F454896
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 496 | 306 | 495 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10295081|Ga0157375_102950812 |
| Length | 170 |
| Sequence | MSVPQRADRLVDERWLGGLTGRPARTCKRSVTMRFMVIVKASKETEAGIMPSTELLTAMGKFNEELVKAGMMEAGEGLHPSSKGARIRYAGGQVRASRGPFPLTDDLVAGFWLIKARSLDEAIDWMKRAPFGGGAEIEIRQVFSSEDFGEALTPELREQEERLRAQAGKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 198 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 214 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 215 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 216 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 217 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 279 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 298 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 299 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 300 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 301 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 302 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 303 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 304 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 305 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.4 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.68 |
| Nodule | 0.4 |
| Rhizoplane | 5.85 |
| Rhizosphere | 76.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10039071 | 3300002075 | Bacteria | 964 |
| 2 | JGI25153J46596_10010032 | 3300003215 | Bacteria | 4323 |
| 3 | Ga0055526_1018086 | 3300003771 | Bacteria | 2652 |
| 4 | Ga0065707_10411836 | 3300005295 | Bacteria | 840 |
| 5 | Ga0070658_10102491 | 3300005327 | Bacteria | 2367 |
| 6 | Ga0070676_10032552 | 3300005328 | Bacteria | 2988 |
| 7 | Ga0070676_10920933 | 3300005328 | Bacteria | 652 |
| 8 | Ga0070683_100014532 | 3300005329 | Bacteria | 6891 |
| 9 | Ga0070670_100202578 | 3300005331 | Bacteria | 1725 |
| 10 | Ga0070670_100447193 | 3300005331 | Bacteria | 1145 |
| 11 | Ga0070677_10058589 | 3300005333 | Bacteria | 1582 |
| 12 | Ga0068869_100073753 | 3300005334 | Bacteria | 2531 |
| 13 | Ga0068869_100667149 | 3300005334 | Bacteria | 884 |
| 14 | Ga0070666_10260339 | 3300005335 | Bacteria | 1230 |
| 15 | Ga0070666_10555555 | 3300005335 | Bacteria | 835 |
| 16 | Ga0070680_100056302 | 3300005336 | Bacteria | 3214 |
| 17 | Ga0070682_100000221 | 3300005337 | Bacteria | 41449 |
| 18 | Ga0070682_100036436 | 3300005337 | Bacteria | 3007 |
| 19 | Ga0068868_100061212 | 3300005338 | Bacteria | 2982 |
| 20 | Ga0068868_100071036 | 3300005338 | Bacteria | 2776 |
| 21 | Ga0070660_100323778 | 3300005339 | Bacteria | 1267 |
| 22 | Ga0070689_101404892 | 3300005340 | Bacteria | 631 |
| 23 | Ga0070691_10240693 | 3300005341 | Bacteria | 967 |
| 24 | Ga0070691_10934889 | 3300005341 | Bacteria | 537 |
| 25 | Ga0070661_100090117 | 3300005344 | Bacteria | 2271 |
| 26 | Ga0070661_100243690 | 3300005344 | Bacteria | 1385 |
| 27 | Ga0070692_10308265 | 3300005345 | Bacteria | 969 |
| 28 | Ga0070692_10671824 | 3300005345 | Bacteria | 694 |
| 29 | Ga0070668_100073611 | 3300005347 | Bacteria | 2663 |
| 30 | Ga0070668_100194020 | 3300005347 | Bacteria | 1664 |
| 31 | Ga0070669_100179644 | 3300005353 | Bacteria | 1655 |
| 32 | Ga0070675_100451557 | 3300005354 | Bacteria | 1153 |
| 33 | Ga0070671_100148103 | 3300005355 | Bacteria | 1982 |
| 34 | Ga0070671_100201808 | 3300005355 | Bacteria | 1686 |
| 35 | Ga0070671_100300849 | 3300005355 | Bacteria | 1366 |
| 36 | Ga0070671_100713028 | 3300005355 | Bacteria | 871 |
| 37 | Ga0070674_100973734 | 3300005356 | Bacteria | 743 |
| 38 | Ga0070673_100071969 | 3300005364 | Bacteria | 2779 |
| 39 | Ga0070673_100940013 | 3300005364 | Bacteria | 803 |
| 40 | Ga0070673_101694160 | 3300005364 | Bacteria | 598 |
| 41 | Ga0070688_100422816 | 3300005365 | Bacteria | 991 |
| 42 | Ga0070688_100561755 | 3300005365 | Bacteria | 869 |
| 43 | Ga0070659_100228300 | 3300005366 | Bacteria | 1538 |
| 44 | Ga0070667_100370376 | 3300005367 | Bacteria | 1300 |
| 45 | Ga0070709_10554435 | 3300005434 | Bacteria | 880 |
| 46 | Ga0070714_100342717 | 3300005435 | Bacteria | 1402 |
| 47 | Ga0070713_100009306 | 3300005436 | Bacteria | 7023 |
| 48 | Ga0070710_10425649 | 3300005437 | Bacteria | 895 |
| 49 | Ga0070711_100583234 | 3300005439 | Bacteria | 931 |
| 50 | Ga0070705_101682567 | 3300005440 | Bacteria | 536 |
| 51 | Ga0070700_100290777 | 3300005441 | Bacteria | 1189 |
| 52 | Ga0070700_101261072 | 3300005441 | Bacteria | 620 |
| 53 | Ga0070694_100143654 | 3300005444 | Bacteria | 1736 |
| 54 | Ga0070694_100391491 | 3300005444 | Bacteria | 1086 |
| 55 | Ga0070708_100025495 | 3300005445 | Bacteria | 5054 |
| 56 | Ga0070663_100004680 | 3300005455 | Bacteria | 8069 |
| 57 | Ga0070663_100026089 | 3300005455 | Bacteria | 3953 |
| 58 | Ga0070663_100073751 | 3300005455 | Bacteria | 2490 |
| 59 | Ga0070678_100045978 | 3300005456 | Bacteria | 3127 |
| 60 | Ga0070678_100175261 | 3300005456 | Bacteria | 1750 |
| 61 | Ga0070662_101849616 | 3300005457 | Bacteria | 522 |
| 62 | Ga0070681_10017662 | 3300005458 | Bacteria | 7129 |
| 63 | Ga0070681_10139323 | 3300005458 | Bacteria | 2356 |
| 64 | Ga0070681_10572560 | 3300005458 | Bacteria | 1043 |
| 65 | Ga0070681_10974530 | 3300005458 | Bacteria | 767 |
| 66 | Ga0070681_11431742 | 3300005458 | Bacteria | 615 |
| 67 | Ga0068867_100506098 | 3300005459 | Bacteria | 1039 |
| 68 | Ga0068867_102053583 | 3300005459 | Bacteria | 541 |
| 69 | Ga0070685_11310440 | 3300005466 | Bacteria | 553 |
| 70 | Ga0070706_100003954 | 3300005467 | Bacteria | 14434 |
| 71 | Ga0070706_100148753 | 3300005467 | Bacteria | 2186 |
| 72 | Ga0070706_100670797 | 3300005467 | Bacteria | 962 |
| 73 | Ga0070707_100239877 | 3300005468 | Bacteria | 1764 |
| 74 | Ga0070707_100336420 | 3300005468 | Bacteria | 1467 |
| 75 | Ga0070707_101439549 | 3300005468 | Bacteria | 656 |
| 76 | Ga0070698_100085836 | 3300005471 | Bacteria | 3134 |
| 77 | Ga0070699_100055894 | 3300005518 | Bacteria | 3417 |
| 78 | Ga0070679_100027556 | 3300005530 | Bacteria | 5593 |
| 79 | Ga0070684_100078687 | 3300005535 | Bacteria | 2913 |
| 80 | Ga0068853_100003590 | 3300005539 | Bacteria | 11880 |
| 81 | Ga0070696_100183633 | 3300005546 | Bacteria | 1553 |
| 82 | Ga0070693_100155060 | 3300005547 | Bacteria | 1454 |
| 83 | Ga0070665_100013100 | 3300005548 | Bacteria | 8350 |
| 84 | Ga0070665_100135598 | 3300005548 | Bacteria | 2464 |
| 85 | Ga0070665_100142934 | 3300005548 | Bacteria | 2396 |
| 86 | Ga0070665_100176827 | 3300005548 | Bacteria | 2135 |
| 87 | Ga0070704_100261456 | 3300005549 | Bacteria | 1426 |
| 88 | Ga0068855_100460714 | 3300005563 | Bacteria | 1386 |
| 89 | Ga0070664_100260739 | 3300005564 | Bacteria | 1560 |
| 90 | Ga0070664_100496003 | 3300005564 | Bacteria | 1125 |
| 91 | Ga0068857_100046709 | 3300005577 | Bacteria | 3843 |
| 92 | Ga0068857_100220672 | 3300005577 | Bacteria | 1732 |
| 93 | Ga0068857_101101025 | 3300005577 | Bacteria | 767 |
| 94 | Ga0068854_100353313 | 3300005578 | Bacteria | 1204 |
| 95 | Ga0068856_100513735 | 3300005614 | Bacteria | 1219 |
| 96 | Ga0068856_100944477 | 3300005614 | Bacteria | 881 |
| 97 | Ga0070702_100594126 | 3300005615 | Bacteria | 829 |
| 98 | Ga0068852_100062363 | 3300005616 | Bacteria | 3243 |
| 99 | Ga0068859_100157976 | 3300005617 | Bacteria | 2346 |
| 100 | Ga0068859_101196745 | 3300005617 | Bacteria | 837 |
| 101 | Ga0068864_100031862 | 3300005618 | Bacteria | 4475 |
| 102 | Ga0068864_100189671 | 3300005618 | Bacteria | 1884 |
| 103 | Ga0068861_100311293 | 3300005719 | Bacteria | 1368 |
| 104 | Ga0068861_100455250 | 3300005719 | Bacteria | 1148 |
| 105 | Ga0068861_101478870 | 3300005719 | Bacteria | 666 |
| 106 | Ga0068870_10329634 | 3300005840 | Bacteria | 973 |
| 107 | Ga0068858_100119536 | 3300005842 | Bacteria | 2463 |
| 108 | Ga0068858_100741746 | 3300005842 | Bacteria | 956 |
| 109 | Ga0068860_100369734 | 3300005843 | Bacteria | 1414 |
| 110 | Ga0068860_102578571 | 3300005843 | Bacteria | 528 |
| 111 | Ga0068862_100315519 | 3300005844 | Bacteria | 1442 |
| 112 | Ga0068862_102334027 | 3300005844 | Bacteria | 547 |
| 113 | Ga0081455_10528597 | 3300005937 | Bacteria | 785 |
| 114 | Ga0081540_1026662 | 3300005983 | Bacteria | 3291 |
| 115 | Ga0070717_10000460 | 3300006028 | Bacteria | 25862 |
| 116 | Ga0070717_10283116 | 3300006028 | Bacteria | 1471 |
| 117 | Ga0075365_10016437 | 3300006038 | Bacteria | 4501 |
| 118 | Ga0075365_10075675 | 3300006038 | Bacteria | 2272 |
| 119 | Ga0075368_10067325 | 3300006042 | Bacteria | 1441 |
| 120 | Ga0075363_100014770 | 3300006048 | Bacteria | 3825 |
