ga0070695_100000163 3300005545 Bacteria 31628
74 Ga0070695_100261090 3300005545 Bacteria 1265
75 Ga0070696_100000570 3300005546 Bacteria 23539
76 Ga0070693_100000111 3300005547 Bacteria 36381
77 Ga0070693_100003468 3300005547 Bacteria 7362
78 Ga0070693_100108013 3300005547 Bacteria 1706
79 Ga0070665_100563474 3300005548 Bacteria 1152
80 Ga0070704_100000008 3300005549 Bacteria 71641
81 Ga0068855_100000242 3300005563 Bacteria 68674
82 Ga0068855_100015654 3300005563 Bacteria 9126
83 Ga0068855_100028360 3300005563 Bacteria 6697
84 Ga0068855_100099273 3300005563 Bacteria 3354
85 Ga0068857_100012916 3300005577 Bacteria 7276
86 Ga0068857_100096274 3300005577 Bacteria 2652
87 Ga0068857_100198716 3300005577 Bacteria 1827
88 Ga0068857_100549768 3300005577 Bacteria 1088
89 Ga0068854_100008166 3300005578 Bacteria 6713
90 Ga0068856_100009632 3300005614 Bacteria 9377
91 Ga0068856_100041567 3300005614 Bacteria 4518
92 Ga0068856_100043238 3300005614 Bacteria 4433
93 Ga0068856_100693762 3300005614 Bacteria 1038
94 Ga0070702_100000012 3300005615 Bacteria 58298
95 Ga0068852_100001824 3300005616 Bacteria 14489
96 Ga0068852_100058649 3300005616 Bacteria 3336
97 Ga0068852_100089263 3300005616 Bacteria 2754
98 Ga0068852_100226625 3300005616 Bacteria 1780
99 Ga0068859_100001460 3300005617 Bacteria 24031
100 Ga0068859_100410230 3300005617 Bacteria 1451
101 Ga0068859_100910649 3300005617 Bacteria 964
102 Ga0068866_10000109 3300005718 Bacteria 35401
103 Ga0068861_100000814 3300005719 Bacteria 18847
104 Ga0068861_100166379 3300005719 Bacteria 1823
105 Ga0068870_10026463 3300005840 Bacteria 2892
106 Ga0068863_100068962 3300005841 Bacteria 3345
107 Ga0068863_100174154 3300005841 Bacteria 2065
108 Ga0068858_100000890 3300005842 Bacteria 31011
109 Ga0068858_100013374 3300005842 Bacteria 7744
110 Ga0068860_100014674 3300005843 Bacteria 7665
111 Ga0068862_100005995 3300005844 Bacteria 10118
112 Ga0075364_10016545 3300006051 Bacteria 4589
113 Ga0075369_10027528 3300006186 Bacteria 2377
114 Ga0075366_10004474 3300006195 Bacteria 7500
115 Ga0075366_10065444 3300006195 Bacteria 2162
116 Ga0075366_10076501 3300006195 Bacteria 1997
117 Ga0075366_10084748 3300006195 Bacteria 1895
118 Ga0075366_10098718 3300006195 Bacteria 1752
119 Ga0097621_100018927 3300006237 Bacteria 5274
120 Ga0097621_100126332 3300006237 Bacteria 2173
121 Ga0097621_100142022 3300006237 Bacteria 2052
122 Ga0097621_100147681 3300006237 Bacteria 2014
123 Ga0075370_10054383 3300006353 Bacteria 2273
124 Ga0068871_100000559 3300006358 Bacteria 25362
125 Ga0068871_100019576 3300006358 Bacteria 5170
126 Ga0068871_100048306 3300006358 Bacteria 3435
127 Ga0075428_100010059 3300006844 Bacteria 10510
128 Ga0075433_10371422 3300006852 Bacteria 1263
129 Ga0075434_100153498 3300006871 Bacteria 2323
130 Ga0075429_100131012 3300006880 Bacteria 2193
131 Ga0068865_100002206 3300006881 Bacteria 11476
132 Ga0075436_100021802 3300006914 Bacteria 4396
133 Ga0097620_100001461 3300006931 Bacteria 24031
134 Ga0097620_100410261 3300006931 Bacteria 1451
135 Ga0097620_100910777 3300006931 Bacteria 964
136 Ga0099824_1035369 3300006942 Bacteria 1527
137 Ga0099823_1000155 3300006944 Bacteria 36540
138 Ga0105240_10008480 3300009093 Bacteria 14698
139 Ga0105240_10047851 3300009093 Bacteria 5408
140 Ga0105240_10062374 3300009093 Bacteria 4641
141 Ga0105240_10230134 3300009093 Bacteria 2155
142 Ga0105240_10502688 3300009093 Bacteria 1348
143 Ga0105240_10550196 3300009093 Bacteria 1277
144 Ga0111539_10001740 3300009094 Bacteria 28934
145 Ga0111539_10080970 3300009094 Bacteria 3819
146 Ga0111539_10140573 3300009094 Bacteria 2827
147 Ga0105245_10000245 3300009098 Bacteria 51952
148 Ga0105245_10060710 3300009098 Bacteria 3405
149 Ga0105245_10185115 3300009098 Bacteria 1992
150 Ga0105245_10257694 3300009098 Bacteria 1697
151 Ga0114129_11097616 3300009147 Bacteria 996
152 Ga0105243_10000279 3300009148 Bacteria 56997
153 Ga0105243_10188907 3300009148 Bacteria 1798
154 Ga0105241_10021587 3300009174 Bacteria 4761
155 Ga0105241_10029613 3300009174 Bacteria 4087
156 Ga0105241_10043652 3300009174 Bacteria 3396
157 Ga0105241_10197103 3300009174 Bacteria 1680