| 121 | Ga0075363_100253343 | 3300006048 | Bacteria | 1014 |
| 122 | Ga0075364_10058712 | 3300006051 | Bacteria | 2521 |
| 123 | Ga0075364_10573886 | 3300006051 | Bacteria | 771 |
| 124 | Ga0070715_10004544 | 3300006163 | Bacteria | 4565 |
| 125 | Ga0070716_100034174 | 3300006173 | Bacteria | 2786 |
| 126 | Ga0070712_100073635 | 3300006175 | Bacteria | 2451 |
| 127 | Ga0075362_10086410 | 3300006177 | Bacteria | 1451 |
| 128 | Ga0075367_10487685 | 3300006178 | Bacteria | 781 |
| 129 | Ga0075367_10592423 | 3300006178 | Bacteria | 704 |
| 130 | Ga0075367_10882358 | 3300006178 | Bacteria | 570 |
| 131 | Ga0075369_10032572 | 3300006186 | Bacteria | 2206 |
| 132 | Ga0075366_10157772 | 3300006195 | Bacteria | 1374 |
| 133 | Ga0075366_10722754 | 3300006195 | Bacteria | 619 |
| 134 | Ga0097621_100119193 | 3300006237 | Bacteria | 2237 |
| 135 | Ga0097621_100170504 | 3300006237 | Bacteria | 1876 |
| 136 | Ga0075370_10020322 | 3300006353 | Bacteria | 3627 |
| 137 | Ga0075370_10295151 | 3300006353 | Bacteria | 963 |
| 138 | Ga0068871_100031423 | 3300006358 | Bacteria | 4188 |
| 139 | Ga0068871_100104460 | 3300006358 | Bacteria | 2376 |
| 140 | Ga0068871_100776822 | 3300006358 | Bacteria | 882 |
| 141 | Ga0075428_100057254 | 3300006844 | Bacteria | 4267 |
| 142 | Ga0075428_100302984 | 3300006844 | Bacteria | 1718 |
| 143 | Ga0075428_100573781 | 3300006844 | Bacteria | 1205 |
| 144 | Ga0075430_101071662 | 3300006846 | Unclassified | 664 |
| 145 | Ga0075431_100025151 | 3300006847 | Bacteria | 6102 |
| 146 | Ga0075431_100026738 | 3300006847 | Bacteria | 5919 |
| 147 | Ga0075431_100479679 | 3300006847 | Unclassified | 1236 |
| 148 | Ga0075433_10030210 | 3300006852 | Bacteria | 4622 |
| 149 | Ga0075433_10080018 | 3300006852 | Bacteria | 2880 |
| 150 | Ga0075433_10152117 | 3300006852 | Bacteria | 2058 |
| 151 | Ga0075433_10378559 | 3300006852 | Bacteria | 1250 |
| 152 | Ga0075434_100017827 | 3300006871 | Bacteria | 6849 |
| 153 | Ga0075434_100019717 | 3300006871 | Bacteria | 6528 |
| 154 | Ga0075434_100020491 | 3300006871 | Bacteria | 6414 |
| 155 | Ga0075434_100853761 | 3300006871 | Bacteria | 926 |
| 156 | Ga0075429_100071979 | 3300006880 | Bacteria | 3011 |
| 157 | Ga0075429_100754097 | 3300006880 | Bacteria | 853 |
| 158 | Ga0068865_100203545 | 3300006881 | Bacteria | 1538 |
| 159 | Ga0068865_101621525 | 3300006881 | Bacteria | 582 |
| 160 | Ga0075436_100235838 | 3300006914 | Bacteria | 1300 |
| 161 | Ga0075436_100274119 | 3300006914 | Bacteria | 1205 |
| 162 | Ga0097620_100157985 | 3300006931 | Bacteria | 2346 |
| 163 | Ga0097620_101196835 | 3300006931 | Bacteria | 837 |
| 164 | Ga0075435_100009105 | 3300007076 | Bacteria | 7166 |
| 165 | Ga0075435_100010376 | 3300007076 | Bacteria | 6812 |
| 166 | Ga0075435_100569881 | 3300007076 | Bacteria | 981 |
| 167 | Ga0075435_100629483 | 3300007076 | Bacteria | 931 |
| 168 | Ga0099794_10166974 | 3300007265 | Bacteria | 1121 |
| 169 | Ga0099795_10043944 | 3300007788 | Bacteria | 1601 |
| 170 | Ga0105240_10150608 | 3300009093 | Bacteria | 2771 |
| 171 | Ga0105247_10936548 | 3300009101 | Bacteria | 672 |
| 172 | Ga0105247_11337007 | 3300009101 | Bacteria | 577 |
| 173 | Ga0114129_10076430 | 3300009147 | Bacteria | 4662 |
| 174 | Ga0114129_10277424 | 3300009147 | Unclassified | 2240 |
| 175 | Ga0114129_11567761 | 3300009147 | Bacteria | 807 |
| 176 | Ga0105241_12647853 | 3300009174 | Bacteria | 504 |
| 177 | Ga0105242_10343862 | 3300009176 | Bacteria | 1375 |
| 178 | Ga0105248_10168417 | 3300009177 | Bacteria | 2469 |
| 179 | Ga0105237_10106632 | 3300009545 | Bacteria | 2794 |
| 180 | Ga0105237_12447003 | 3300009545 | Bacteria | 532 |
| 181 | Ga0105238_10001743 | 3300009551 | Bacteria | 21842 |
| 182 | Ga0105238_11359587 | 3300009551 | Bacteria | 737 |
| 183 | Ga0105249_11597093 | 3300009553 | Bacteria | 725 |
| 184 | Ga0099796_10009289 | 3300010159 | Bacteria | 2656 |
| 185 | Ga0105239_10232066 | 3300010375 | Bacteria | 2070 |
| 186 | Ga0105239_10409962 | 3300010375 | Bacteria | 1534 |
| 187 | Ga0105239_10649243 | 3300010375 | Bacteria | 1205 |
| 188 | Ga0105239_11311462 | 3300010375 | Bacteria | 835 |
| 189 | Ga0105246_10059340 | 3300011119 | Bacteria | 2654 |
| 190 | Ga0105246_10339704 | 3300011119 | Bacteria | 1227 |
| 191 | Ga0157374_11393289 | 3300013296 | Bacteria | 724 |
| 192 | Ga0163162_10216696 | 3300013306 | Bacteria | 2044 |
| 193 | Ga0163162_10369010 | 3300013306 | Bacteria | 1568 |
| 194 | Ga0163162_11215176 | 3300013306 | Bacteria | 856 |
| 195 | Ga0157375_10295081 | 3300013308 | Bacteria | 1784 |
| 196 | Ga0157379_10060147 | 3300014968 | Bacteria | 3396 |
| 197 | Ga0157379_10368141 | 3300014968 | Bacteria | 1318 |
| 198 | Ga0157379_11541420 | 3300014968 | Bacteria | 647 |
| 199 | Ga0206356_10603777 | 3300020070 | Bacteria | 1039 |
| 200 | Ga0213876_10521498 | 3300021384 | Bacteria | 632 |
| 201 | Ga0209677_101639 | 3300025253 | Bacteria | 9408 |
| 202 | Ga0209148_1006467 | 3300025254 | Bacteria | 2537 |
| 203 | Ga0209455_1001472 | 3300025272 | Bacteria | 10597 |
| 204 | Ga0209564_1000755 | 3300025295 | Bacteria | 45779 |
| 205 | Ga0209758_1005478 | 3300025297 | Bacteria | 9742 |
| 206 | Ga0209758_1081625 | 3300025297 | Bacteria | 976 |
| 207 | Ga0207656_10089015 | 3300025321 | Bacteria | 1398 |
| 208 | Ga0207682_10059177 | 3300025893 | Bacteria | 1601 |
| 209 | Ga0207692_10022084 | 3300025898 | Bacteria | 2924 |
| 210 | Ga0207710_10011063 | 3300025900 | Bacteria | 3801 |
| 211 | Ga0207710_10164150 | 3300025900 | Bacteria | 1083 |
| 212 | Ga0207680_10163305 | 3300025903 | Bacteria | 1495 |
| 213 | Ga0207647_10023917 | 3300025904 | Bacteria | 4034 |
| 214 | Ga0207685_10593758 | 3300025905 | Bacteria | 593 |
| 215 | Ga0207645_10038640 | 3300025907 | Bacteria | 3059 |
| 216 | Ga0207645_10184660 | 3300025907 | Bacteria | 1369 |
| 217 | Ga0207705_10234508 | 3300025909 | Bacteria | 1396 |
| 218 | Ga0207684_10144602 | 3300025910 | Bacteria | 2045 |
| 219 | Ga0207684_10708467 | 3300025910 | Bacteria | 855 |
| 220 | Ga0207654_10014746 | 3300025911 | Bacteria | 4042 |
| 221 | Ga0207707_10001016 | 3300025912 | Bacteria | 26912 |
| 222 | Ga0207695_10511341 | 3300025913 | Bacteria | 1083 |
| 223 | Ga0207671_10031884 | 3300025914 | Bacteria | 3924 |
| 224 | Ga0207671_10083323 | 3300025914 | Bacteria | 2401 |
| 225 | Ga0207693_10009325 | 3300025915 | Bacteria | 8001 |
| 226 | Ga0207663_10208349 | 3300025916 | Bacteria | 1415 |
| 227 | Ga0207660_10000924 | 3300025917 | Bacteria | 19378 |
| 228 | Ga0207660_10965227 | 3300025917 | Bacteria | 695 |
| 229 | Ga0207662_11050334 | 3300025918 | Bacteria | 579 |
| 230 | Ga0207657_10001391 | 3300025919 | Bacteria | 25799 |
| 231 | Ga0207657_10371953 | 3300025919 | Bacteria | 1126 |
| 232 | Ga0207649_10066665 | 3300025920 | Bacteria | 2283 |
| 233 | Ga0207649_10403475 | 3300025920 | Bacteria | 1023 |
| 234 | Ga0207652_10003893 | 3300025921 | Bacteria | 12209 |
| 235 | Ga0207652_10479758 | 3300025921 | Bacteria | 1120 |
| 236 | Ga0207646_10078182 | 3300025922 | Bacteria | 2957 |
| 237 | Ga0207646_10582073 | 3300025922 | Bacteria | 1005 |
| 238 | Ga0207681_10882781 | 3300025923 | Bacteria | 748 |
| 239 | Ga0207694_10836320 | 3300025924 | Bacteria | 778 |
| 240 | Ga0207650_10288457 | 3300025925 | Bacteria | 1338 |
| 241 | Ga0207650_10603917 | 3300025925 | Bacteria | 923 |
| 242 | Ga0207659_10133706 | 3300025926 | Bacteria | 1918 |
| 243 | Ga0207700_10010911 | 3300025928 | Bacteria | 5768 |
| 244 | Ga0207664_10301523 | 3300025929 | Bacteria | 1410 |
| 245 | Ga0207644_10178384 | 3300025931 | Bacteria | 1663 |
| 246 | Ga0207644_10273138 | 3300025931 | Bacteria | 1355 |
| 247 | Ga0207644_10799820 | 3300025931 | Bacteria | 789 |
| 248 | Ga0207690_10164702 | 3300025932 | Bacteria | 1656 |
| 249 | Ga0207690_10336702 | 3300025932 | Bacteria | 1190 |
| 250 | Ga0207706_10195270 | 3300025933 | Bacteria | 1776 |
| 251 | Ga0207686_10256367 | 3300025934 | Bacteria | 1280 |
| 252 | Ga0207670_11523453 | 3300025936 | Bacteria | 568 |
| 253 | Ga0207704_10133658 | 3300025938 | Bacteria | 1723 |
| 254 | Ga0207704_11323176 | 3300025938 | Bacteria | 616 |
| 255 | Ga0207665_10023296 | 3300025939 | Bacteria | 4078 |
| 256 | Ga0207665_10269845 | 3300025939 | Bacteria | 1263 |
| 257 | Ga0207691_10496282 | 3300025940 | Bacteria | 1037 |
| 258 | Ga0207691_10619039 | 3300025940 | Bacteria | 916 |
| 259 | Ga0207691_10685299 | 3300025940 | Bacteria | 865 |
| 260 | Ga0207711_10351249 | 3300025941 | Bacteria | 1365 |
| 261 | Ga0207711_10756306 | 3300025941 | Bacteria | 906 |
| 262 | Ga0207711_11821309 | 3300025941 | Bacteria | 552 |
| 263 | Ga0207689_10083915 | 3300025942 | Bacteria | 2619 |
| 264 | Ga0207689_10717840 | 3300025942 | Bacteria | 843 |
| 265 | Ga0207661_10972709 | 3300025944 | Bacteria | 782 |
| 266 | Ga0207679_10318278 | 3300025945 | Bacteria | 1346 |
| 267 | Ga0207679_10463704 | 3300025945 | Bacteria | 1125 |
| 268 | Ga0207667_10011614 | 3300025949 | Bacteria | 10225 |
| 269 | Ga0207651_10064111 | 3300025960 | Bacteria | 2570 |
| 270 | Ga0207651_11538812 | 3300025960 | Bacteria | 599 |
| 271 | Ga0207712_11470247 | 3300025961 | Bacteria | 610 |
| 272 | Ga0207668_10197224 | 3300025972 | Bacteria | 1600 |
| 273 | Ga0207668_10340694 | 3300025972 | Bacteria | 1250 |
| 274 | Ga0207668_11815114 | 3300025972 | Bacteria | 550 |
| 275 | Ga0207640_10048550 | 3300025981 | Bacteria | 2745 |
| 276 | Ga0207640_10411395 | 3300025981 | Bacteria | 1104 |
| 277 | Ga0207658_10675383 | 3300025986 | Bacteria | 932 |
| 278 | Ga0207677_10110732 | 3300026023 | Bacteria | 2044 |
| 279 | Ga0207677_10633401 | 3300026023 | Bacteria | 942 |
| 280 | Ga0207703_10024373 | 3300026035 | Bacteria | 4761 |
| 281 | Ga0207703_11065545 | 3300026035 | Bacteria | 776 |
| 282 | Ga0207639_10167178 | 3300026041 | Bacteria | 1859 |
| 283 | Ga0207639_10185649 | 3300026041 | Bacteria | 1772 |
| 284 | Ga0207639_10371451 | 3300026041 | Bacteria | 1282 |
| 285 | Ga0207678_10004216 | 3300026067 | Bacteria | 12904 |
| 286 | Ga0207678_10023509 | 3300026067 | Bacteria | 5389 |
| 287 | Ga0207678_10024243 | 3300026067 | Bacteria | 5299 |
| 288 | Ga0207678_10679000 | 3300026067 | Bacteria | 906 |
| 289 | Ga0207678_11032911 | 3300026067 | Bacteria | 728 |
| 290 | Ga0207708_10390452 | 3300026075 | Bacteria | 1149 |
| 291 | Ga0207702_10270405 | 3300026078 | Bacteria | 1603 |
| 292 | Ga0207641_10308005 | 3300026088 | Bacteria | 1498 |
| 293 | Ga0207676_10062764 | 3300026095 | Bacteria | 2948 |
| 294 | Ga0207674_10309414 | 3300026116 | Bacteria | 1529 |
| 295 | Ga0207675_100126297 | 3300026118 | Bacteria | 2423 |
| 296 | Ga0207675_100153144 | 3300026118 | Bacteria | 2196 |
| 297 | Ga0207675_101894648 | 3300026118 | Bacteria | 615 |
| 298 | Ga0207683_10029544 | 3300026121 | Bacteria | 4746 |
| 299 | Ga0207683_10060366 | 3300026121 | Bacteria | 3333 |
| 300 | Ga0207683_10128981 | 3300026121 | Bacteria | 2274 |
| 301 | Ga0207683_10155090 | 3300026121 | Bacteria | 2068 |
| 302 | Ga0207698_10568036 | 3300026142 | Bacteria | 1114 |
| 303 | Ga0207698_11366829 | 3300026142 | Bacteria | 723 |
| 304 | Ga0209179_1008779 | 3300027512 | Bacteria | 1714 |
| 305 | Ga0209588_1019784 | 3300027671 | Bacteria | 2105 |
| 306 | Ga0209813_10219011 | 3300027866 | Bacteria | 712 |
| 307 | Ga0268266_10001136 | 3300028379 | Bacteria | 33101 |
| 308 | Ga0268266_10094515 | 3300028379 | Bacteria | 2624 |
| 309 | Ga0268266_10192293 | 3300028379 | Bacteria | 1864 |
| 310 | Ga0268266_10219898 | 3300028379 | Bacteria | 1745 |
| 311 | Ga0268265_10480048 | 3300028380 | Bacteria | 1167 |
| 312 | Ga0268265_11653270 | 3300028380 | Bacteria | 646 |
| 313 | Ga0268264_10171793 | 3300028381 | Bacteria | 1961 |
| 314 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 315 | Ga0307517_10475056 | 3300028786 | Bacteria | 642 |
| 316 | Ga0307515_10104075 | 3300028794 | Bacteria | 3396 |
| 317 | Ga0265760_10007374 | 3300031090 | Bacteria | 3146 |
| 318 | Ga0307513_10210520 | 3300031456 | Bacteria | 1776 |
| 319 | Ga0307513_10388635 | 3300031456 | Bacteria | 1132 |
| 320 | Ga0307508_10476471 | 3300031616 | Bacteria | 842 |
| 321 | Ga0307508_10716336 | 3300031616 | Bacteria | 611 |
| 322 | Ga0265314_10051287 | 3300031711 | Bacteria | 2875 |
| 323 | Ga0265342_10178301 | 3300031712 | Bacteria | 1165 |
| 324 | Ga0307516_10046388 | 3300031730 | Bacteria | 4287 |
| 325 | Ga0307516_10524733 | 3300031730 | Bacteria | 838 |
| 326 | Ga0307409_101698202 | 3300031995 | Bacteria | 660 |
| 327 | Ga0307415_100297967 | 3300032126 | Bacteria | 1334 |
| 328 | Ga0307415_100801028 | 3300032126 | Bacteria | 860 |
| 329 | Ga0307510_10085315 | 3300033180 | Bacteria | 3035 |
| 330 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 331 | Ga0373930_0019370 | 3300034816 | Bacteria | 1316 |
| 332 | Ga0373958_0037953 | 3300034819 | Bacteria | 974 |
| 333 | Ga0373928_0023752 | 3300035084 | Bacteria | 1310 |
| 334 | Ga0373954_0157631 | 3300035118 | Bacteria | 1110 |
| 335 | Ga0373943_0289074 | 3300035170 | Bacteria | 928 |
| 336 | Ga0373946_0176394 | 3300035171 | Bacteria | 1012 |
| 337 | Ga0373946_0650910 | 3300035171 | Bacteria | 549 |
| 338 | Ga0373931_0003428 | 3300035691 | Bacteria | 7118 |
| 339 | Ga0373935_0439319 | 3300035692 | Bacteria | 941 |
| 340 | Ga0373927_0039246 | 3300035695 | Bacteria | 3073 |
| 341 | Ga0373947_0079581 | 3300035725 | Bacteria | 2026 |
| 342 | Ga0373947_0165966 | 3300035725 | Bacteria | 1430 |
| 343 | Ga0373925_0013452 | 3300037068 | Bacteria | 5923 |
| 344 | Ga0395898_0475635 | 3300037466 | Bacteria | 1189 |
| 345 | Ga0395905_0081275 | 3300037471 | Bacteria | 3037 |
| 346 | Ga0436364_0581979 | 3300037853 | Bacteria | 989 |
| 347 | Ga0436365_0808674 | 3300039437 | Bacteria | 1431 |
| 348 | Ga0451793_1915486 | 3300041452 | Bacteria | 528 |
| 349 | Ga0439458_0107875 | 3300042157 | Bacteria | 727 |
| 350 | Ga0439459_0025347 | 3300042438 | Bacteria | 1170 |
| 351 | Ga0453683_0145307 | 3300044673 | Bacteria | 1497 |
| 352 | Ga0466966_0783188 | 3300044684 | Bacteria | 575 |
| 353 | Ga0466963_0494927 | 3300044694 | Bacteria | 863 |
| 354 | Ga0466971_0686711 | 3300044719 | Unclassified | 514 |
| 355 | Ga0466957_0105153 | 3300044842 | Bacteria | 1784 |
| 356 | Ga0466957_0422959 | 3300044842 | Bacteria | 914 |
| 357 | Ga0466958_0791111 | 3300045836 | Bacteria | 618 |
| 358 | Ga0466967_0130167 | 3300045976 | Bacteria | 2335 |
| 359 | Ga0466967_1077883 | 3300045976 | Bacteria | 800 |
| 360 | Ga0495617_180806 | 3300046452 | Bacteria | 664 |
| 361 | Ga0495638_0348779 | 3300046460 | Bacteria | 782 |
| 362 | Ga0495638_0557939 | 3300046460 | Bacteria | 568 |
| 363 | Ga0495651_0091400 | 3300046462 | Bacteria | 2281 |
| 364 | Ga0495605_0075741 | 3300046474 | Bacteria | 1582 |
| 365 | Ga0495639_0363976 | 3300046475 | Bacteria | 727 |
| 366 | Ga0495584_0097384 | 3300046491 | Bacteria | 1486 |
| 367 | Ga0495594_0070484 | 3300046499 | Bacteria | 1943 |
| 368 | Ga0495594_0656553 | 3300046499 | Bacteria | 594 |
| 369 | Ga0495596_0117331 | 3300046500 | Bacteria | 1034 |
| 370 | Ga0495583_0194043 | 3300046506 | Bacteria | 827 |
| 371 | Ga0495631_0368908 | 3300046518 | Bacteria | 611 |
| 372 | Ga0495632_0249773 | 3300046519 | Bacteria | 796 |
| 373 | Ga0495637_0177353 | 3300046520 | Bacteria | 792 |
| 374 | Ga0495644_0036932 | 3300046523 | Bacteria | 1843 |
| 375 | Ga0495644_0091283 | 3300046523 | Bacteria | 1150 |
| 376 | Ga0495663_0173207 | 3300046525 | Bacteria | 745 |
| 377 | Ga0495642_0157888 | 3300046528 | Bacteria | 983 |
| 378 | Ga0495609_0143684 | 3300046538 | Bacteria | 1017 |
| 379 | Ga0495622_0135417 | 3300046557 | Bacteria | 1120 |
| 380 | Ga0495668_0029504 | 3300046616 | Bacteria | 3099 |
| 381 | Ga0495611_0098496 | 3300046648 | Bacteria | 1356 |
| 382 | Ga0495625_0272457 | 3300046660 | Bacteria | 1092 |
| 383 | Ga0495625_0572893 | 3300046660 | Bacteria | 681 |
| 384 | Ga0495625_0735860 | 3300046660 | Bacteria | 579 |
| 385 | Ga0495588_0412582 | 3300046674 | Bacteria | 709 |
| 386 | Ga0495669_0358943 | 3300046684 | Bacteria | 704 |
| 387 | Ga0495649_0360912 | 3300046694 | Bacteria | 733 |
| 388 | Ga0495600_0148061 | 3300046809 | Bacteria | 1521 |
| 389 | Ga0495636_0097970 | 3300047318 | Bacteria | 1279 |
| 390 | Ga0495674_0395793 | 3300047319 | Bacteria | 1116 |
| 391 | Ga0495674_0550823 | 3300047319 | Bacteria | 918 |
| 392 | Ga0495672_0025981 | 3300047320 | Bacteria | 3742 |
| 393 | Ga0495676_0105143 | 3300047321 | Bacteria | 2082 |
| 394 | Ga0495680_0339143 | 3300047322 | Bacteria | 1049 |
| 395 | Ga0495686_0212111 | 3300047472 | Bacteria | 1106 |
| 396 | Ga0495626_0243389 | 3300048091 | Bacteria | 724 |
| 397 | Ga0496100_0137249 | 3300048903 | Bacteria | 1729 |
| 398 | Ga0496100_0198462 | 3300048903 | Bacteria | 1461 |
| 399 | Ga0496100_0468766 | 3300048903 | Bacteria | 967 |
| 400 | Ga0496100_0739927 | 3300048903 | Bacteria | 769 |
| 401 | Ga0496101_0075055 | 3300048904 | Bacteria | 2488 |
| 402 | Ga0496101_0232477 | 3300048904 | Bacteria | 1433 |
| 403 | Ga0496102_0484942 | 3300048905 | Bacteria | 1158 |
| 404 | Ga0496102_0516631 | 3300048905 | Bacteria | 1117 |
| 405 | Ga0496102_1414131 | 3300048905 | Bacteria | 615 |
| 406 | Ga0496104_0116018 | 3300048907 | Bacteria | 2570 |
| 407 | Ga0496104_0156668 | 3300048907 | Bacteria | 2185 |
| 408 | Ga0496105_0184881 | 3300048908 | Bacteria | 1705 |