158 Ga0105242_10000480 3300009176 Bacteria 31755
159 Ga0105242_10002769 3300009176 Bacteria 13718
160 Ga0105242_10010157 3300009176 Bacteria 7212
161 Ga0105242_10092696 3300009176 Bacteria 2545
162 Ga0105248_10024197 3300009177 Bacteria 6750
163 Ga0105248_10466243 3300009177 Bacteria 1424
164 Ga0105238_10009455 3300009551 Bacteria 9756
165 Ga0105238_10074067 3300009551 Bacteria 3398
166 Ga0105238_10132151 3300009551 Bacteria 2474
167 Ga0105238_10504426 3300009551 Bacteria 1211
168 Ga0105249_10007151 3300009553 Bacteria 9742
169 Ga0105249_10081290 3300009553 Bacteria 3012
170 Ga0099796_10014760 3300010159 Bacteria 2265
171 Ga0105239_10032131 3300010375 Bacteria 5768
172 Ga0105239_10142336 3300010375 Bacteria 2673
173 Ga0105246_10115399 3300011119 Bacteria 1980
174 Ga0157317_1000729 3300012475 Bacteria 1555
175 Ga0157319_1000004 3300012497 Bacteria 394735
176 Ga0157370_10001959 3300013104 Bacteria 25360
177 Ga0157370_10011180 3300013104 Bacteria 9412
178 Ga0157370_10325650 3300013104 Bacteria 1417
179 Ga0157369_10003314 3300013105 Bacteria 19138
180 Ga0157369_10644371 3300013105 Bacteria 1093
181 Ga0157378_10002150 3300013297 Bacteria 17495
182 Ga0157378_10297907 3300013297 Bacteria 1560
183 Ga0157378_10527549 3300013297 Bacteria 1183
184 Ga0163162_10012691 3300013306 Bacteria 8224
185 Ga0163162_10061474 3300013306 Bacteria 3794
186 Ga0163162_10473357 3300013306 Bacteria 1384
187 Ga0157372_10001380 3300013307 Bacteria 26204
188 Ga0157372_10039798 3300013307 Bacteria 5189
189 Ga0157372_10470914 3300013307 Bacteria 1464
190 Ga0157372_10512585 3300013307 Bacteria 1398
191 Ga0157375_10100751 3300013308 Bacteria 2970
192 Ga0157375_10500780 3300013308 Bacteria 1379
193 Ga0157380_10502490 3300014326 Bacteria 1178
194 Ga0157377_10072359 3300014745 Bacteria 1995
195 Ga0157379_10275466 3300014968 Bacteria 1530
196 Ga0157379_10279422 3300014968 Bacteria 1519
197 Ga0157376_10002130 3300014969 Bacteria 13330
198 Ga0157376_10035703 3300014969 Bacteria 4022
199 Ga0157376_10069400 3300014969 Bacteria 2988
200 Ga0157376_10356052 3300014969 Bacteria 1402
201 Ga0157376_10365910 3300014969 Bacteria 1384
202 Ga0157376_10390085 3300014969 Bacteria 1344
203 Ga0206353_10342971 3300020082 Bacteria 1022
204 Ga0209674_100066 3300025226 Bacteria 256739
205 Ga0209563_100107 3300025230 Bacteria 143807
206 Ga0207427_100266 3300025231 Bacteria 40361
207 Ga0209258_100489 3300025242 Bacteria 40371
208 Ga0209646_1000039 3300025246 Bacteria 349637
209 Ga0209026_1000006 3300025250 Bacteria 677225
210 Ga0209677_100052 3300025253 Bacteria 167826
211 Ga0209677_100914 3300025253 Bacteria 14434
212 Ga0209759_1000020 3300025256 Bacteria 344904
213 Ga0209759_1002131 3300025256 Bacteria 9135
214 Ga0209050_1008144 3300025298 Bacteria 5678
215 Ga0209256_1000085 3300025299 Bacteria 219043
216 Ga0209256_1000437 3300025299 Bacteria 64248
217 Ga0209051_1001930 3300025303 Bacteria 16022
218 Ga0209257_1000351 3300025304 Bacteria 94766
219 Ga0209257_1000479 3300025304 Bacteria 72716
220 Ga0207653_10003892 3300025885 Bacteria 4691
221 Ga0207682_10019418 3300025893 Bacteria 2660
222 Ga0207642_10000702 3300025899 Bacteria 10369
223 Ga0207688_10014848 3300025901 Bacteria 4227
224 Ga0207688_10035090 3300025901 Bacteria 2778
225 Ga0207647_10098604 3300025904 Bacteria 1736
226 Ga0207685_10040893 3300025905 Bacteria 1731
227 Ga0207699_10232394 3300025906 Bacteria 1263
228 Ga0207645_10147240 3300025907 Bacteria 1536
229 Ga0207643_10037376 3300025908 Bacteria 2725
230 Ga0207705_10016737 3300025909 Bacteria 5251
231 Ga0207705_10022223 3300025909 Bacteria 4524
232 Ga0207654_10057473 3300025911 Bacteria 2261
233 Ga0207654_10123906 3300025911 Bacteria 1627
234 Ga0207654_10145118 3300025911 Bacteria 1518
235 Ga0207695_10019943 3300025913 Bacteria 7700
236 Ga0207695_10042983 3300025913 Bacteria 4820
237 Ga0207695_10045730 3300025913 Bacteria 4645
238 Ga0207695_10162377 3300025913 Bacteria 2165
239 Ga0207695_10193150 3300025913 Bacteria 1953
240 Ga0207663_10119231 3300025916 Bacteria 1804
241 Ga0207660_10002762 3300025917 Bacteria 11505
242 Ga0207662_10000176 3300025918 Bacteria 30450
243 Ga0207662_10162098 3300025918 Bacteria 1429
244 Ga0207657_10191812 3300025919 Bacteria 1648
245 Ga0207657_10214562 3300025919 Bacteria 1543
246 Ga0207649_10096863 3300025920 Bacteria 1944
247 Ga0207649_10153758 3300025920 Bacteria 1587
248 Ga0207652_10016191 3300025921 Bacteria 6083
249 Ga0207652_10166835 3300025921 Bacteria 1975
250 Ga0207652_10183831 3300025921 Bacteria 1879
251 Ga0207652_10201657 3300025921 Bacteria 1790
252 Ga0207694_10381206 3300025924 Bacteria 1170
253 Ga0207659_10005795 3300025926 Bacteria 7528
254 Ga0207659_10143774 3300025926 Bacteria 1855
255 Ga0207659_10309402 3300025926 Bacteria 1300
256 Ga0207687_10008984 3300025927 Bacteria 6531
257 Ga0207687_10182014 3300025927 Bacteria 1629
258 Ga0207700_10021477 3300025928 Bacteria 4408
259 Ga0207700_10439918 3300025928 Bacteria 1148
260 Ga0207664_10034440 3300025929 Bacteria 3901
261 Ga0207664_10133809 3300025929 Bacteria 2090
262 Ga0207690_10147653 3300025932 Bacteria 1740
263 Ga0207690_10226397 3300025932 Bacteria 1433
264 Ga0207706_10081959 3300025933 Bacteria 2835
265 Ga0207686_10000627 3300025934 Bacteria 21927
266 Ga0207686_10032262 3300025934 Bacteria 3116
267 Ga0207686_10055638 3300025934 Bacteria 2483
268 Ga0207686_10436546 3300025934 Bacteria 1005
269 Ga0207709_10000549 3300025935 Bacteria 32146
270 Ga0207670_10001899 3300025936 Bacteria 10919
271 Ga0207670_10019984 3300025936 Bacteria 4105
272 Ga0207670_10079367 3300025936 Bacteria 2291
273 Ga0207669_10040305 3300025937 Bacteria 2708
274 Ga0207669_10061930 3300025937 Bacteria 2302
275 Ga0207669_10220534 3300025937 Bacteria 1391
276 Ga0207669_10504783 3300025937 Bacteria 968
277 Ga0207704_10000329 3300025938 Bacteria 22100
278 Ga0207704_10079695 3300025938 Bacteria 2111
279 Ga0207711_10398887 3300025941 Bacteria 1278
280 Ga0207689_10001276 3300025942 Bacteria 24276
281 Ga0207689_10024569 3300025942 Bacteria 5054
282 Ga0207689_10031020 3300025942 Bacteria 4452
283 Ga0207689_10058782 3300025942 Bacteria 3163
284 Ga0207689_10482507 3300025942 Bacteria 1038
285 Ga0207661_10123912 3300025944 Bacteria 2205
286 Ga0207667_10016267 3300025949 Bacteria 8406
287 Ga0207667_10024029 3300025949 Bacteria 6702
288 Ga0207667_10064720 3300025949 Bacteria 3816
289 Ga0207667_10066744 3300025949 Bacteria 3749
290 Ga0207667_10092607 3300025949 Bacteria 3121
291 Ga0207667_10110283 3300025949 Bacteria 2839
292 Ga0207651_10014367 3300025960 Bacteria 4568
293 Ga0207651_10209978 3300025960 Bacteria 1566
294 Ga0207712_10046117 3300025961 Bacteria 3020
295 Ga0207640_10008328 3300025981 Bacteria 5759
296 Ga0207677_10000669 3300026023 Bacteria 20376
297 Ga0207677_10181460 3300026023 Bacteria 1656
298 Ga0207703_10004197 3300026035 Bacteria 11879
299 Ga0207703_10008924 3300026035 Bacteria 7897
300 Ga0207703_10605599 3300026035 Bacteria 1036
301 Ga0207639_10077699 3300026041 Bacteria 2618
302 Ga0207639_10239755 3300026041 Bacteria 1576
303 Ga0207639_10272330 3300026041 Bacteria 1486
304 Ga0207678_10157730 3300026067 Bacteria 1938
305 Ga0207708_10000275 3300026075 Bacteria 40312
306 Ga0207708_10057652 3300026075 Bacteria 2963
307 Ga0207702_10017969 3300026078 Bacteria 5852
308 Ga0207702_10021997 3300026078 Bacteria 5282
309 Ga0207702_10187272 3300026078 Bacteria 1910
310 Ga0207641_10220934 3300026088 Bacteria 1757
311 Ga0207648_10000185 3300026089 Bacteria 65925
312 Ga0207648_10048393 3300026089 Bacteria 3722
313 Ga0207648_10201016 3300026089 Bacteria 1767
314 Ga0207674_10040795 3300026116 Bacteria 4805
315 Ga0207674_10237808 3300026116 Bacteria 1768
316 Ga0207674_10262232 3300026116 Bacteria 1675
317 Ga0207675_100000150 3300026118 Bacteria 61064
318 Ga0207675_100317722 3300026118 Bacteria 1520
319 Ga0207698_10002752 3300026142 Bacteria 10485
320 Ga0207698_10006232 3300026142 Bacteria 7427
321 Ga0209389_1011713 3300027296 Bacteria 7940
322 Ga0209179_1018901 3300027512 Bacteria 1321
323 Ga0209983_1014690 3300027665 Bacteria 1614
324 Ga0207428_10002211 3300027907 Bacteria 19536
325 Ga0207428_10461232 3300027907 Bacteria 926
326 Ga0268266_10108735 3300028379 Bacteria 2454
327 Ga0268265_10001010 3300028380 Bacteria 25458
328 Ga0268264_10000903 3300028381 Bacteria 31199
329 Ga0265328_10000007 3300031239 Bacteria 224310
330 Ga0265331_10007589 3300031250 Bacteria 6259