| 409 | Ga0496106_0740323 | 3300048909 | Bacteria | 782 |
| 410 | Ga0496107_0319923 | 3300048910 | Bacteria | 1155 |
| 411 | Ga0496107_0374863 | 3300048910 | Bacteria | 1058 |
| 412 | Ga0496107_0474831 | 3300048910 | Bacteria | 928 |
| 413 | Ga0496109_0633094 | 3300048912 | Bacteria | 1006 |
| 414 | Ga0496109_0723497 | 3300048912 | Bacteria | 933 |
| 415 | Ga0496109_1187330 | 3300048912 | Bacteria | 700 |
| 416 | Ga0496110_0557313 | 3300048913 | Bacteria | 1041 |
| 417 | Ga0496111_0377439 | 3300048914 | Bacteria | 1048 |
| 418 | Ga0496111_0859534 | 3300048914 | Bacteria | 654 |
| 419 | Ga0496112_0012229 | 3300048915 | Bacteria | 7879 |
| 420 | Ga0496113_0278216 | 3300048916 | Bacteria | 1338 |
| 421 | Ga0496114_0476359 | 3300048917 | Bacteria | 1104 |
| 422 | Ga0496114_0756656 | 3300048917 | Bacteria | 849 |
| 423 | Ga0496115_0019746 | 3300048918 | Bacteria | 5189 |
| 424 | Ga0496115_0453317 | 3300048918 | Bacteria | 1036 |
| 425 | Ga0496117_0126187 | 3300048920 | Bacteria | 1561 |
| 426 | Ga0496118_0065065 | 3300048921 | Bacteria | 2670 |
| 427 | Ga0496118_0393509 | 3300048921 | Bacteria | 722 |
| 428 | Ga0496119_0250125 | 3300048922 | Bacteria | 894 |
| 429 | Ga0496121_0000265 | 3300048924 | Bacteria | 109251 |
| 430 | Ga0496121_0011280 | 3300048924 | Bacteria | 9954 |
| 431 | Ga0496121_0011669 | 3300048924 | Bacteria | 9712 |
| 432 | Ga0496121_0028222 | 3300048924 | Bacteria | 5229 |
| 433 | Ga0496121_0040223 | 3300048924 | Bacteria | 4105 |
| 434 | Ga0496121_0155945 | 3300048924 | Bacteria | 1675 |
| 435 | Ga0496121_0237950 | 3300048924 | Bacteria | 1271 |
| 436 | Ga0496121_0627412 | 3300048924 | Bacteria | 659 |
| 437 | Ga0496122_0090249 | 3300048925 | Bacteria | 2092 |
| 438 | Ga0496122_0093188 | 3300048925 | Bacteria | 2044 |
| 439 | Ga0496124_0238547 | 3300048927 | Bacteria | 1354 |
| 440 | Ga0496124_0794302 | 3300048927 | Bacteria | 587 |
| 441 | Ga0496125_0000176 | 3300048928 | Bacteria | 140746 |
| 442 | Ga0496125_0001764 | 3300048928 | Bacteria | 30006 |
| 443 | Ga0496125_0096343 | 3300048928 | Bacteria | 2197 |
| 444 | Ga0496126_0011852 | 3300048929 | Bacteria | 8969 |
| 445 | Ga0496126_0026811 | 3300048929 | Bacteria | 5517 |
| 446 | Ga0496126_0072217 | 3300048929 | Bacteria | 3070 |
| 447 | Ga0496126_0084815 | 3300048929 | Bacteria | 2793 |
| 448 | Ga0495682_0169008 | 3300049460 | Bacteria | 778 |
| 449 | Ga0501075_0775252 | 3300049591 | Bacteria | 730 |
| 450 | Ga0501222_015334 | 3300049662 | Bacteria | 1013 |
| 451 | nmdc:mga03683_107519_c1 | 3300050489 | Bacteria | 1230 |
| 452 | nmdc:mga03n38_12993_c1 | 3300050490 | Bacteria | 3150 |
| 453 | nmdc:mga03n38_209348_c1 | 3300050490 | Bacteria | 1013 |
| 454 | nmdc:mga03n38_269137_c1 | 3300050490 | Bacteria | 906 |
| 455 | nmdc:mga00v17_86774_c1 | 3300050491 | Bacteria | 1961 |
| 456 | nmdc:mga0yw44_234364_c1 | 3300050492 | Bacteria | 1219 |
| 457 | nmdc:mga0yw44_31797_c1 | 3300050492 | Bacteria | 3071 |
| 458 | nmdc:mga0k408_148173_c1 | 3300050493 | Bacteria | 1397 |
| 459 | nmdc:mga0k408_339683_c1 | 3300050493 | Bacteria | 895 |
| 460 | nmdc:mga06z11_8466_c1 | 3300050494 | Bacteria | 4291 |
| 461 | nmdc:mga06z11_93967_c1 | 3300050494 | Bacteria | 1633 |
| 462 | nmdc:mga07m45_54052_c1 | 3300050496 | Bacteria | 2270 |
| 463 | nmdc:mga05p37_18843_c1 | 3300050507 | Bacteria | 8342 |
| 464 | nmdc:mga05p37_224925_c1 | 3300050507 | Bacteria | 2263 |
| 465 | nmdc:mga05p37_776602_c1 | 3300050507 | Bacteria | 1052 |
| 466 | nmdc:mga05p37_954601_c1 | 3300050507 | Bacteria | 917 |
| 467 | nmdc:mga09592_216059_c1 | 3300050508 | Bacteria | 1661 |
| 468 | nmdc:mga09592_24966_c1 | 3300050508 | Bacteria | 4943 |
| 469 | nmdc:mga06r32_138185_c1 | 3300050510 | Bacteria | 2411 |
| 470 | nmdc:mga06r32_30783_c1 | 3300050510 | Bacteria | 5036 |
| 471 | nmdc:mga0n895_19007_c1 | 3300050512 | Bacteria | 6375 |
| 472 | nmdc:mga0n895_314959_c1 | 3300050512 | Bacteria | 1586 |
| 473 | nmdc:mga0n895_624675_c1 | 3300050512 | Bacteria | 1078 |
| 474 | nmdc:mga0rr50_27386_c1 | 3300050513 | Bacteria | 3990 |
| 475 | nmdc:mga0rr50_618406_c1 | 3300050513 | Bacteria | 924 |
| 476 | nmdc:mga0rr50_9591_c1 | 3300050513 | Bacteria | 6096 |
| 477 | nmdc:mga0a205_511301_c1 | 3300050515 | Bacteria | 1058 |
| 478 | nmdc:mga0a205_84393_c1 | 3300050515 | Bacteria | 3068 |
| 479 | nmdc:mga0sz30_150718_c1 | 3300050516 | Bacteria | 1029 |
| 480 | Ga0495601_0237194 | 3300053077 | Bacteria | 1191 |
| 481 | Ga0495655_0033704 | 3300053083 | Bacteria | 1262 |
| 482 | Ga0495655_0255220 | 3300053083 | Bacteria | 591 |
| 483 | Ga0495595_0031235 | 3300053084 | Bacteria | 2393 |
| 484 | Ga0495619_0098538 | 3300053085 | Bacteria | 1987 |
| 485 | Ga0500583_0098116 | 3300053092 | Bacteria | 1432 |
| 486 | Ga0500651_0365693 | 3300053093 | Bacteria | 816 |
| 487 | Ga0500641_0024457 | 3300053096 | Bacteria | 2329 |
| 488 | Ga0500641_0106397 | 3300053096 | Bacteria | 1206 |
| 489 | Ga0500562_147700 | 3300053108 | Bacteria | 640 |
| 490 | Ga0500569_018952 | 3300053109 | Bacteria | 1785 |
| 491 | Ga0500561_0058078 | 3300053137 | Bacteria | 1076 |
| 492 | Ga0500568_0076768 | 3300053139 | Bacteria | 1272 |
| 493 | Ga0500588_0105843 | 3300053146 | Bacteria | 976 |
| 494 | Ga0500603_063804 | 3300053150 | Bacteria | 1036 |
| 495 | Ga0466962_0063179 | 3300061719 | Bacteria | 1768 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050489 | nmdc:mga03683_107519_c1 | nmdc:mga03683_107519_c1_875_1210 | 111 |
| 2 | iso_pu_bacteria | 2524023210 | 2524465863 | 133 |
| 3 | 3300010375 | Ga0105239_10649243 | Ga0105239_106492432 | 134 |
| 4 | 3300013306 | Ga0163162_10216696 | Ga0163162_102166963 | 134 |
| 5 | 3300035692 | Ga0373935_0439319 | Ga0373935_0439319_66_470 | 134 |
| 6 | 3300046674 | Ga0495588_0412582 | Ga0495588_0412582_119_523 | 134 |
| 7 | 3300048903 | Ga0496100_0137249 | Ga0496100_0137249_438_842 | 134 |
| 8 | 3300048904 | Ga0496101_0232477 | Ga0496101_0232477_150_554 | 134 |
| 9 | 3300048905 | Ga0496102_0516631 | Ga0496102_0516631_258_662 | 134 |
| 10 | 3300048917 | Ga0496114_0756656 | Ga0496114_0756656_159_563 | 134 |
| 11 | 3300005344 | Ga0070661_100243690 | Ga0070661_1002436901 | 135 |
| 12 | 3300005355 | Ga0070671_100713028 | Ga0070671_1007130281 | 135 |
| 13 | 3300005455 | Ga0070663_100073751 | Ga0070663_1000737513 | 135 |
| 14 | 3300005548 | Ga0070665_100013100 | Ga0070665_1000131002 | 135 |
| 15 | 3300005617 | Ga0068859_101196745 | Ga0068859_1011967451 | 135 |
| 16 | 3300005842 | Ga0068858_100741746 | Ga0068858_1007417462 | 135 |
| 17 | 3300006038 | Ga0075365_10016437 | Ga0075365_100164374 | 135 |
| 18 | 3300006048 | Ga0075363_100014770 | Ga0075363_1000147706 | 135 |
| 19 | 3300006195 | Ga0075366_10157772 | Ga0075366_101577723 | 135 |
| 20 | 3300006353 | Ga0075370_10020322 | Ga0075370_100203225 | 135 |
| 21 | 3300006358 | Ga0068871_100776822 | Ga0068871_1007768222 | 135 |
| 22 | 3300006931 | Ga0097620_101196835 | Ga0097620_1011968352 | 135 |
| 23 | 3300009545 | Ga0105237_12447003 | Ga0105237_124470031 | 135 |
| 24 | 3300014968 | Ga0157379_11541420 | Ga0157379_115414201 | 135 |
| 25 | 3300025297 | Ga0209758_1081625 | Ga0209758_10816252 | 135 |
| 26 | 3300025900 | Ga0207710_10164150 | Ga0207710_101641502 | 135 |
| 27 | 3300025920 | Ga0207649_10403475 | Ga0207649_104034752 | 135 |
| 28 | 3300025940 | Ga0207691_10685299 | Ga0207691_106852992 | 135 |
| 29 | 3300026067 | Ga0207678_10023509 | Ga0207678_100235092 | 135 |
| 30 | 3300028379 | Ga0268266_10001136 | Ga0268266_1000113619 | 135 |
| 31 | 3300041452 | Ga0451793_1915486 | Ga0451793_1915486_65_472 | 135 |
| 32 | 3300048903 | Ga0496100_0739927 | Ga0496100_0739927_154_567 | 135 |
| 33 | 3300048912 | Ga0496109_0723497 | Ga0496109_0723497_440_853 | 135 |
| 34 | 3300050490 | nmdc:mga03n38_12993_c1 | nmdc:mga03n38_12993_c1_1941_2354 | 135 |
| 35 | 3300050491 | nmdc:mga00v17_86774_c1 | nmdc:mga00v17_86774_c1_692_1105 | 135 |
| 36 | 3300050492 | nmdc:mga0yw44_31797_c1 | nmdc:mga0yw44_31797_c1_1424_1837 | 135 |
| 37 | 3300050493 | nmdc:mga0k408_148173_c1 | nmdc:mga0k408_148173_c1_15_428 | 135 |
| 38 | 3300050494 | nmdc:mga06z11_8466_c1 | nmdc:mga06z11_8466_c1_2755_3168 | 135 |
| 39 | 3300050496 | nmdc:mga07m45_54052_c1 | nmdc:mga07m45_54052_c1_1267_1680 | 135 |
| 40 | 3300006844 | Ga0075428_100302984 | Ga0075428_1003029841 | 136 |
| 41 | 3300003215 | JGI25153J46596_10010032 | JGI25153J46596_100100321 | 137 |
| 42 | 3300003771 | Ga0055526_1018086 | Ga0055526_10180862 | 137 |
| 43 | 3300005333 | Ga0070677_10058589 | Ga0070677_100585892 | 137 |
| 44 | 3300005341 | Ga0070691_10934889 | Ga0070691_109348891 | 137 |