331 Ga0265327_10000871 3300031251 Bacteria 44739
332 Ga0265327_10012877 3300031251 Bacteria 5602
333 Ga0265314_10007074 3300031711 Bacteria 9791
334 Ga0265342_10061275 3300031712 Bacteria 2217
335 Ga0307405_10262283 3300031731 Bacteria 1291
336 Ga0307405_10345704 3300031731 Bacteria 1145
337 Ga0307410_10234757 3300031852 Bacteria 1418
338 Ga0307412_10221264 3300031911 Bacteria 1451
339 Ga0307412_10580257 3300031911 Bacteria 946
340 Ga0307409_100145883 3300031995 Bacteria 2047
341 Ga0307416_100057411 3300032002 Bacteria 3149
342 Ga0307416_100189033 3300032002 Bacteria 1940
343 Ga0307416_100230526 3300032002 Bacteria 1785
344 Ga0307416_100461750 3300032002 Bacteria 1325
345 Ga0307416_100483174 3300032002 Bacteria 1299
346 Ga0373958_0018573 3300034819 Bacteria 1262
347 Ga0373939_0031708 3300035114 Bacteria 1530
348 Ga0373954_0002148 3300035118 Bacteria 8184
349 Ga0373931_0040885 3300035691 Bacteria 2434
350 Ga0373933_0301063 3300035724 Bacteria 1038
351 Ga0373937_0004087 3300036401 Bacteria 12375
352 Ga0373937_0028552 3300036401 Bacteria 5049
353 Ga0373925_0275428 3300037068 Bacteria 1354
354 Ga0395899_0027750 3300037312 Bacteria 4265
355 Ga0395900_0036966 3300037418 Bacteria 5034
356 Ga0395898_0024382 3300037466 Bacteria 6100
357 Ga0395905_0000544 3300037471 Bacteria 51411
358 Ga0395905_0002682 3300037471 Bacteria 19512
359 Ga0395905_0006280 3300037471 Bacteria 11985
360 Ga0395905_0049265 3300037471 Bacteria 3947
361 Ga0395905_0052262 3300037471 Bacteria 3825
362 Ga0395905_0105076 3300037471 Bacteria 2651
363 Ga0395901_0033024 3300038443 Bacteria 5340
364 Ga0395901_0108658 3300038443 Bacteria 2911
365 Ga0395901_0167094 3300038443 Bacteria 2309
366 Ga0400490_25259 3300038726 Bacteria 11815
367 Ga0436361_0982441 3300039447 Bacteria 1055
368 Ga0450890_001617 3300042127 Bacteria 3232
369 Ga0439459_0000172 3300042438 Bacteria 6925
370 Ga0450893_0001626 3300042532 Bacteria 3452
371 Ga0451577_0001277 3300042876 Bacteria 34672
372 Ga0451577_0002309 3300042876 Bacteria 23046
373 Ga0451577_0014648 3300042876 Bacteria 7307
374 Ga0466969_0002748 3300044656 Bacteria 9413
375 Ga0466969_0024812 3300044656 Bacteria 3083
376 Ga0466966_0005994 3300044684 Bacteria 8023
377 Ga0466961_0008487 3300044693 Bacteria 6544
378 Ga0466961_0027999 3300044693 Bacteria 3624
379 Ga0466961_0114625 3300044693 Bacteria 1694
380 Ga0466964_0000601 3300044706 Bacteria 11390
381 Ga0453684_0042026 3300044712 Bacteria 6170
382 Ga0453684_0343818 3300044712 Bacteria 1684
383 Ga0466971_0004741 3300044719 Bacteria 5882
384 Ga0466970_0010877 3300044765 Bacteria 4628
385 Ga0466957_0006160 3300044842 Bacteria 6773
386 Ga0466957_0012363 3300044842 Bacteria 4942
387 Ga0466957_0191076 3300044842 Bacteria 1341
388 Ga0466959_0005876 3300045049 Bacteria 8451
389 Ga0466959_0024373 3300045049 Bacteria 4482
390 Ga0466959_0189030 3300045049 Bacteria 1438
391 Ga0466958_0035698 3300045836 Bacteria 2970
392 Ga0466967_0015064 3300045976 Bacteria 6050
393 Ga0495592_0004622 3300046454 Bacteria 10085
394 Ga0495628_0009950 3300046516 Bacteria 8094
395 Ga0495652_0123831 3300046529 Bacteria 2057
396 Ga0495587_0016929 3300046536 Bacteria 4534
397 Ga0495598_0034505 3300046537 Bacteria 1443
398 Ga0495645_0007376 3300046543 Bacteria 7648
399 Ga0495667_0004241 3300046559 Bacteria 9657
400 Ga0495588_0001603 3300046674 Bacteria 9665
401 Ga0495599_0009455 3300046678 Bacteria 5959
402 Ga0495604_0016539 3300047317 Bacteria 5897
403 Ga0495680_0487742 3300047322 Bacteria 838
404 Ga0496100_0062647 3300048903 Bacteria 2455
405 Ga0496104_0081008 3300048907 Bacteria 3095
406 Ga0496105_0064019 3300048908 Bacteria 3034
407 Ga0496108_0009133 3300048911 Bacteria 8024
408 Ga0496109_0010679 3300048912 Bacteria 7856
409 Ga0496110_0010651 3300048913 Bacteria 7485
410 Ga0496114_0004541 3300048917 Bacteria 10776
411 Ga0496114_0006320 3300048917 Bacteria 9323
412 Ga0496114_0168846 3300048917 Bacteria 1906
413 Ga0496115_0046951 3300048918 Bacteria 3453
414 Ga0496124_0100396 3300048927 Bacteria 2346
415 Ga0501031_0003556 3300049568 Bacteria 10009
416 Ga0501031_0046735 3300049568 Bacteria 2822
417 Ga0501031_0101443 3300049568 Bacteria 1878
418 Ga0501032_0001864 3300049569 Bacteria 16662
419 Ga0501032_0163556 3300049569 Bacteria 1461
420 Ga0501033_0017666 3300049570 Bacteria 5387
421 Ga0501033_0088776 3300049570 Bacteria 2262
422 Ga0501034_0009604 3300049571 Bacteria 10121
423 Ga0501034_0213418 3300049571 Bacteria 1884
424 Ga0501034_0343851 3300049571 Bacteria 1421
425 Ga0501036_0005857 3300049572 Bacteria 9954
426 Ga0501036_0039968 3300049572 Bacteria 3968
427 Ga0501036_0074299 3300049572 Bacteria 2875
428 Ga0501036_0129497 3300049572 Bacteria 2131
429 Ga0501036_0220896 3300049572 Bacteria 1591
430 Ga0501036_0251593 3300049572 Bacteria 1481
431 Ga0501037_0002345 3300049573 Bacteria 13682
432 Ga0501037_0055265 3300049573 Bacteria 2903
433 Ga0501037_0172063 3300049573 Bacteria 1539
434 Ga0501037_0236297 3300049573 Bacteria 1282
435 Ga0501038_0046371 3300049574 Bacteria 3768
436 Ga0501038_0050961 3300049574 Bacteria 3575
437 Ga0501038_0061701 3300049574 Bacteria 3205
438 Ga0501038_0153175 3300049574 Bacteria 1878
439 Ga0501039_0016871 3300049575 Bacteria 5596
440 Ga0501039_0017720 3300049575 Bacteria 5463
441 Ga0501039_0202373 3300049575 Bacteria 1561
442 Ga0501039_0255235 3300049575 Bacteria 1378
443 Ga0501040_0015122 3300049576 Bacteria 5098
444 Ga0501040_0173419 3300049576 Bacteria 1528
445 Ga0501042_0017364 3300049578 Bacteria 4961
446 Ga0501042_0193498 3300049578 Bacteria 1467
447 Ga0501043_0002622 3300049579 Bacteria 15157
448 Ga0501043_0005045 3300049579 Bacteria 10679
449 Ga0501043_0041953 3300049579 Bacteria 3594
450 Ga0501043_0104078 3300049579 Bacteria 2230
451 Ga0501046_0004232 3300049580 Bacteria 13056
452 Ga0501048_0110430 3300049582 Bacteria 1942
453 Ga0501068_0005983 3300049584 Bacteria 6677
454 Ga0501071_0020331 3300049587 Bacteria 4612
455 Ga0501072_0236263 3300049588 Bacteria 1456
456 Ga0501074_0169828 3300049590 Bacteria 1557
457 Ga0501075_0017270 3300049591 Bacteria 5211
458 Ga0501075_0123449 3300049591 Bacteria 1971
459 Ga0501076_0152083 3300049592 Bacteria 1883
460 Ga0501077_0267901 3300049593 Bacteria 1087
461 Ga0501079_0154202 3300049741 Bacteria 1790
462 Ga0501080_0000634 3300049742 Bacteria 27899
463 Ga0501081_0054336 3300049743 Bacteria 2767
464 Ga0501035_0004063 3300049822 Bacteria 13927
465 Ga0501035_0095098 3300049822 Bacteria 2619
466 Ga0501035_0204419 3300049822 Bacteria 1692
467 Ga0501044_0000386 3300049823 Bacteria 54777
468 Ga0501044_0015193 3300049823 Bacteria 8292
469 Ga0501044_0039276 3300049823 Bacteria 4938
470 Ga0501045_0000912 3300049824 Bacteria 19276
471 Ga0501045_0050215 3300049824 Bacteria 3043
472 nmdc:mga00v17_97614_c1 3300050491 Bacteria 1852
473 nmdc:mga0k408_13541_c1 3300050493 Bacteria 4476
474 nmdc:mga0k408_13904_c1 3300050493 Bacteria 4423
475 nmdc:mga0k408_74250_c1 3300050493 Bacteria 1987
476 nmdc:mga06z11_123182_c1 3300050494 Bacteria 1448
477 nmdc:mga05p37_86783_c1 3300050507 Bacteria 3857
478 nmdc:mga09592_60104_c1 3300050508 Bacteria 3213
479 nmdc:mga08y16_1258_c1 3300050511 Bacteria 25159
480 nmdc:mga08y16_165463_c1 3300050511 Bacteria 2298
481 nmdc:mga08y16_88248_c1 3300050511 Bacteria 3232
482 nmdc:mga08x19_240922_c1 3300050514 Bacteria 1247
483 nmdc:mga0a205_418046_c1 3300050515 Bacteria 1203
484 Ga0495601_0009545 3300053077 Bacteria 5745
485 Ga0500562_006293 3300053108 Bacteria 2995
486 Ga0500622_0049429 3300053156 Bacteria 2168
487 Ga0500636_0000050 3300053177 Bacteria 56422
488 Ga0500637_0074084 3300053178 Bacteria 1961
489 Ga0500625_001909 3300053729 Bacteria 7493
490 Ga0501084_0215760 3300054114 Bacteria 1619
491 Ga0501084_0271446 3300054114 Bacteria 1432
492 Ga0590071_005157 3300059421 Bacteria 3152
493 Ga0466962_0009886 3300061719 Bacteria 4577
494 Ga0466962_0016044 3300061719 Bacteria 3613
495 2831865197 2831864461 Bacteria 6502356
496 2886850082 2886848708 Bacteria 5632523
497 Ga0075436_100001144
498 JGI25157J39369_1000008
499 JGI25164J39214_1009284
500 Ga0055539_1000255
501 Ga0055539_1002525
502 Ga0055533_1000040
503 Ga0055525_1001111
504 Ga0055524_1003013
505 Ga0055531_10012214
506 Ga0055531_10021335
507 Ga0055543_1007099
508 Ga0065165_1000170
509 Ga0065712_10155511
510 Ga0070658_10006355
511 Ga0070658_10014011
512 Ga0070658_10033248