| 45 | 3300005355 | Ga0070671_100148103 | Ga0070671_1001481032 | 137 |
| 46 | 3300005364 | Ga0070673_101694160 | Ga0070673_1016941601 | 137 |
| 47 | 3300005365 | Ga0070688_100561755 | Ga0070688_1005617552 | 137 |
| 48 | 3300005437 | Ga0070710_10425649 | Ga0070710_104256492 | 137 |
| 49 | 3300005614 | Ga0068856_100513735 | Ga0068856_1005137352 | 137 |
| 50 | 3300006051 | Ga0075364_10573886 | Ga0075364_105738862 | 137 |
| 51 | 3300006173 | Ga0070716_100034174 | Ga0070716_1000341744 | 137 |
| 52 | 3300006175 | Ga0070712_100073635 | Ga0070712_1000736351 | 137 |
| 53 | 3300006177 | Ga0075362_10086410 | Ga0075362_100864103 | 137 |
| 54 | 3300006195 | Ga0075366_10722754 | Ga0075366_107227541 | 137 |
| 55 | 3300007788 | Ga0099795_10043944 | Ga0099795_100439442 | 137 |
| 56 | 3300009176 | Ga0105242_10343862 | Ga0105242_103438622 | 137 |
| 57 | 3300009177 | Ga0105248_10168417 | Ga0105248_101684174 | 137 |
| 58 | 3300009545 | Ga0105237_10106632 | Ga0105237_101066323 | 137 |
| 59 | 3300009553 | Ga0105249_11597093 | Ga0105249_115970931 | 137 |
| 60 | 3300010159 | Ga0099796_10009289 | Ga0099796_100092893 | 137 |
| 61 | 3300010375 | Ga0105239_10409962 | Ga0105239_104099621 | 137 |
| 62 | 3300011119 | Ga0105246_10339704 | Ga0105246_103397042 | 137 |
| 63 | 3300013296 | Ga0157374_11393289 | Ga0157374_113932891 | 137 |
| 64 | 3300013306 | Ga0163162_11215176 | Ga0163162_112151761 | 137 |
| 65 | 3300025295 | Ga0209564_1000755 | Ga0209564_100075541 | 137 |
| 66 | 3300025297 | Ga0209758_1005478 | Ga0209758_10054784 | 137 |
| 67 | 3300025893 | Ga0207682_10059177 | Ga0207682_100591773 | 137 |
| 68 | 3300025898 | Ga0207692_10022084 | Ga0207692_100220841 | 137 |
| 69 | 3300025915 | Ga0207693_10009325 | Ga0207693_100093259 | 137 |
| 70 | 3300025931 | Ga0207644_10799820 | Ga0207644_107998201 | 137 |
| 71 | 3300025939 | Ga0207665_10023296 | Ga0207665_100232965 | 137 |
| 72 | 3300025941 | Ga0207711_10756306 | Ga0207711_107563061 | 137 |
| 73 | 3300025944 | Ga0207661_10972709 | Ga0207661_109727091 | 137 |
| 74 | 3300025960 | Ga0207651_11538812 | Ga0207651_115388121 | 137 |
| 75 | 3300025961 | Ga0207712_11470247 | Ga0207712_114702471 | 137 |
| 76 | 3300025972 | Ga0207668_11815114 | Ga0207668_118151141 | 137 |
| 77 | 3300026023 | Ga0207677_10633401 | Ga0207677_106334012 | 137 |
| 78 | 3300026035 | Ga0207703_11065545 | Ga0207703_110655452 | 137 |
| 79 | 3300026121 | Ga0207683_10128981 | Ga0207683_101289814 | 137 |
| 80 | 3300026142 | Ga0207698_10568036 | Ga0207698_105680361 | 137 |
| 81 | 3300027512 | Ga0209179_1008779 | Ga0209179_10087792 | 137 |
| 82 | 3300027671 | Ga0209588_1019784 | Ga0209588_10197843 | 137 |
| 83 | 3300031995 | Ga0307409_101698202 | Ga0307409_1016982022 | 137 |
| 84 | 3300032126 | Ga0307415_100801028 | Ga0307415_1008010282 | 137 |
| 85 | 3300034816 | Ga0373930_0019370 | Ga0373930_0019370_620_1129 | 137 |
| 86 | 3300034819 | Ga0373958_0037953 | Ga0373958_0037953_293_802 | 137 |
| 87 | 3300035084 | Ga0373928_0023752 | Ga0373928_0023752_621_1130 | 137 |
| 88 | 3300035170 | Ga0373943_0289074 | Ga0373943_0289074_100_567 | 137 |
| 89 | 3300035171 | Ga0373946_0176394 | Ga0373946_0176394_535_1002 | 137 |
| 90 | 3300035171 | Ga0373946_0650910 | Ga0373946_0650910_107_520 | 137 |
| 91 | 3300035691 | Ga0373931_0003428 | Ga0373931_0003428_2114_2623 | 137 |
| 92 | 3300035695 | Ga0373927_0039246 | Ga0373927_0039246_710_1177 | 137 |
| 93 | 3300035725 | Ga0373947_0079581 | Ga0373947_0079581_735_1244 | 137 |
| 94 | 3300035725 | Ga0373947_0165966 | Ga0373947_0165966_305_718 | 137 |
| 95 | 3300037068 | Ga0373925_0013452 | Ga0373925_0013452_4902_5369 | 137 |
| 96 | 3300046452 | Ga0495617_180806 | Ga0495617_180806_183_596 | 137 |
| 97 | 3300046460 | Ga0495638_0557939 | Ga0495638_0557939_130_549 | 137 |
| 98 | 3300046499 | Ga0495594_0656553 | Ga0495594_0656553_52_519 | 137 |
| 99 | 3300046500 | Ga0495596_0117331 | Ga0495596_0117331_401_814 | 137 |
| 100 | 3300046523 | Ga0495644_0091283 | Ga0495644_0091283_152_565 | 137 |
| 101 | 3300046648 | Ga0495611_0098496 | Ga0495611_0098496_393_812 | 137 |
| 102 | 3300047319 | Ga0495674_0550823 | Ga0495674_0550823_302_769 | 137 |
| 103 | 3300048903 | Ga0496100_0198462 | Ga0496100_0198462_649_1158 | 137 |
| 104 | 3300048904 | Ga0496101_0075055 | Ga0496101_0075055_1220_1729 | 137 |
| 105 | 3300048905 | Ga0496102_0484942 | Ga0496102_0484942_346_855 | 137 |
| 106 | 3300048907 | Ga0496104_0156668 | Ga0496104_0156668_1530_2039 | 137 |
| 107 | 3300048908 | Ga0496105_0184881 | Ga0496105_0184881_397_906 | 137 |
| 108 | 3300048909 | Ga0496106_0740323 | Ga0496106_0740323_304_717 | 137 |
| 109 | 3300048912 | Ga0496109_0633094 | Ga0496109_0633094_75_488 | 137 |
| 110 | 3300048913 | Ga0496110_0557313 | Ga0496110_0557313_554_967 | 137 |
| 111 | 3300048914 | Ga0496111_0377439 | Ga0496111_0377439_177_686 | 137 |
| 112 | 3300048915 | Ga0496112_0012229 | Ga0496112_0012229_2894_3403 | 137 |
| 113 | 3300048917 | Ga0496114_0476359 | Ga0496114_0476359_71_484 | 137 |
| 114 | 3300048918 | Ga0496115_0019746 | Ga0496115_0019746_1104_1613 | 137 |
| 115 | 3300048924 | Ga0496121_0237950 | Ga0496121_0237950_146_559 | 137 |
| 116 | 3300048925 | Ga0496122_0093188 | Ga0496122_0093188_519_932 | 137 |
| 117 | 3300048927 | Ga0496124_0238547 | Ga0496124_0238547_661_1074 | 137 |
| 118 | 3300048929 | Ga0496126_0011852 | Ga0496126_0011852_5554_5967 | 137 |
| 119 | 3300049662 | Ga0501222_015334 | Ga0501222_015334_568_987 | 137 |
| 120 | 3300053092 | Ga0500583_0098116 | Ga0500583_0098116_380_799 | 137 |
| 121 | 3300002075 | JGI24738J21930_10039071 | JGI24738J21930_100390712 | 138 |
| 122 | 3300005295 | Ga0065707_10411836 | Ga0065707_104118362 | 138 |
| 123 | 3300005327 | Ga0070658_10102491 | Ga0070658_101024914 | 138 |
| 124 | 3300005328 | Ga0070676_10032552 | Ga0070676_100325522 | 138 |
| 125 | 3300005328 | Ga0070676_10920933 | Ga0070676_109209331 | 138 |
| 126 | 3300005329 | Ga0070683_100014532 | Ga0070683_1000145327 | 138 |
| 127 | 3300005331 | Ga0070670_100202578 | Ga0070670_1002025782 | 138 |
| 128 | 3300005331 | Ga0070670_100447193 | Ga0070670_1004471932 | 138 |
| 129 | 3300005334 | Ga0068869_100073753 | Ga0068869_1000737533 | 138 |
| 130 | 3300005334 | Ga0068869_100667149 | Ga0068869_1006671491 | 138 |
| 131 | 3300005335 | Ga0070666_10260339 | Ga0070666_102603392 | 138 |
| 132 | 3300005335 | Ga0070666_10555555 | Ga0070666_105555551 | 138 |
| 133 | 3300005336 | Ga0070680_100056302 | Ga0070680_1000563024 | 138 |
| 134 | 3300005337 | Ga0070682_100000221 | Ga0070682_10000022122 | 138 |
| 135 | 3300005337 | Ga0070682_100036436 | Ga0070682_1000364364 | 138 |
| 136 | 3300005338 | Ga0068868_100061212 | Ga0068868_1000612122 | 138 |
| 137 | 3300005338 | Ga0068868_100071036 | Ga0068868_1000710361 | 138 |
| 138 | 3300005339 | Ga0070660_100323778 | Ga0070660_1003237782 | 138 |
| 139 | 3300005340 | Ga0070689_101404892 | Ga0070689_1014048921 | 138 |
| 140 | 3300005341 | Ga0070691_10240693 | Ga0070691_102406931 | 138 |
| 141 | 3300005344 | Ga0070661_100090117 | Ga0070661_1000901174 | 138 |
| 142 | 3300005345 | Ga0070692_10308265 | Ga0070692_103082651 | 138 |
| 143 | 3300005345 | Ga0070692_10671824 | Ga0070692_106718241 | 138 |
| 144 | 3300005347 | Ga0070668_100073611 | Ga0070668_1000736112 | 138 |
| 145 | 3300005347 | Ga0070668_100194020 | Ga0070668_1001940203 | 138 |
| 146 | 3300005353 | Ga0070669_100179644 | Ga0070669_1001796441 | 138 |
| 147 | 3300005354 | Ga0070675_100451557 | Ga0070675_1004515572 | 138 |
| 148 | 3300005355 | Ga0070671_100201808 | Ga0070671_1002018082 | 138 |
| 149 | 3300005355 | Ga0070671_100300849 | Ga0070671_1003008493 | 138 |
| 150 | 3300005356 | Ga0070674_100973734 | Ga0070674_1009737342 | 138 |
| 151 | 3300005364 | Ga0070673_100071969 | Ga0070673_1000719693 | 138 |
| 152 | 3300005364 | Ga0070673_100940013 | Ga0070673_1009400132 | 138 |
| 153 | 3300005365 | Ga0070688_100422816 | Ga0070688_1004228162 | 138 |
| 154 | 3300005366 | Ga0070659_100228300 | Ga0070659_1002283003 | 138 |
| 155 | 3300005367 | Ga0070667_100370376 | Ga0070667_1003703762 | 138 |
| 156 | 3300005434 | Ga0070709_10554435 | Ga0070709_105544352 | 138 |
| 157 | 3300005435 | Ga0070714_100342717 | Ga0070714_1003427171 | 138 |
| 158 | 3300005436 | Ga0070713_100009306 | Ga0070713_1000093062 | 138 |
| 159 | 3300005439 | Ga0070711_100583234 | Ga0070711_1005832341 | 138 |
| 160 | 3300005440 | Ga0070705_101682567 | Ga0070705_1016825671 | 138 |
| 161 | 3300005441 | Ga0070700_100290777 | Ga0070700_1002907771 | 138 |
| 162 | 3300005441 | Ga0070700_101261072 | Ga0070700_1012610721 | 138 |
| 163 | 3300005444 | Ga0070694_100143654 | Ga0070694_1001436542 | 138 |
| 164 | 3300005444 | Ga0070694_100391491 | Ga0070694_1003914911 | 138 |