513 Ga0070658_10079682
514 Ga0070658_10483932
515 Ga0070690_100000183
516 Ga0070690_100029916
517 Ga0070690_100084572
518 Ga0070690_100344691
519 Ga0068869_100000139
520 Ga0070680_100000688
521 Ga0070682_100012632
522 Ga0068868_100000115
523 Ga0068868_100027450
524 Ga0068868_100159375
525 Ga0068868_100299781
526 Ga0068868_100533858
527 Ga0070660_100137106
528 Ga0070689_100007131
529 Ga0070689_100085043
530 Ga0070689_100810509
531 Ga0070691_10003942
532 Ga0070687_100000091
533 Ga0070661_100091837
534 Ga0070692_10004059
535 Ga0070692_10259597
536 Ga0070669_100298527
537 Ga0070675_100095331
538 Ga0070674_100123837
539 Ga0070674_100296351
540 Ga0070673_100071889
541 Ga0070673_100340997
542 Ga0070659_100086431
543 Ga0070659_100442998
544 Ga0070709_10086810
545 Ga0070714_100002634
546 Ga0070714_100013921
547 Ga0070713_100000699
548 Ga0070701_10000914
549 Ga0070705_100000441
550 Ga0070694_100000133
551 Ga0070663_100153268
552 Ga0070678_100184465
553 Ga0070681_10005855
554 Ga0068867_100000084
555 Ga0070685_10042714
556 Ga0070706_100312511
557 Ga0070707_100681467
558 Ga0070698_100095641
559 Ga0070699_100408565
560 Ga0070679_100011828
561 Ga0070679_100011998
562 Ga0070679_100148650
563 Ga0070679_100273446
564 Ga0070684_100114451
565 Ga0070684_100287551
566 Ga0068853_100355395
567 Ga0070686_100000193
568 Ga0070686_100214780
569 Ga0070695_100000163
570 Ga0070695_100261090
571 Ga0070696_100000570
572 Ga0070693_100000111
573 Ga0070693_100003468
574 Ga0070693_100108013
575 Ga0070665_100563474
576 Ga0070704_100000008
577 Ga0068855_100000242
578 Ga0068855_100015654
579 Ga0068855_100028360
580 Ga0068855_100099273
581 Ga0068857_100012916
582 Ga0068857_100096274
583 Ga0068857_100198716
584 Ga0068857_100549768
585 Ga0068854_100008166
586 Ga0068856_100009632
587 Ga0068856_100041567
588 Ga0068856_100043238
589 Ga0068856_100693762
590 Ga0070702_100000012
591 Ga0068852_100001824
592 Ga0068852_100058649
593 Ga0068852_100089263
594 Ga0068852_100226625
595 Ga0068859_100001460
596 Ga0068859_100410230
597 Ga0068859_100910649
598 Ga0068866_10000109
599 Ga0068861_100000814
600 Ga0068861_100166379
601 Ga0068870_10026463
602 Ga0068863_100068962
603 Ga0068863_100174154
604 Ga0068858_100000890
605 Ga0068858_100013374
606 Ga0068860_100014674
607 Ga0068862_100005995
608 Ga0075364_10016545
609 Ga0075369_10027528
610 Ga0075366_10004474
611 Ga0075366_10065444
612 Ga0075366_10076501
613 Ga0075366_10084748
614 Ga0075366_10098718
615 Ga0097621_100018927
616 Ga0097621_100126332
617 Ga0097621_100142022
618 Ga0097621_100147681
619 Ga0075370_10054383
620 Ga0068871_100000559
621 Ga0068871_100019576
622 Ga0068871_100048306
623 Ga0075428_100010059
624 Ga0075433_10371422
625 Ga0075434_100153498
626 Ga0075429_100131012
627 Ga0068865_100002206
628 Ga0075436_100021802
629 Ga0097620_100001461
630 Ga0097620_100410261
631 Ga0097620_100910777
632 Ga0099824_1035369
633 Ga0099823_1000155
634 Ga0105240_10008480
635 Ga0105240_10047851
636 Ga0105240_10062374
637 Ga0105240_10230134
638 Ga0105240_10502688
639 Ga0105240_10550196
640 Ga0111539_10001740
641 Ga0111539_10080970
642 Ga0111539_10140573
643 Ga0105245_10000245
644 Ga0105245_10060710
645 Ga0105245_10185115
646 Ga0105245_10257694
647 Ga0114129_11097616
648 Ga0105243_10000279
649 Ga0105243_10188907
650 Ga0105241_10021587
651 Ga0105241_10029613
652 Ga0105241_10043652
653 Ga0105241_10197103
654 Ga0105242_10000480
655 Ga0105242_10002769
656 Ga0105242_10010157
657 Ga0105242_10092696
658 Ga0105248_10024197
659 Ga0105248_10466243
660 Ga0105238_10009455
661 Ga0105238_10074067
662 Ga0105238_10132151
663 Ga0105238_10504426
664 Ga0105249_10007151
665 Ga0105249_10081290
666 Ga0099796_10014760
667 Ga0105239_10032131
668 Ga0105239_10142336
669 Ga0105246_10115399
670 Ga0157317_1000729
671 Ga0157319_1000004
672 Ga0157370_10001959
673 Ga0157370_10011180
674 Ga0157370_10325650
675 Ga0157369_10003314
676 Ga0157369_10644371
677 Ga0157378_10002150
678 Ga0157378_10297907
679 Ga0157378_10527549
680 Ga0163162_10012691
681 Ga0163162_10061474
682 Ga0163162_10473357
683 Ga0157372_10001380
684 Ga0157372_10039798
685 Ga0157372_10470914
686 Ga0157372_10512585
687 Ga0157375_10100751
688 Ga0157375_10500780