| 165 | 3300005445 | Ga0070708_100025495 | Ga0070708_1000254951 | 138 |
| 166 | 3300005455 | Ga0070663_100004680 | Ga0070663_1000046806 | 138 |
| 167 | 3300005455 | Ga0070663_100026089 | Ga0070663_1000260893 | 138 |
| 168 | 3300005456 | Ga0070678_100045978 | Ga0070678_1000459783 | 138 |
| 169 | 3300005456 | Ga0070678_100175261 | Ga0070678_1001752612 | 138 |
| 170 | 3300005457 | Ga0070662_101849616 | Ga0070662_1018496161 | 138 |
| 171 | 3300005458 | Ga0070681_10017662 | Ga0070681_100176628 | 138 |
| 172 | 3300005458 | Ga0070681_10139323 | Ga0070681_101393233 | 138 |
| 173 | 3300005458 | Ga0070681_10572560 | Ga0070681_105725602 | 138 |
| 174 | 3300005458 | Ga0070681_10974530 | Ga0070681_109745302 | 138 |
| 175 | 3300005458 | Ga0070681_11431742 | Ga0070681_114317421 | 138 |
| 176 | 3300005459 | Ga0068867_100506098 | Ga0068867_1005060982 | 138 |
| 177 | 3300005459 | Ga0068867_102053583 | Ga0068867_1020535831 | 138 |
| 178 | 3300005466 | Ga0070685_11310440 | Ga0070685_113104401 | 138 |
| 179 | 3300005467 | Ga0070706_100003954 | Ga0070706_10000395415 | 138 |
| 180 | 3300005467 | Ga0070706_100148753 | Ga0070706_1001487532 | 138 |
| 181 | 3300005467 | Ga0070706_100670797 | Ga0070706_1006707971 | 138 |
| 182 | 3300005468 | Ga0070707_100239877 | Ga0070707_1002398772 | 138 |
| 183 | 3300005468 | Ga0070707_100336420 | Ga0070707_1003364202 | 138 |
| 184 | 3300005468 | Ga0070707_101439549 | Ga0070707_1014395491 | 138 |
| 185 | 3300005471 | Ga0070698_100085836 | Ga0070698_1000858364 | 138 |
| 186 | 3300005518 | Ga0070699_100055894 | Ga0070699_1000558942 | 138 |
| 187 | 3300005530 | Ga0070679_100027556 | Ga0070679_1000275567 | 138 |
| 188 | 3300005535 | Ga0070684_100078687 | Ga0070684_1000786874 | 138 |
| 189 | 3300005539 | Ga0068853_100003590 | Ga0068853_10000359013 | 138 |
| 190 | 3300005546 | Ga0070696_100183633 | Ga0070696_1001836332 | 138 |
| 191 | 3300005547 | Ga0070693_100155060 | Ga0070693_1001550602 | 138 |
| 192 | 3300005548 | Ga0070665_100135598 | Ga0070665_1001355984 | 138 |
| 193 | 3300005548 | Ga0070665_100142934 | Ga0070665_1001429342 | 138 |
| 194 | 3300005548 | Ga0070665_100176827 | Ga0070665_1001768271 | 138 |
| 195 | 3300005549 | Ga0070704_100261456 | Ga0070704_1002614562 | 138 |
| 196 | 3300005563 | Ga0068855_100460714 | Ga0068855_1004607143 | 138 |
| 197 | 3300005564 | Ga0070664_100260739 | Ga0070664_1002607392 | 138 |
| 198 | 3300005564 | Ga0070664_100496003 | Ga0070664_1004960032 | 138 |
| 199 | 3300005577 | Ga0068857_100046709 | Ga0068857_1000467093 | 138 |
| 200 | 3300005577 | Ga0068857_100220672 | Ga0068857_1002206723 | 138 |
| 201 | 3300005577 | Ga0068857_101101025 | Ga0068857_1011010252 | 138 |
| 202 | 3300005578 | Ga0068854_100353313 | Ga0068854_1003533131 | 138 |
| 203 | 3300005614 | Ga0068856_100944477 | Ga0068856_1009444772 | 138 |
| 204 | 3300005615 | Ga0070702_100594126 | Ga0070702_1005941261 | 138 |
| 205 | 3300005616 | Ga0068852_100062363 | Ga0068852_1000623632 | 138 |
| 206 | 3300005617 | Ga0068859_100157976 | Ga0068859_1001579762 | 138 |
| 207 | 3300005618 | Ga0068864_100031862 | Ga0068864_1000318626 | 138 |
| 208 | 3300005618 | Ga0068864_100189671 | Ga0068864_1001896714 | 138 |
| 209 | 3300005719 | Ga0068861_100311293 | Ga0068861_1003112933 | 138 |
| 210 | 3300005719 | Ga0068861_100455250 | Ga0068861_1004552502 | 138 |
| 211 | 3300005719 | Ga0068861_101478870 | Ga0068861_1014788701 | 138 |
| 212 | 3300005840 | Ga0068870_10329634 | Ga0068870_103296342 | 138 |
| 213 | 3300005842 | Ga0068858_100119536 | Ga0068858_1001195364 | 138 |
| 214 | 3300005843 | Ga0068860_100369734 | Ga0068860_1003697342 | 138 |
| 215 | 3300005843 | Ga0068860_102578571 | Ga0068860_1025785711 | 138 |
| 216 | 3300005844 | Ga0068862_100315519 | Ga0068862_1003155192 | 138 |
| 217 | 3300005844 | Ga0068862_102334027 | Ga0068862_1023340271 | 138 |
| 218 | 3300005937 | Ga0081455_10528597 | Ga0081455_105285972 | 138 |
| 219 | 3300005983 | Ga0081540_1026662 | Ga0081540_10266623 | 138 |
| 220 | 3300006028 | Ga0070717_10000460 | Ga0070717_1000046011 | 138 |
| 221 | 3300006028 | Ga0070717_10283116 | Ga0070717_102831162 | 138 |
| 222 | 3300006038 | Ga0075365_10075675 | Ga0075365_100756753 | 138 |
| 223 | 3300006042 | Ga0075368_10067325 | Ga0075368_100673252 | 138 |
| 224 | 3300006048 | Ga0075363_100253343 | Ga0075363_1002533432 | 138 |
| 225 | 3300006051 | Ga0075364_10058712 | Ga0075364_100587124 | 138 |
| 226 | 3300006163 | Ga0070715_10004544 | Ga0070715_100045447 | 138 |
| 227 | 3300006178 | Ga0075367_10487685 | Ga0075367_104876852 | 138 |
| 228 | 3300006178 | Ga0075367_10592423 | Ga0075367_105924231 | 138 |
| 229 | 3300006178 | Ga0075367_10882358 | Ga0075367_108823581 | 138 |
| 230 | 3300006186 | Ga0075369_10032572 | Ga0075369_100325724 | 138 |
| 231 | 3300006237 | Ga0097621_100119193 | Ga0097621_1001191932 | 138 |
| 232 | 3300006237 | Ga0097621_100170504 | Ga0097621_1001705043 | 138 |
| 233 | 3300006353 | Ga0075370_10295151 | Ga0075370_102951512 | 138 |
| 234 | 3300006358 | Ga0068871_100031423 | Ga0068871_1000314235 | 138 |
| 235 | 3300006358 | Ga0068871_100104460 | Ga0068871_1001044604 | 138 |
| 236 | 3300006844 | Ga0075428_100057254 | Ga0075428_1000572544 | 138 |
| 237 | 3300006844 | Ga0075428_100573781 | Ga0075428_1005737812 | 138 |
| 238 | 3300006846 | Ga0075430_101071662 | Ga0075430_1010716621 | 138 |
| 239 | 3300006847 | Ga0075431_100025151 | Ga0075431_1000251513 | 138 |
| 240 | 3300006847 | Ga0075431_100026738 | Ga0075431_1000267383 | 138 |
| 241 | 3300006847 | Ga0075431_100479679 | Ga0075431_1004796792 | 138 |
| 242 | 3300006852 | Ga0075433_10030210 | Ga0075433_100302104 | 138 |
| 243 | 3300006852 | Ga0075433_10080018 | Ga0075433_100800184 | 138 |
| 244 | 3300006852 | Ga0075433_10152117 | Ga0075433_101521172 | 138 |
| 245 | 3300006852 | Ga0075433_10378559 | Ga0075433_103785591 | 138 |
| 246 | 3300006871 | Ga0075434_100017827 | Ga0075434_1000178273 | 138 |
| 247 | 3300006871 | Ga0075434_100019717 | Ga0075434_1000197172 | 138 |
| 248 | 3300006871 | Ga0075434_100020491 | Ga0075434_1000204918 | 138 |
| 249 | 3300006871 | Ga0075434_100853761 | Ga0075434_1008537612 | 138 |
| 250 | 3300006880 | Ga0075429_100071979 | Ga0075429_1000719792 | 138 |
| 251 | 3300006880 | Ga0075429_100754097 | Ga0075429_1007540971 | 138 |
| 252 | 3300006881 | Ga0068865_100203545 | Ga0068865_1002035453 | 138 |
| 253 | 3300006881 | Ga0068865_101621525 | Ga0068865_1016215251 | 138 |
| 254 | 3300006914 | Ga0075436_100235838 | Ga0075436_1002358381 | 138 |
| 255 | 3300006914 | Ga0075436_100274119 | Ga0075436_1002741192 | 138 |
| 256 | 3300006931 | Ga0097620_100157985 | Ga0097620_1001579852 | 138 |
| 257 | 3300007076 | Ga0075435_100009105 | Ga0075435_1000091059 | 138 |
| 258 | 3300007076 | Ga0075435_100010376 | Ga0075435_1000103766 | 138 |
| 259 | 3300007076 | Ga0075435_100569881 | Ga0075435_1005698812 | 138 |
| 260 | 3300007076 | Ga0075435_100629483 | Ga0075435_1006294832 | 138 |
| 261 | 3300007265 | Ga0099794_10166974 | Ga0099794_101669741 | 138 |
| 262 | 3300009093 | Ga0105240_10150608 | Ga0105240_101506085 | 138 |
| 263 | 3300009101 | Ga0105247_10936548 | Ga0105247_109365481 | 138 |
| 264 | 3300009101 | Ga0105247_11337007 | Ga0105247_113370071 | 138 |
| 265 | 3300009147 | Ga0114129_10076430 | Ga0114129_100764306 | 138 |
| 266 | 3300009147 | Ga0114129_10277424 | Ga0114129_102774243 | 138 |
| 267 | 3300009147 | Ga0114129_11567761 | Ga0114129_115677611 | 138 |
| 268 | 3300009174 | Ga0105241_12647853 | Ga0105241_126478531 | 138 |
| 269 | 3300009551 | Ga0105238_10001743 | Ga0105238_100017434 | 138 |
| 270 | 3300009551 | Ga0105238_11359587 | Ga0105238_113595872 | 138 |
| 271 | 3300010375 | Ga0105239_10232066 | Ga0105239_102320663 | 138 |
| 272 | 3300010375 | Ga0105239_11311462 | Ga0105239_113114622 | 138 |
| 273 | 3300011119 | Ga0105246_10059340 | Ga0105246_100593404 | 138 |
| 274 | 3300013306 | Ga0163162_10369010 | Ga0163162_103690102 | 138 |
| 275 | 3300013308 | Ga0157375_10295081 | Ga0157375_102950812 | 138 |
| 276 | 3300014968 | Ga0157379_10060147 | Ga0157379_100601474 | 138 |
| 277 | 3300014968 | Ga0157379_10368141 | Ga0157379_103681412 | 138 |
| 278 | 3300020070 | Ga0206356_10603777 | Ga0206356_106037772 | 138 |
| 279 | 3300021384 | Ga0213876_10521498 | Ga0213876_105214982 | 138 |
| 280 | 3300025253 | Ga0209677_101639 | Ga0209677_10163910 | 138 |
| 281 | 3300025254 | Ga0209148_1006467 | Ga0209148_10064673 | 138 |
| 282 | 3300025272 | Ga0209455_1001472 | Ga0209455_100147212 | 138 |
| 283 | 3300025321 | Ga0207656_10089015 | Ga0207656_100890152 | 138 |
| 284 | 3300025900 | Ga0207710_10011063 | Ga0207710_100110632 | 138 |
| 285 | 3300025903 | Ga0207680_10163305 | Ga0207680_101633052 | 138 |
| 286 | 3300025904 | Ga0207647_10023917 | Ga0207647_100239172 | 138 |
| 287 | 3300025905 | Ga0207685_10593758 | Ga0207685_105937581 | 138 |
| 288 | 3300025907 | Ga0207645_10038640 | Ga0207645_100386403 | 138 |
| 289 | 3300025907 | Ga0207645_10184660 | Ga0207645_101846601 | 138 |
| 290 | 3300025909 | Ga0207705_10234508 | Ga0207705_102345083 | 138 |
| 291 | 3300025910 | Ga0207684_10144602 | Ga0207684_101446022 | 138 |
| 292 | 3300025910 | Ga0207684_10708467 | Ga0207684_107084672 | 138 |
| 293 | 3300025911 | Ga0207654_10014746 | Ga0207654_100147464 | 138 |
| 294 | 3300025912 | Ga0207707_10001016 | Ga0207707_1000101618 | 138 |
| 295 | 3300025913 | Ga0207695_10511341 | Ga0207695_105113412 | 138 |
| 296 | 3300025914 | Ga0207671_10031884 | Ga0207671_100318843 | 138 |
| 297 | 3300025914 | Ga0207671_10083323 | Ga0207671_100833233 | 138 |
| 298 | 3300025916 | Ga0207663_10208349 | Ga0207663_102083492 | 138 |
| 299 | 3300025917 | Ga0207660_10000924 | Ga0207660_1000092419 | 138 |
| 300 | 3300025917 | Ga0207660_10965227 | Ga0207660_109652271 | 138 |
| 301 | 3300025918 | Ga0207662_11050334 | Ga0207662_110503341 | 138 |
| 302 | 3300025919 | Ga0207657_10001391 | Ga0207657_1000139120 | 138 |
| 303 | 3300025919 | Ga0207657_10371953 | Ga0207657_103719532 | 138 |
| 304 | 3300025920 | Ga0207649_10066665 | Ga0207649_100666654 | 138 |
| 305 | 3300025921 | Ga0207652_10003893 | Ga0207652_100038939 | 138 |
| 306 | 3300025921 | Ga0207652_10479758 | Ga0207652_104797582 | 138 |
| 307 | 3300025922 | Ga0207646_10078182 | Ga0207646_100781822 | 138 |
| 308 | 3300025922 | Ga0207646_10582073 | Ga0207646_105820731 | 138 |
| 309 | 3300025923 | Ga0207681_10882781 | Ga0207681_108827811 | 138 |
| 310 | 3300025924 | Ga0207694_10836320 | Ga0207694_108363202 | 138 |
| 311 | 3300025925 | Ga0207650_10288457 | Ga0207650_102884572 | 138 |
| 312 | 3300025925 | Ga0207650_10603917 | Ga0207650_106039172 | 138 |
| 313 | 3300025926 | Ga0207659_10133706 | Ga0207659_101337061 | 138 |
| 314 | 3300025928 | Ga0207700_10010911 | Ga0207700_100109114 | 138 |
| 315 | 3300025929 | Ga0207664_10301523 | Ga0207664_103015232 | 138 |
| 316 | 3300025931 | Ga0207644_10178384 | Ga0207644_101783843 | 138 |
| 317 | 3300025931 | Ga0207644_10273138 | Ga0207644_102731383 | 138 |
| 318 | 3300025932 | Ga0207690_10164702 | Ga0207690_101647023 | 138 |
| 319 | 3300025932 | Ga0207690_10336702 | Ga0207690_103367022 | 138 |
| 320 | 3300025933 | Ga0207706_10195270 | Ga0207706_101952703 | 138 |
| 321 | 3300025934 | Ga0207686_10256367 | Ga0207686_102563672 | 138 |
| 322 | 3300025936 | Ga0207670_11523453 | Ga0207670_115234531 | 138 |
| 323 | 3300025938 | Ga0207704_10133658 | Ga0207704_101336581 | 138 |
| 324 | 3300025938 | Ga0207704_11323176 | Ga0207704_113231761 | 138 |
| 325 | 3300025939 | Ga0207665_10269845 | Ga0207665_102698453 | 138 |
| 326 | 3300025940 | Ga0207691_10496282 | Ga0207691_104962821 | 138 |
| 327 | 3300025940 | Ga0207691_10619039 | Ga0207691_106190392 | 138 |
| 328 | 3300025941 | Ga0207711_10351249 | Ga0207711_103512492 | 138 |
| 329 | 3300025941 | Ga0207711_11821309 | Ga0207711_118213091 | 138 |
| 330 | 3300025942 | Ga0207689_10083915 | Ga0207689_100839152 | 138 |
| 331 | 3300025942 | Ga0207689_10717840 | Ga0207689_107178402 | 138 |
| 332 | 3300025945 | Ga0207679_10318278 | Ga0207679_103182781 | 138 |
| 333 | 3300025945 | Ga0207679_10463704 | Ga0207679_104637042 | 138 |
| 334 | 3300025949 | Ga0207667_10011614 | Ga0207667_1001161410 | 138 |
| 335 | 3300025960 | Ga0207651_10064111 | Ga0207651_100641112 | 138 |
| 336 | 3300025972 | Ga0207668_10197224 | Ga0207668_101972243 | 138 |
| 337 | 3300025972 | Ga0207668_10340694 | Ga0207668_103406942 | 138 |
| 338 | 3300025981 | Ga0207640_10048550 | Ga0207640_100485502 | 138 |
| 339 | 3300025981 | Ga0207640_10411395 | Ga0207640_104113952 | 138 |
| 340 | 3300025986 | Ga0207658_10675383 | Ga0207658_106753832 | 138 |
| 341 | 3300026023 | Ga0207677_10110732 | Ga0207677_101107323 | 138 |
| 342 | 3300026035 | Ga0207703_10024373 | Ga0207703_100243732 | 138 |
| 343 | 3300026041 | Ga0207639_10167178 | Ga0207639_101671783 | 138 |
| 344 | 3300026041 | Ga0207639_10185649 | Ga0207639_101856493 | 138 |
| 345 | 3300026041 | Ga0207639_10371451 | Ga0207639_103714512 | 138 |
| 346 | 3300026067 | Ga0207678_10004216 | Ga0207678_1000421614 | 138 |
| 347 | 3300026067 | Ga0207678_10024243 | Ga0207678_100242436 | 138 |
| 348 | 3300026067 | Ga0207678_10679000 | Ga0207678_106790001 | 138 |
| 349 | 3300026067 | Ga0207678_11032911 | Ga0207678_110329112 | 138 |
| 350 | 3300026075 | Ga0207708_10390452 | Ga0207708_103904522 | 138 |
| 351 | 3300026078 | Ga0207702_10270405 | Ga0207702_102704051 | 138 |
| 352 | 3300026088 | Ga0207641_10308005 | Ga0207641_103080052 | 138 |
| 353 | 3300026095 | Ga0207676_10062764 | Ga0207676_100627644 | 138 |
| 354 | 3300026116 | Ga0207674_10309414 | Ga0207674_103094141 | 138 |
| 355 | 3300026118 | Ga0207675_100126297 | Ga0207675_1001262974 | 138 |
| 356 | 3300026118 | Ga0207675_100153144 | Ga0207675_1001531443 | 138 |
| 357 | 3300026118 | Ga0207675_101894648 | Ga0207675_1018946481 | 138 |
| 358 | 3300026121 | Ga0207683_10029544 | Ga0207683_100295446 | 138 |
| 359 | 3300026121 | Ga0207683_10060366 | Ga0207683_100603663 | 138 |
| 360 | 3300026121 | Ga0207683_10155090 | Ga0207683_101550904 | 138 |
| 361 | 3300026142 | Ga0207698_11366829 | Ga0207698_113668291 | 138 |
| 362 | 3300027866 | Ga0209813_10219011 | Ga0209813_102190111 | 138 |
| 363 | 3300028379 | Ga0268266_10094515 | Ga0268266_100945152 | 138 |
| 364 | 3300028379 | Ga0268266_10192293 | Ga0268266_101922932 | 138 |
| 365 | 3300028379 | Ga0268266_10219898 | Ga0268266_102198983 | 138 |
| 366 | 3300028380 | Ga0268265_10480048 | Ga0268265_104800482 | 138 |
| 367 | 3300028380 | Ga0268265_11653270 | Ga0268265_116532702 | 138 |
| 368 | 3300028381 | Ga0268264_10171793 | Ga0268264_101717932 | 138 |
| 369 | 3300028786 | Ga0307517_10000098 | Ga0307517_10000098110 | 138 |
| 370 | 3300028786 | Ga0307517_10475056 | Ga0307517_104750561 | 138 |
| 371 | 3300028794 | Ga0307515_10104075 | Ga0307515_101040754 | 138 |
| 372 | 3300031090 | Ga0265760_10007374 | Ga0265760_100073742 | 138 |
| 373 | 3300031456 | Ga0307513_10210520 | Ga0307513_102105201 | 138 |
| 374 | 3300031456 | Ga0307513_10388635 | Ga0307513_103886351 | 138 |
| 375 | 3300031616 | Ga0307508_10476471 | Ga0307508_104764712 | 138 |
| 376 | 3300031616 | Ga0307508_10716336 | Ga0307508_107163362 | 138 |
| 377 | 3300031711 | Ga0265314_10051287 | Ga0265314_100512871 | 138 |
| 378 | 3300031712 | Ga0265342_10178301 | Ga0265342_101783012 | 138 |
| 379 | 3300031730 | Ga0307516_10046388 | Ga0307516_100463883 | 138 |
| 380 | 3300031730 | Ga0307516_10524733 | Ga0307516_105247331 | 138 |
| 381 | 3300032126 | Ga0307415_100297967 | Ga0307415_1002979673 | 138 |
| 382 | 3300033180 | Ga0307510_10085315 | Ga0307510_100853154 | 138 |
| 383 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005253 | 138 |
| 384 | 3300035118 | Ga0373954_0157631 | Ga0373954_0157631_377_793 | 138 |
| 385 | 3300037466 | Ga0395898_0475635 | Ga0395898_0475635_244_672 | 138 |
| 386 | 3300037471 | Ga0395905_0081275 | Ga0395905_0081275_281_709 | 138 |
| 387 | 3300037853 | Ga0436364_0581979 | Ga0436364_0581979_37_453 | 138 |
| 388 | 3300039437 | Ga0436365_0808674 | Ga0436365_0808674_142_558 | 138 |
| 389 | 3300042157 | Ga0439458_0107875 | Ga0439458_0107875_157_573 | 138 |
| 390 | 3300042438 | Ga0439459_0025347 | Ga0439459_0025347_301_726 | 138 |
| 391 | 3300044673 | Ga0453683_0145307 | Ga0453683_0145307_596_1015 | 138 |
| 392 | 3300044684 | Ga0466966_0783188 | Ga0466966_0783188_16_432 | 138 |
| 393 | 3300044694 | Ga0466963_0494927 | Ga0466963_0494927_331_747 | 138 |
| 394 | 3300044719 | Ga0466971_0686711 | Ga0466971_0686711_33_449 | 138 |
| 395 | 3300044842 | Ga0466957_0105153 | Ga0466957_0105153_679_1176 | 138 |
| 396 | 3300044842 | Ga0466957_0422959 | Ga0466957_0422959_313_729 | 138 |
| 397 | 3300045836 | Ga0466958_0791111 | Ga0466958_0791111_49_465 | 138 |
| 398 | 3300045976 | Ga0466967_0130167 | Ga0466967_0130167_783_1250 | 138 |
| 399 | 3300045976 | Ga0466967_1077883 | Ga0466967_1077883_13_438 | 138 |
| 400 | 3300046460 | Ga0495638_0348779 | Ga0495638_0348779_254_670 | 138 |
| 401 | 3300046462 | Ga0495651_0091400 | Ga0495651_0091400_1343_1759 | 138 |
| 402 | 3300046474 | Ga0495605_0075741 | Ga0495605_0075741_432_848 | 138 |
| 403 | 3300046475 | Ga0495639_0363976 | Ga0495639_0363976_186_602 | 138 |
| 404 | 3300046491 | Ga0495584_0097384 | Ga0495584_0097384_611_1027 | 138 |