689 Ga0157380_10502490
690 Ga0157377_10072359
691 Ga0157379_10275466
692 Ga0157379_10279422
693 Ga0157376_10002130
694 Ga0157376_10035703
695 Ga0157376_10069400
696 Ga0157376_10356052
697 Ga0157376_10365910
698 Ga0157376_10390085
699 Ga0206353_10342971
700 Ga0209674_100066
701 Ga0209563_100107
702 Ga0207427_100266
703 Ga0209258_100489
704 Ga0209646_1000039
705 Ga0209026_1000006
706 Ga0209677_100052
707 Ga0209677_100914
708 Ga0209759_1000020
709 Ga0209759_1002131
710 Ga0209050_1008144
711 Ga0209256_1000085
712 Ga0209256_1000437
713 Ga0209051_1001930
714 Ga0209257_1000351
715 Ga0209257_1000479
716 Ga0207653_10003892
717 Ga0207682_10019418
718 Ga0207642_10000702
719 Ga0207688_10014848
720 Ga0207688_10035090
721 Ga0207647_10098604
722 Ga0207685_10040893
723 Ga0207699_10232394
724 Ga0207645_10147240
725 Ga0207643_10037376
726 Ga0207705_10016737
727 Ga0207705_10022223
728 Ga0207654_10057473
729 Ga0207654_10123906
730 Ga0207654_10145118
731 Ga0207695_10019943
732 Ga0207695_10042983
733 Ga0207695_10045730
734 Ga0207695_10162377
735 Ga0207695_10193150
736 Ga0207663_10119231
737 Ga0207660_10002762
738 Ga0207662_10000176
739 Ga0207662_10162098
740 Ga0207657_10191812
741 Ga0207657_10214562
742 Ga0207649_10096863
743 Ga0207649_10153758
744 Ga0207652_10016191
745 Ga0207652_10166835
746 Ga0207652_10183831
747 Ga0207652_10201657
748 Ga0207694_10381206
749 Ga0207659_10005795
750 Ga0207659_10143774
751 Ga0207659_10309402
752 Ga0207687_10008984
753 Ga0207687_10182014
754 Ga0207700_10021477
755 Ga0207700_10439918
756 Ga0207664_10034440
757 Ga0207664_10133809
758 Ga0207690_10147653
759 Ga0207690_10226397
760 Ga0207706_10081959
761 Ga0207686_10000627
762 Ga0207686_10032262
763 Ga0207686_10055638
764 Ga0207686_10436546
765 Ga0207709_10000549
766 Ga0207670_10001899
767 Ga0207670_10019984
768 Ga0207670_10079367
769 Ga0207669_10040305
770 Ga0207669_10061930
771 Ga0207669_10220534
772 Ga0207669_10504783
773 Ga0207704_10000329
774 Ga0207704_10079695
775 Ga0207711_10398887
776 Ga0207689_10001276
777 Ga0207689_10024569
778 Ga0207689_10031020
779 Ga0207689_10058782
780 Ga0207689_10482507
781 Ga0207661_10123912
782 Ga0207667_10016267
783 Ga0207667_10024029
784 Ga0207667_10064720
785 Ga0207667_10066744
786 Ga0207667_10092607
787 Ga0207667_10110283
788 Ga0207651_10014367
789 Ga0207651_10209978
790 Ga0207712_10046117
791 Ga0207640_10008328
792 Ga0207677_10000669
793 Ga0207677_10181460
794 Ga0207703_10004197
795 Ga0207703_10008924
796 Ga0207703_10605599
797 Ga0207639_10077699
798 Ga0207639_10239755
799 Ga0207639_10272330
800 Ga0207678_10157730
801 Ga0207708_10000275
802 Ga0207708_10057652
803 Ga0207702_10017969
804 Ga0207702_10021997
805 Ga0207702_10187272
806 Ga0207641_10220934
807 Ga0207648_10000185
808 Ga0207648_10048393
809 Ga0207648_10201016
810 Ga0207674_10040795
811 Ga0207674_10237808
812 Ga0207674_10262232
813 Ga0207675_100000150
814 Ga0207675_100317722
815 Ga0207698_10002752
816 Ga0207698_10006232
817 Ga0209389_1011713
818 Ga0209179_1018901
819 Ga0209983_1014690
820 Ga0207428_10002211
821 Ga0207428_10461232
822 Ga0268266_10108735
823 Ga0268265_10001010
824 Ga0268264_10000903
825 Ga0265328_10000007
826 Ga0265331_10007589
827 Ga0265327_10000871
828 Ga0265327_10012877
829 Ga0265314_10007074
830 Ga0265342_10061275
831 Ga0307405_10262283
832 Ga0307405_10345704
833 Ga0307410_10234757
834 Ga0307412_10221264
835 Ga0307412_10580257
836 Ga0307409_100145883
837 Ga0307416_100057411
838 Ga0307416_100189033
839 Ga0307416_100230526
840 Ga0307416_100461750
841 Ga0307416_100483174
842 Ga0373958_0018573
843 Ga0373939_0031708
844 Ga0373954_0002148
845 Ga0373931_0040885
846 Ga0373933_0301063
847 Ga0373937_0004087
848 Ga0373937_0028552
849 Ga0373925_0275428
850 Ga0395899_0027750
851 Ga0395900_0036966
852 Ga0395898_0024382
853 Ga0395905_0000544
854 Ga0395905_0002682
855 Ga0395905_0006280
856 Ga0395905_0049265
857 Ga0395905_0052262
858 Ga0395905_0105076
859 Ga0395901_0033024
860 Ga0395901_0108658
861 Ga0395901_0167094
862 Ga0400490_25259
863 Ga0436361_0982441
864 Ga0450890_001617
865 Ga0439459_0000172
866 Ga0450893_0001626
867 Ga0451577_0001277
868 Ga0451577_0002309
869 Ga0451577_0014648
870 Ga0466969_0002748
871 Ga0466969_0024812
872 Ga0466966_0005994
873 Ga0466961_0008487
874 Ga0466961_0027999
875 Ga0466961_0114625
876 Ga0466964_0000601
877 Ga0453684_0042026
878 Ga0453684_0343818
879 Ga0466971_0004741
880 Ga0466970_0010877
881 Ga0466957_0006160
882 Ga0466957_0012363
883 Ga0466957_0191076
884 Ga0466959_0005876
885 Ga0466959_0024373
886 Ga0466959_0189030
887 Ga0466958_0035698
888 Ga0466967_0015064
889 Ga0495592_0004622
890 Ga0495628_0009950
891 Ga0495652_0123831
892 Ga0495587_0016929
893 Ga0495598_0034505
894 Ga0495645_0007376
895 Ga0495667_0004241
896 Ga0495588_0001603
897 Ga0495599_0009455
898 Ga0495604_0016539
899 Ga0495680_0487742
900 Ga0496100_0062647
901 Ga0496104_0081008
902 Ga0496105_0064019
903 Ga0496108_0009133
904 Ga0496109_0010679
905 Ga0496110_0010651
906 Ga0496114_0004541
907 Ga0496114_0006320
908 Ga0496114_0168846
909 Ga0496115_0046951
910 Ga0496124_0100396
911 Ga0501031_0003556
912 Ga0501031_0046735
913 Ga0501031_0101443
914 Ga0501032_0001864
915 Ga0501032_0163556
916 Ga0501033_0017666
917 Ga0501033_0088776
918 Ga0501034_0009604
919 Ga0501034_0213418
920 Ga0501034_0343851
921 Ga0501036_0005857
922 Ga0501036_0039968
923 Ga0501036_0074299
924 Ga0501036_0129497
925 Ga0501036_0220896
926 Ga0501036_0251593
927 Ga0501037_0002345
928 Ga0501037_0055265
929 Ga0501037_0172063
930 Ga0501037_0236297
931 Ga0501038_0046371
932 Ga0501038_0050961
933 Ga0501038_0061701
934 Ga0501038_0153175
935 Ga0501039_0016871
936 Ga0501039_0017720
937 Ga0501039_0202373
938 Ga0501039_0255235
939 Ga0501040_0015122
940 Ga0501040_0173419
941 Ga0501042_0017364
942 Ga0501042_0193498
943 Ga0501043_0002622
944 Ga0501043_0005045
945 Ga0501043_0041953
946 Ga0501043_0104078
947 Ga0501046_0004232
948 Ga0501048_0110430
949 Ga0501068_0005983
950 Ga0501071_0020331
951 Ga0501072_0236263
952 Ga0501074_0169828
953 Ga0501075_0017270
954 Ga0501075_0123449
955 Ga0501076_0152083
956 Ga0501077_0267901
957 Ga0501079_0154202
958 Ga0501080_0000634
959 Ga0501081_0054336
960 Ga0501035_0004063
961 Ga0501035_0095098
962 Ga0501035_0204419
963 Ga0501044_0000386
964 Ga0501044_0015193
965 Ga0501044_0039276
966 Ga0501045_0000912
967 Ga0501045_0050215
968 nmdc:mga00v17_97614_c1
969 nmdc:mga0k408_13541_c1
970 nmdc:mga0k408_13904_c1
971 nmdc:mga0k408_74250_c1
972 nmdc:mga06z11_123182_c1
973 nmdc:mga05p37_86783_c1
974 nmdc:mga09592_60104_c1
975 nmdc:mga08y16_1258_c1
976 nmdc:mga08y16_165463_c1
977 nmdc:mga08y16_88248_c1
978 nmdc:mga08x19_240922_c1
979 nmdc:mga0a205_418046_c1
980 Ga0495601_0009545
981 Ga0500562_006293
982 Ga0500622_0049429
983 Ga0500636_0000050
984 Ga0500637_0074084
985 Ga0500625_001909
986 Ga0501084_0215760
987 Ga0501084_0271446
988 Ga0590071_005157
989 Ga0466962_0009886
990 Ga0466962_0016044
991 2831865197
992 2886850082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

32

243

0.92

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

78

271

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.7116 7 254
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.7089 7 254
8wba-assembly1.cif.gz_A cryo-em structure of the abcg25 bound to chs 0.7033 6 251
7r8b-assembly1.cif.gz_A the structure of human abcg5/abcg8 supplemented with cholesterol 0.7018 6 255
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.6992 1 250
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.84 54 249 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7749 45 247 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.767 33 245 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6557 54 249 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6453 33 245 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A381YL02-F1-model_v4 ABC transmembrane type-2 domain-containing protein 0.983 66 257 GO:0005886
GO:0140359
AF-A0A176S4K3-F1-model_v4 Abc-type multidrug transport system, permease component 0.9822 59 257 GO:0005886
GO:0140359
AF-A0A2N5CHN7-F1-model_v4 Transport permease protein 0.9799 7 257 GO:0016787
GO:0043190
GO:0140359
AF-A0A095UWJ0-F1-model_v4 Transport permease protein 0.9799 9 257 GO:0016787
GO:0043190
GO:0140359
AF-V8QTX0-F1-model_v4 Transport permease protein 0.9798 9 257 GO:0016787
GO:0043190
GO:0140359

Map