| 405 | 3300046499 | Ga0495594_0070484 | Ga0495594_0070484_1318_1734 | 138 |
| 406 | 3300046506 | Ga0495583_0194043 | Ga0495583_0194043_153_569 | 138 |
| 407 | 3300046518 | Ga0495631_0368908 | Ga0495631_0368908_135_551 | 138 |
| 408 | 3300046519 | Ga0495632_0249773 | Ga0495632_0249773_286_702 | 138 |
| 409 | 3300046520 | Ga0495637_0177353 | Ga0495637_0177353_201_617 | 138 |
| 410 | 3300046523 | Ga0495644_0036932 | Ga0495644_0036932_413_829 | 138 |
| 411 | 3300046525 | Ga0495663_0173207 | Ga0495663_0173207_17_433 | 138 |
| 412 | 3300046528 | Ga0495642_0157888 | Ga0495642_0157888_71_487 | 138 |
| 413 | 3300046538 | Ga0495609_0143684 | Ga0495609_0143684_303_719 | 138 |
| 414 | 3300046557 | Ga0495622_0135417 | Ga0495622_0135417_153_569 | 138 |
| 415 | 3300046616 | Ga0495668_0029504 | Ga0495668_0029504_1262_1678 | 138 |
| 416 | 3300046660 | Ga0495625_0272457 | Ga0495625_0272457_381_860 | 138 |
| 417 | 3300046660 | Ga0495625_0572893 | Ga0495625_0572893_180_596 | 138 |
| 418 | 3300046660 | Ga0495625_0735860 | Ga0495625_0735860_31_447 | 138 |
| 419 | 3300046684 | Ga0495669_0358943 | Ga0495669_0358943_151_567 | 138 |
| 420 | 3300046694 | Ga0495649_0360912 | Ga0495649_0360912_246_662 | 138 |
| 421 | 3300046809 | Ga0495600_0148061 | Ga0495600_0148061_804_1223 | 138 |
| 422 | 3300047318 | Ga0495636_0097970 | Ga0495636_0097970_132_548 | 138 |
| 423 | 3300047319 | Ga0495674_0395793 | Ga0495674_0395793_175_642 | 138 |
| 424 | 3300047320 | Ga0495672_0025981 | Ga0495672_0025981_2408_2824 | 138 |
| 425 | 3300047321 | Ga0495676_0105143 | Ga0495676_0105143_1391_1807 | 138 |
| 426 | 3300047322 | Ga0495680_0339143 | Ga0495680_0339143_116_577 | 138 |
| 427 | 3300047472 | Ga0495686_0212111 | Ga0495686_0212111_293_709 | 138 |
| 428 | 3300048091 | Ga0495626_0243389 | Ga0495626_0243389_18_434 | 138 |
| 429 | 3300048903 | Ga0496100_0468766 | Ga0496100_0468766_222_638 | 138 |
| 430 | 3300048905 | Ga0496102_1414131 | Ga0496102_1414131_153_569 | 138 |
| 431 | 3300048907 | Ga0496104_0116018 | Ga0496104_0116018_1443_1859 | 138 |
| 432 | 3300048910 | Ga0496107_0319923 | Ga0496107_0319923_327_743 | 138 |
| 433 | 3300048910 | Ga0496107_0374863 | Ga0496107_0374863_262_678 | 138 |
| 434 | 3300048910 | Ga0496107_0474831 | Ga0496107_0474831_394_903 | 138 |
| 435 | 3300048912 | Ga0496109_1187330 | Ga0496109_1187330_50_466 | 138 |
| 436 | 3300048914 | Ga0496111_0859534 | Ga0496111_0859534_108_524 | 138 |
| 437 | 3300048916 | Ga0496113_0278216 | Ga0496113_0278216_200_616 | 138 |
| 438 | 3300048918 | Ga0496115_0453317 | Ga0496115_0453317_180_596 | 138 |
| 439 | 3300048920 | Ga0496117_0126187 | Ga0496117_0126187_629_1054 | 138 |
| 440 | 3300048921 | Ga0496118_0065065 | Ga0496118_0065065_810_1226 | 138 |
| 441 | 3300048921 | Ga0496118_0393509 | Ga0496118_0393509_10_435 | 138 |
| 442 | 3300048922 | Ga0496119_0250125 | Ga0496119_0250125_413_838 | 138 |
| 443 | 3300048924 | Ga0496121_0000265 | Ga0496121_0000265_49763_50245 | 138 |
| 444 | 3300048924 | Ga0496121_0011280 | Ga0496121_0011280_5565_5981 | 138 |
| 445 | 3300048924 | Ga0496121_0011669 | Ga0496121_0011669_2141_2566 | 138 |
| 446 | 3300048924 | Ga0496121_0028222 | Ga0496121_0028222_598_1014 | 138 |
| 447 | 3300048924 | Ga0496121_0040223 | Ga0496121_0040223_255_683 | 138 |
| 448 | 3300048924 | Ga0496121_0155945 | Ga0496121_0155945_212_628 | 138 |
| 449 | 3300048924 | Ga0496121_0627412 | Ga0496121_0627412_35_451 | 138 |
| 450 | 3300048925 | Ga0496122_0090249 | Ga0496122_0090249_919_1347 | 138 |
| 451 | 3300048927 | Ga0496124_0794302 | Ga0496124_0794302_12_437 | 138 |
| 452 | 3300048928 | Ga0496125_0000176 | Ga0496125_0000176_29243_29671 | 138 |
| 453 | 3300048928 | Ga0496125_0001764 | Ga0496125_0001764_7543_7971 | 138 |
| 454 | 3300048928 | Ga0496125_0096343 | Ga0496125_0096343_103_519 | 138 |
| 455 | 3300048929 | Ga0496126_0026811 | Ga0496126_0026811_599_1051 | 138 |
| 456 | 3300048929 | Ga0496126_0072217 | Ga0496126_0072217_332_760 | 138 |
| 457 | 3300048929 | Ga0496126_0084815 | Ga0496126_0084815_2336_2764 | 138 |
| 458 | 3300049460 | Ga0495682_0169008 | Ga0495682_0169008_168_641 | 138 |
| 459 | 3300049591 | Ga0501075_0775252 | Ga0501075_0775252_54_473 | 138 |
| 460 | 3300050490 | nmdc:mga03n38_209348_c1 | nmdc:mga03n38_209348_c1_583_999 | 138 |
| 461 | 3300050490 | nmdc:mga03n38_269137_c1 | nmdc:mga03n38_269137_c1_32_448 | 138 |
| 462 | 3300050492 | nmdc:mga0yw44_234364_c1 | nmdc:mga0yw44_234364_c1_418_834 | 138 |
| 463 | 3300050493 | nmdc:mga0k408_339683_c1 | nmdc:mga0k408_339683_c1_192_608 | 138 |
| 464 | 3300050494 | nmdc:mga06z11_93967_c1 | nmdc:mga06z11_93967_c1_963_1379 | 138 |
| 465 | 3300050507 | nmdc:mga05p37_18843_c1 | nmdc:mga05p37_18843_c1_6659_7102 | 138 |
| 466 | 3300050507 | nmdc:mga05p37_224925_c1 | nmdc:mga05p37_224925_c1_584_1027 | 138 |
| 467 | 3300050507 | nmdc:mga05p37_776602_c1 | nmdc:mga05p37_776602_c1_354_779 | 138 |
| 468 | 3300050507 | nmdc:mga05p37_954601_c1 | nmdc:mga05p37_954601_c1_248_670 | 138 |
| 469 | 3300050508 | nmdc:mga09592_216059_c1 | nmdc:mga09592_216059_c1_983_1405 | 138 |
| 470 | 3300050508 | nmdc:mga09592_24966_c1 | nmdc:mga09592_24966_c1_2380_2823 | 138 |
| 471 | 3300050510 | nmdc:mga06r32_138185_c1 | nmdc:mga06r32_138185_c1_952_1395 | 138 |
| 472 | 3300050510 | nmdc:mga06r32_30783_c1 | nmdc:mga06r32_30783_c1_3746_4168 | 138 |
| 473 | 3300050512 | nmdc:mga0n895_19007_c1 | nmdc:mga0n895_19007_c1_4115_4543 | 138 |
| 474 | 3300050512 | nmdc:mga0n895_314959_c1 | nmdc:mga0n895_314959_c1_1134_1559 | 138 |
| 475 | 3300050512 | nmdc:mga0n895_624675_c1 | nmdc:mga0n895_624675_c1_187_630 | 138 |
| 476 | 3300050513 | nmdc:mga0rr50_27386_c1 | nmdc:mga0rr50_27386_c1_611_1039 | 138 |
| 477 | 3300050513 | nmdc:mga0rr50_618406_c1 | nmdc:mga0rr50_618406_c1_376_819 | 138 |
| 478 | 3300050513 | nmdc:mga0rr50_9591_c1 | nmdc:mga0rr50_9591_c1_1529_1954 | 138 |
| 479 | 3300050515 | nmdc:mga0a205_511301_c1 | nmdc:mga0a205_511301_c1_349_792 | 138 |
| 480 | 3300050515 | nmdc:mga0a205_84393_c1 | nmdc:mga0a205_84393_c1_1862_2290 | 138 |
| 481 | 3300050516 | nmdc:mga0sz30_150718_c1 | nmdc:mga0sz30_150718_c1_68_484 | 138 |
| 482 | 3300053077 | Ga0495601_0237194 | Ga0495601_0237194_567_1046 | 138 |
| 483 | 3300053083 | Ga0495655_0033704 | Ga0495655_0033704_478_894 | 138 |
| 484 | 3300053083 | Ga0495655_0255220 | Ga0495655_0255220_131_547 | 138 |
| 485 | 3300053084 | Ga0495595_0031235 | Ga0495595_0031235_628_1107 | 138 |
| 486 | 3300053085 | Ga0495619_0098538 | Ga0495619_0098538_380_859 | 138 |
| 487 | 3300053093 | Ga0500651_0365693 | Ga0500651_0365693_240_656 | 138 |
| 488 | 3300053096 | Ga0500641_0024457 | Ga0500641_0024457_1512_1928 | 138 |
| 489 | 3300053096 | Ga0500641_0106397 | Ga0500641_0106397_691_1113 | 138 |
| 490 | 3300053108 | Ga0500562_147700 | Ga0500562_147700_161_577 | 138 |
| 491 | 3300053109 | Ga0500569_018952 | Ga0500569_018952_546_962 | 138 |
| 492 | 3300053137 | Ga0500561_0058078 | Ga0500561_0058078_31_447 | 138 |
| 493 | 3300053139 | Ga0500568_0076768 | Ga0500568_0076768_448_864 | 138 |
| 494 | 3300053146 | Ga0500588_0105843 | Ga0500588_0105843_43_459 | 138 |
| 495 | 3300053150 | Ga0500603_063804 | Ga0500603_063804_455_871 | 138 |
| 496 | 3300061719 | Ga0466962_0063179 | Ga0466962_0063179_1171_1587 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7379 | 1 | 112 |
| 3zo7-assembly1.cif.gz_E | crystal structure of clcfe27a with substrate | 0.7196 | 1 | 112 |
| 3znj-assembly1.cif.gz_3 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.7055 | 1 | 112 |
| 3zo7-assembly1.cif.gz_F | crystal structure of clcfe27a with substrate | 0.7034 | 1 | 112 |
| 3znu-assembly1.cif.gz_I | crystal structure of clcf in crystal form 2 | 0.6914 | 1 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7436 | 1 | 112 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7379 | 1 | 112 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6884 | 1 | 112 | 3.30.70.1060 |
| af_O07243_108_202_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6815 | 2 | 115 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6717 | 1 | 112 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J3DD56-F1-model_v4 | YCII-related domain-containing protein | 0.9454 | 1 | 109 |
|
| AF-A0A534STC8-F1-model_v4 | Bacterial transcription activator effector binding domain-containing protein | 0.9432 | 1 | 135 |
|
| AF-A0A178U656-F1-model_v4 | Uncharacterized protein | 0.9427 | 1 | 112 |
GO:0003677
GO:0003824 GO:0006352 GO:0016987 |
| AF-A0A7Y6UGB1-F1-model_v4 | YCII-related domain-containing protein | 0.9427 | 1 | 117 |
|
| AF-A5ERI2-F1-model_v4 | deleted | 0.9419 | 1 | 138 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar