F454896

General Info

Members Datasets Scaffolds Average Seq Length
496 306 495 141

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10295081|Ga0157375_102950812
Length 170
Sequence MSVPQRADRLVDERWLGGLTGRPARTCKRSVTMRFMVIVKASKETEAGIMPSTELLTAMGKFNEELVKAGMMEAGEGLHPSSKGARIRYAGGQVRASRGPFPLTDDLVAGFWLIKARSLDEAIDWMKRAPFGGGAEIEIRQVFSSEDFGEALTPELREQEERLRAQAGKK

Samples

Sample ID Description Type Environment
1 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
198 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
214 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
302 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
303 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
304 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
305 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.4
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.68
Nodule 0.4
Rhizoplane 5.85
Rhizosphere 76.81
Stem 0
Stem Tuber 0
Unclassified 7.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10039071 3300002075 Bacteria 964
2 JGI25153J46596_10010032 3300003215 Bacteria 4323
3 Ga0055526_1018086 3300003771 Bacteria 2652
4 Ga0065707_10411836 3300005295 Bacteria 840
5 Ga0070658_10102491 3300005327 Bacteria 2367
6 Ga0070676_10032552 3300005328 Bacteria 2988
7 Ga0070676_10920933 3300005328 Bacteria 652
8 Ga0070683_100014532 3300005329 Bacteria 6891
9 Ga0070670_100202578 3300005331 Bacteria 1725
10 Ga0070670_100447193 3300005331 Bacteria 1145
11 Ga0070677_10058589 3300005333 Bacteria 1582
12 Ga0068869_100073753 3300005334 Bacteria 2531
13 Ga0068869_100667149 3300005334 Bacteria 884
14 Ga0070666_10260339 3300005335 Bacteria 1230
15 Ga0070666_10555555 3300005335 Bacteria 835
16 Ga0070680_100056302 3300005336 Bacteria 3214
17 Ga0070682_100000221 3300005337 Bacteria 41449
18 Ga0070682_100036436 3300005337 Bacteria 3007
19 Ga0068868_100061212 3300005338 Bacteria 2982
20 Ga0068868_100071036 3300005338 Bacteria 2776
21 Ga0070660_100323778 3300005339 Bacteria 1267
22 Ga0070689_101404892 3300005340 Bacteria 631
23 Ga0070691_10240693 3300005341 Bacteria 967
24 Ga0070691_10934889 3300005341 Bacteria 537
25 Ga0070661_100090117 3300005344 Bacteria 2271
26 Ga0070661_100243690 3300005344 Bacteria 1385
27 Ga0070692_10308265 3300005345 Bacteria 969
28 Ga0070692_10671824 3300005345 Bacteria 694
29 Ga0070668_100073611 3300005347 Bacteria 2663
30 Ga0070668_100194020 3300005347 Bacteria 1664
31 Ga0070669_100179644 3300005353 Bacteria 1655
32 Ga0070675_100451557 3300005354 Bacteria 1153
33 Ga0070671_100148103 3300005355 Bacteria 1982
34 Ga0070671_100201808 3300005355 Bacteria 1686
35 Ga0070671_100300849 3300005355 Bacteria 1366
36 Ga0070671_100713028 3300005355 Bacteria 871
37 Ga0070674_100973734 3300005356 Bacteria 743
38 Ga0070673_100071969 3300005364 Bacteria 2779
39 Ga0070673_100940013 3300005364 Bacteria 803
40 Ga0070673_101694160 3300005364 Bacteria 598
41 Ga0070688_100422816 3300005365 Bacteria 991
42 Ga0070688_100561755 3300005365 Bacteria 869
43 Ga0070659_100228300 3300005366 Bacteria 1538
44 Ga0070667_100370376 3300005367 Bacteria 1300
45 Ga0070709_10554435 3300005434 Bacteria 880
46 Ga0070714_100342717 3300005435 Bacteria 1402
47 Ga0070713_100009306 3300005436 Bacteria 7023
48 Ga0070710_10425649 3300005437 Bacteria 895
49 Ga0070711_100583234 3300005439 Bacteria 931
50 Ga0070705_101682567 3300005440 Bacteria 536
51 Ga0070700_100290777 3300005441 Bacteria 1189
52 Ga0070700_101261072 3300005441 Bacteria 620
53 Ga0070694_100143654 3300005444 Bacteria 1736
54 Ga0070694_100391491 3300005444 Bacteria 1086
55 Ga0070708_100025495 3300005445 Bacteria 5054
56 Ga0070663_100004680 3300005455 Bacteria 8069
57 Ga0070663_100026089 3300005455 Bacteria 3953
58 Ga0070663_100073751 3300005455 Bacteria 2490
59 Ga0070678_100045978 3300005456 Bacteria 3127
60 Ga0070678_100175261 3300005456 Bacteria 1750
61 Ga0070662_101849616 3300005457 Bacteria 522
62 Ga0070681_10017662 3300005458 Bacteria 7129
63 Ga0070681_10139323 3300005458 Bacteria 2356
64 Ga0070681_10572560 3300005458 Bacteria 1043
65 Ga0070681_10974530 3300005458 Bacteria 767
66 Ga0070681_11431742 3300005458 Bacteria 615
67 Ga0068867_100506098 3300005459 Bacteria 1039
68 Ga0068867_102053583 3300005459 Bacteria 541
69 Ga0070685_11310440 3300005466 Bacteria 553
70 Ga0070706_100003954 3300005467 Bacteria 14434
71 Ga0070706_100148753 3300005467 Bacteria 2186
72 Ga0070706_100670797 3300005467 Bacteria 962
73 Ga0070707_100239877 3300005468 Bacteria 1764
74 Ga0070707_100336420 3300005468 Bacteria 1467
75 Ga0070707_101439549 3300005468 Bacteria 656
76 Ga0070698_100085836 3300005471 Bacteria 3134
77 Ga0070699_100055894 3300005518 Bacteria 3417
78 Ga0070679_100027556 3300005530 Bacteria 5593
79 Ga0070684_100078687 3300005535 Bacteria 2913
80 Ga0068853_100003590 3300005539 Bacteria 11880
81 Ga0070696_100183633 3300005546 Bacteria 1553
82 Ga0070693_100155060 3300005547 Bacteria 1454
83 Ga0070665_100013100 3300005548 Bacteria 8350
84 Ga0070665_100135598 3300005548 Bacteria 2464
85 Ga0070665_100142934 3300005548 Bacteria 2396
86 Ga0070665_100176827 3300005548 Bacteria 2135
87 Ga0070704_100261456 3300005549 Bacteria 1426
88 Ga0068855_100460714 3300005563 Bacteria 1386
89 Ga0070664_100260739 3300005564 Bacteria 1560
90 Ga0070664_100496003 3300005564 Bacteria 1125
91 Ga0068857_100046709 3300005577 Bacteria 3843
92 Ga0068857_100220672 3300005577 Bacteria 1732
93 Ga0068857_101101025 3300005577 Bacteria 767
94 Ga0068854_100353313 3300005578 Bacteria 1204
95 Ga0068856_100513735 3300005614 Bacteria 1219
96 Ga0068856_100944477 3300005614 Bacteria 881
97 Ga0070702_100594126 3300005615 Bacteria 829
98 Ga0068852_100062363 3300005616 Bacteria 3243
99 Ga0068859_100157976 3300005617 Bacteria 2346
100 Ga0068859_101196745 3300005617 Bacteria 837
101 Ga0068864_100031862 3300005618 Bacteria 4475
102 Ga0068864_100189671 3300005618 Bacteria 1884
103 Ga0068861_100311293 3300005719 Bacteria 1368
104 Ga0068861_100455250 3300005719 Bacteria 1148
105 Ga0068861_101478870 3300005719 Bacteria 666
106 Ga0068870_10329634 3300005840 Bacteria 973
107 Ga0068858_100119536 3300005842 Bacteria 2463
108 Ga0068858_100741746 3300005842 Bacteria 956
109 Ga0068860_100369734 3300005843 Bacteria 1414
110 Ga0068860_102578571 3300005843 Bacteria 528
111 Ga0068862_100315519 3300005844 Bacteria 1442
112 Ga0068862_102334027 3300005844 Bacteria 547
113 Ga0081455_10528597 3300005937 Bacteria 785
114 Ga0081540_1026662 3300005983 Bacteria 3291
115 Ga0070717_10000460 3300006028 Bacteria 25862
116 Ga0070717_10283116 3300006028 Bacteria 1471
117 Ga0075365_10016437 3300006038 Bacteria 4501
118 Ga0075365_10075675 3300006038 Bacteria 2272
119 Ga0075368_10067325 3300006042 Bacteria 1441
120 Ga0075363_100014770 3300006048 Bacteria 3825
121 Ga0075363_100253343 3300006048 Bacteria 1014
122 Ga0075364_10058712 3300006051 Bacteria 2521
123 Ga0075364_10573886 3300006051 Bacteria 771
124 Ga0070715_10004544 3300006163 Bacteria 4565
125 Ga0070716_100034174 3300006173 Bacteria 2786
126 Ga0070712_100073635 3300006175 Bacteria 2451
127 Ga0075362_10086410 3300006177 Bacteria 1451
128 Ga0075367_10487685 3300006178 Bacteria 781
129 Ga0075367_10592423 3300006178 Bacteria 704
130 Ga0075367_10882358 3300006178 Bacteria 570
131 Ga0075369_10032572 3300006186 Bacteria 2206
132 Ga0075366_10157772 3300006195 Bacteria 1374
133 Ga0075366_10722754 3300006195 Bacteria 619
134 Ga0097621_100119193 3300006237 Bacteria 2237
135 Ga0097621_100170504 3300006237 Bacteria 1876
136 Ga0075370_10020322 3300006353 Bacteria 3627
137 Ga0075370_10295151 3300006353 Bacteria 963
138 Ga0068871_100031423 3300006358 Bacteria 4188
139 Ga0068871_100104460 3300006358 Bacteria 2376
140 Ga0068871_100776822 3300006358 Bacteria 882
141 Ga0075428_100057254 3300006844 Bacteria 4267
142 Ga0075428_100302984 3300006844 Bacteria 1718
143 Ga0075428_100573781 3300006844 Bacteria 1205
144 Ga0075430_101071662 3300006846 Unclassified 664
145 Ga0075431_100025151 3300006847 Bacteria 6102
146 Ga0075431_100026738 3300006847 Bacteria 5919
147 Ga0075431_100479679 3300006847 Unclassified 1236
148 Ga0075433_10030210 3300006852 Bacteria 4622
149 Ga0075433_10080018 3300006852 Bacteria 2880
150 Ga0075433_10152117 3300006852 Bacteria 2058
151 Ga0075433_10378559 3300006852 Bacteria 1250
152 Ga0075434_100017827 3300006871 Bacteria 6849
153 Ga0075434_100019717 3300006871 Bacteria 6528
154 Ga0075434_100020491 3300006871 Bacteria 6414
155 Ga0075434_100853761 3300006871 Bacteria 926
156 Ga0075429_100071979 3300006880 Bacteria 3011
157 Ga0075429_100754097 3300006880 Bacteria 853
158 Ga0068865_100203545 3300006881 Bacteria 1538
159 Ga0068865_101621525 3300006881 Bacteria 582
160 Ga0075436_100235838 3300006914 Bacteria 1300
161 Ga0075436_100274119 3300006914 Bacteria 1205
162 Ga0097620_100157985 3300006931 Bacteria 2346
163 Ga0097620_101196835 3300006931 Bacteria 837
164 Ga0075435_100009105 3300007076 Bacteria 7166
165 Ga0075435_100010376 3300007076 Bacteria 6812
166 Ga0075435_100569881 3300007076 Bacteria 981
167 Ga0075435_100629483 3300007076 Bacteria 931
168 Ga0099794_10166974 3300007265 Bacteria 1121
169 Ga0099795_10043944 3300007788 Bacteria 1601
170 Ga0105240_10150608 3300009093 Bacteria 2771
171 Ga0105247_10936548 3300009101 Bacteria 672
172 Ga0105247_11337007 3300009101 Bacteria 577
173 Ga0114129_10076430 3300009147 Bacteria 4662
174 Ga0114129_10277424 3300009147 Unclassified 2240
175 Ga0114129_11567761 3300009147 Bacteria 807
176 Ga0105241_12647853 3300009174 Bacteria 504
177 Ga0105242_10343862 3300009176 Bacteria 1375
178 Ga0105248_10168417 3300009177 Bacteria 2469
179 Ga0105237_10106632 3300009545 Bacteria 2794
180 Ga0105237_12447003 3300009545 Bacteria 532
181 Ga0105238_10001743 3300009551 Bacteria 21842
182 Ga0105238_11359587 3300009551 Bacteria 737
183 Ga0105249_11597093 3300009553 Bacteria 725
184 Ga0099796_10009289 3300010159 Bacteria 2656
185 Ga0105239_10232066 3300010375 Bacteria 2070
186 Ga0105239_10409962 3300010375 Bacteria 1534
187 Ga0105239_10649243 3300010375 Bacteria 1205
188 Ga0105239_11311462 3300010375 Bacteria 835
189 Ga0105246_10059340 3300011119 Bacteria 2654
190 Ga0105246_10339704 3300011119 Bacteria 1227
191 Ga0157374_11393289 3300013296 Bacteria 724
192 Ga0163162_10216696 3300013306 Bacteria 2044
193 Ga0163162_10369010 3300013306 Bacteria 1568
194 Ga0163162_11215176 3300013306 Bacteria 856
195 Ga0157375_10295081 3300013308 Bacteria 1784
196 Ga0157379_10060147 3300014968 Bacteria 3396
197 Ga0157379_10368141 3300014968 Bacteria 1318
198 Ga0157379_11541420 3300014968 Bacteria 647
199 Ga0206356_10603777 3300020070 Bacteria 1039
200 Ga0213876_10521498 3300021384 Bacteria 632
201 Ga0209677_101639 3300025253 Bacteria 9408
202 Ga0209148_1006467 3300025254 Bacteria 2537
203 Ga0209455_1001472 3300025272 Bacteria 10597
204 Ga0209564_1000755 3300025295 Bacteria 45779
205 Ga0209758_1005478 3300025297 Bacteria 9742
206 Ga0209758_1081625 3300025297 Bacteria 976
207 Ga0207656_10089015 3300025321 Bacteria 1398
208 Ga0207682_10059177 3300025893 Bacteria 1601
209 Ga0207692_10022084 3300025898 Bacteria 2924
210 Ga0207710_10011063 3300025900 Bacteria 3801
211 Ga0207710_10164150 3300025900 Bacteria 1083
212 Ga0207680_10163305 3300025903 Bacteria 1495
213 Ga0207647_10023917 3300025904 Bacteria 4034
214 Ga0207685_10593758 3300025905 Bacteria 593
215 Ga0207645_10038640 3300025907 Bacteria 3059
216 Ga0207645_10184660 3300025907 Bacteria 1369
217 Ga0207705_10234508 3300025909 Bacteria 1396
218 Ga0207684_10144602 3300025910 Bacteria 2045
219 Ga0207684_10708467 3300025910 Bacteria 855
220 Ga0207654_10014746 3300025911 Bacteria 4042
221 Ga0207707_10001016 3300025912 Bacteria 26912
222 Ga0207695_10511341 3300025913 Bacteria 1083
223 Ga0207671_10031884 3300025914 Bacteria 3924
224 Ga0207671_10083323 3300025914 Bacteria 2401
225 Ga0207693_10009325 3300025915 Bacteria 8001
226 Ga0207663_10208349 3300025916 Bacteria 1415
227 Ga0207660_10000924 3300025917 Bacteria 19378
228 Ga0207660_10965227 3300025917 Bacteria 695
229 Ga0207662_11050334 3300025918 Bacteria 579
230 Ga0207657_10001391 3300025919 Bacteria 25799
231 Ga0207657_10371953 3300025919 Bacteria 1126
232 Ga0207649_10066665 3300025920 Bacteria 2283
233 Ga0207649_10403475 3300025920 Bacteria 1023
234 Ga0207652_10003893 3300025921 Bacteria 12209
235 Ga0207652_10479758 3300025921 Bacteria 1120
236 Ga0207646_10078182 3300025922 Bacteria 2957
237 Ga0207646_10582073 3300025922 Bacteria 1005
238 Ga0207681_10882781 3300025923 Bacteria 748
239 Ga0207694_10836320 3300025924 Bacteria 778
240 Ga0207650_10288457 3300025925 Bacteria 1338
241 Ga0207650_10603917 3300025925 Bacteria 923
242 Ga0207659_10133706 3300025926 Bacteria 1918
243 Ga0207700_10010911 3300025928 Bacteria 5768
244 Ga0207664_10301523 3300025929 Bacteria 1410
245 Ga0207644_10178384 3300025931 Bacteria 1663
246 Ga0207644_10273138 3300025931 Bacteria 1355
247 Ga0207644_10799820 3300025931 Bacteria 789
248 Ga0207690_10164702 3300025932 Bacteria 1656
249 Ga0207690_10336702 3300025932 Bacteria 1190
250 Ga0207706_10195270 3300025933 Bacteria 1776
251 Ga0207686_10256367 3300025934 Bacteria 1280
252 Ga0207670_11523453 3300025936 Bacteria 568
253 Ga0207704_10133658 3300025938 Bacteria 1723
254 Ga0207704_11323176 3300025938 Bacteria 616
255 Ga0207665_10023296 3300025939 Bacteria 4078
256 Ga0207665_10269845 3300025939 Bacteria 1263
257 Ga0207691_10496282 3300025940 Bacteria 1037
258 Ga0207691_10619039 3300025940 Bacteria 916
259 Ga0207691_10685299 3300025940 Bacteria 865
260 Ga0207711_10351249 3300025941 Bacteria 1365
261 Ga0207711_10756306 3300025941 Bacteria 906
262 Ga0207711_11821309 3300025941 Bacteria 552
263 Ga0207689_10083915 3300025942 Bacteria 2619
264 Ga0207689_10717840 3300025942 Bacteria 843
265 Ga0207661_10972709 3300025944 Bacteria 782
266 Ga0207679_10318278 3300025945 Bacteria 1346
267 Ga0207679_10463704 3300025945 Bacteria 1125
268 Ga0207667_10011614 3300025949 Bacteria 10225
269 Ga0207651_10064111 3300025960 Bacteria 2570
270 Ga0207651_11538812 3300025960 Bacteria 599
271 Ga0207712_11470247 3300025961 Bacteria 610
272 Ga0207668_10197224 3300025972 Bacteria 1600
273 Ga0207668_10340694 3300025972 Bacteria 1250
274 Ga0207668_11815114 3300025972 Bacteria 550
275 Ga0207640_10048550 3300025981 Bacteria 2745
276 Ga0207640_10411395 3300025981 Bacteria 1104
277 Ga0207658_10675383 3300025986 Bacteria 932
278 Ga0207677_10110732 3300026023 Bacteria 2044
279 Ga0207677_10633401 3300026023 Bacteria 942
280 Ga0207703_10024373 3300026035 Bacteria 4761
281 Ga0207703_11065545 3300026035 Bacteria 776
282 Ga0207639_10167178 3300026041 Bacteria 1859
283 Ga0207639_10185649 3300026041 Bacteria 1772
284 Ga0207639_10371451 3300026041 Bacteria 1282
285 Ga0207678_10004216 3300026067 Bacteria 12904
286 Ga0207678_10023509 3300026067 Bacteria 5389
287 Ga0207678_10024243 3300026067 Bacteria 5299
288 Ga0207678_10679000 3300026067 Bacteria 906
289 Ga0207678_11032911 3300026067 Bacteria 728
290 Ga0207708_10390452 3300026075 Bacteria 1149
291 Ga0207702_10270405 3300026078 Bacteria 1603
292 Ga0207641_10308005 3300026088 Bacteria 1498
293 Ga0207676_10062764 3300026095 Bacteria 2948
294 Ga0207674_10309414 3300026116 Bacteria 1529
295 Ga0207675_100126297 3300026118 Bacteria 2423
296 Ga0207675_100153144 3300026118 Bacteria 2196
297 Ga0207675_101894648 3300026118 Bacteria 615
298 Ga0207683_10029544 3300026121 Bacteria 4746
299 Ga0207683_10060366 3300026121 Bacteria 3333
300 Ga0207683_10128981 3300026121 Bacteria 2274
301 Ga0207683_10155090 3300026121 Bacteria 2068
302 Ga0207698_10568036 3300026142 Bacteria 1114
303 Ga0207698_11366829 3300026142 Bacteria 723
304 Ga0209179_1008779 3300027512 Bacteria 1714
305 Ga0209588_1019784 3300027671 Bacteria 2105
306 Ga0209813_10219011 3300027866 Bacteria 712
307 Ga0268266_10001136 3300028379 Bacteria 33101
308 Ga0268266_10094515 3300028379 Bacteria 2624
309 Ga0268266_10192293 3300028379 Bacteria 1864
310 Ga0268266_10219898 3300028379 Bacteria 1745
311 Ga0268265_10480048 3300028380 Bacteria 1167
312 Ga0268265_11653270 3300028380 Bacteria 646
313 Ga0268264_10171793 3300028381 Bacteria 1961
314 Ga0307517_10000098 3300028786 Bacteria 126044
315 Ga0307517_10475056 3300028786 Bacteria 642
316 Ga0307515_10104075 3300028794 Bacteria 3396
317 Ga0265760_10007374 3300031090 Bacteria 3146
318 Ga0307513_10210520 3300031456 Bacteria 1776
319 Ga0307513_10388635 3300031456 Bacteria 1132
320 Ga0307508_10476471 3300031616 Bacteria 842
321 Ga0307508_10716336 3300031616 Bacteria 611
322 Ga0265314_10051287 3300031711 Bacteria 2875
323 Ga0265342_10178301 3300031712 Bacteria 1165
324 Ga0307516_10046388 3300031730 Bacteria 4287
325 Ga0307516_10524733 3300031730 Bacteria 838
326 Ga0307409_101698202 3300031995 Bacteria 660
327 Ga0307415_100297967 3300032126 Bacteria 1334
328 Ga0307415_100801028 3300032126 Bacteria 860
329 Ga0307510_10085315 3300033180 Bacteria 3035
330 Ga0315911_1000005 3300033442 Bacteria 426255
331 Ga0373930_0019370 3300034816 Bacteria 1316
332 Ga0373958_0037953 3300034819 Bacteria 974
333 Ga0373928_0023752 3300035084 Bacteria 1310
334 Ga0373954_0157631 3300035118 Bacteria 1110
335 Ga0373943_0289074 3300035170 Bacteria 928
336 Ga0373946_0176394 3300035171 Bacteria 1012
337 Ga0373946_0650910 3300035171 Bacteria 549
338 Ga0373931_0003428 3300035691 Bacteria 7118
339 Ga0373935_0439319 3300035692 Bacteria 941
340 Ga0373927_0039246 3300035695 Bacteria 3073
341 Ga0373947_0079581 3300035725 Bacteria 2026
342 Ga0373947_0165966 3300035725 Bacteria 1430
343 Ga0373925_0013452 3300037068 Bacteria 5923
344 Ga0395898_0475635 3300037466 Bacteria 1189
345 Ga0395905_0081275 3300037471 Bacteria 3037
346 Ga0436364_0581979 3300037853 Bacteria 989
347 Ga0436365_0808674 3300039437 Bacteria 1431
348 Ga0451793_1915486 3300041452 Bacteria 528
349 Ga0439458_0107875 3300042157 Bacteria 727
350 Ga0439459_0025347 3300042438 Bacteria 1170
351 Ga0453683_0145307 3300044673 Bacteria 1497
352 Ga0466966_0783188 3300044684 Bacteria 575
353 Ga0466963_0494927 3300044694 Bacteria 863
354 Ga0466971_0686711 3300044719 Unclassified 514
355 Ga0466957_0105153 3300044842 Bacteria 1784
356 Ga0466957_0422959 3300044842 Bacteria 914
357 Ga0466958_0791111 3300045836 Bacteria 618
358 Ga0466967_0130167 3300045976 Bacteria 2335
359 Ga0466967_1077883 3300045976 Bacteria 800
360 Ga0495617_180806 3300046452 Bacteria 664
361 Ga0495638_0348779 3300046460 Bacteria 782
362 Ga0495638_0557939 3300046460 Bacteria 568
363 Ga0495651_0091400 3300046462 Bacteria 2281
364 Ga0495605_0075741 3300046474 Bacteria 1582
365 Ga0495639_0363976 3300046475 Bacteria 727
366 Ga0495584_0097384 3300046491 Bacteria 1486
367 Ga0495594_0070484 3300046499 Bacteria 1943
368 Ga0495594_0656553 3300046499 Bacteria 594
369 Ga0495596_0117331 3300046500 Bacteria 1034
370 Ga0495583_0194043 3300046506 Bacteria 827
371 Ga0495631_0368908 3300046518 Bacteria 611
372 Ga0495632_0249773 3300046519 Bacteria 796
373 Ga0495637_0177353 3300046520 Bacteria 792
374 Ga0495644_0036932 3300046523 Bacteria 1843
375 Ga0495644_0091283 3300046523 Bacteria 1150
376 Ga0495663_0173207 3300046525 Bacteria 745
377 Ga0495642_0157888 3300046528 Bacteria 983
378 Ga0495609_0143684 3300046538 Bacteria 1017
379 Ga0495622_0135417 3300046557 Bacteria 1120
380 Ga0495668_0029504 3300046616 Bacteria 3099
381 Ga0495611_0098496 3300046648 Bacteria 1356
382 Ga0495625_0272457 3300046660 Bacteria 1092
383 Ga0495625_0572893 3300046660 Bacteria 681
384 Ga0495625_0735860 3300046660 Bacteria 579
385 Ga0495588_0412582 3300046674 Bacteria 709
386 Ga0495669_0358943 3300046684 Bacteria 704
387 Ga0495649_0360912 3300046694 Bacteria 733
388 Ga0495600_0148061 3300046809 Bacteria 1521
389 Ga0495636_0097970 3300047318 Bacteria 1279
390 Ga0495674_0395793 3300047319 Bacteria 1116
391 Ga0495674_0550823 3300047319 Bacteria 918
392 Ga0495672_0025981 3300047320 Bacteria 3742
393 Ga0495676_0105143 3300047321 Bacteria 2082
394 Ga0495680_0339143 3300047322 Bacteria 1049
395 Ga0495686_0212111 3300047472 Bacteria 1106
396 Ga0495626_0243389 3300048091 Bacteria 724
397 Ga0496100_0137249 3300048903 Bacteria 1729
398 Ga0496100_0198462 3300048903 Bacteria 1461
399 Ga0496100_0468766 3300048903 Bacteria 967
400 Ga0496100_0739927 3300048903 Bacteria 769
401 Ga0496101_0075055 3300048904 Bacteria 2488
402 Ga0496101_0232477 3300048904 Bacteria 1433
403 Ga0496102_0484942 3300048905 Bacteria 1158
404 Ga0496102_0516631 3300048905 Bacteria 1117
405 Ga0496102_1414131 3300048905 Bacteria 615
406 Ga0496104_0116018 3300048907 Bacteria 2570
407 Ga0496104_0156668 3300048907 Bacteria 2185
408 Ga0496105_0184881 3300048908 Bacteria 1705
409 Ga0496106_0740323 3300048909 Bacteria 782
410 Ga0496107_0319923 3300048910 Bacteria 1155
411 Ga0496107_0374863 3300048910 Bacteria 1058
412 Ga0496107_0474831 3300048910 Bacteria 928
413 Ga0496109_0633094 3300048912 Bacteria 1006
414 Ga0496109_0723497 3300048912 Bacteria 933
415 Ga0496109_1187330 3300048912 Bacteria 700
416 Ga0496110_0557313 3300048913 Bacteria 1041
417 Ga0496111_0377439 3300048914 Bacteria 1048
418 Ga0496111_0859534 3300048914 Bacteria 654
419 Ga0496112_0012229 3300048915 Bacteria 7879
420 Ga0496113_0278216 3300048916 Bacteria 1338
421 Ga0496114_0476359 3300048917 Bacteria 1104
422 Ga0496114_0756656 3300048917 Bacteria 849
423 Ga0496115_0019746 3300048918 Bacteria 5189
424 Ga0496115_0453317 3300048918 Bacteria 1036
425 Ga0496117_0126187 3300048920 Bacteria 1561
426 Ga0496118_0065065 3300048921 Bacteria 2670
427 Ga0496118_0393509 3300048921 Bacteria 722
428 Ga0496119_0250125 3300048922 Bacteria 894
429 Ga0496121_0000265 3300048924 Bacteria 109251
430 Ga0496121_0011280 3300048924 Bacteria 9954
431 Ga0496121_0011669 3300048924 Bacteria 9712
432 Ga0496121_0028222 3300048924 Bacteria 5229
433 Ga0496121_0040223 3300048924 Bacteria 4105
434 Ga0496121_0155945 3300048924 Bacteria 1675
435 Ga0496121_0237950 3300048924 Bacteria 1271
436 Ga0496121_0627412 3300048924 Bacteria 659
437 Ga0496122_0090249 3300048925 Bacteria 2092
438 Ga0496122_0093188 3300048925 Bacteria 2044
439 Ga0496124_0238547 3300048927 Bacteria 1354
440 Ga0496124_0794302 3300048927 Bacteria 587
441 Ga0496125_0000176 3300048928 Bacteria 140746
442 Ga0496125_0001764 3300048928 Bacteria 30006
443 Ga0496125_0096343 3300048928 Bacteria 2197
444 Ga0496126_0011852 3300048929 Bacteria 8969
445 Ga0496126_0026811 3300048929 Bacteria 5517
446 Ga0496126_0072217 3300048929 Bacteria 3070
447 Ga0496126_0084815 3300048929 Bacteria 2793
448 Ga0495682_0169008 3300049460 Bacteria 778
449 Ga0501075_0775252 3300049591 Bacteria 730
450 Ga0501222_015334 3300049662 Bacteria 1013
451 nmdc:mga03683_107519_c1 3300050489 Bacteria 1230
452 nmdc:mga03n38_12993_c1 3300050490 Bacteria 3150
453 nmdc:mga03n38_209348_c1 3300050490 Bacteria 1013
454 nmdc:mga03n38_269137_c1 3300050490 Bacteria 906
455 nmdc:mga00v17_86774_c1 3300050491 Bacteria 1961
456 nmdc:mga0yw44_234364_c1 3300050492 Bacteria 1219
457 nmdc:mga0yw44_31797_c1 3300050492 Bacteria 3071
458 nmdc:mga0k408_148173_c1 3300050493 Bacteria 1397
459 nmdc:mga0k408_339683_c1 3300050493 Bacteria 895
460 nmdc:mga06z11_8466_c1 3300050494 Bacteria 4291
461 nmdc:mga06z11_93967_c1 3300050494 Bacteria 1633
462 nmdc:mga07m45_54052_c1 3300050496 Bacteria 2270
463 nmdc:mga05p37_18843_c1 3300050507 Bacteria 8342
464 nmdc:mga05p37_224925_c1 3300050507 Bacteria 2263
465 nmdc:mga05p37_776602_c1 3300050507 Bacteria 1052
466 nmdc:mga05p37_954601_c1 3300050507 Bacteria 917
467 nmdc:mga09592_216059_c1 3300050508 Bacteria 1661
468 nmdc:mga09592_24966_c1 3300050508 Bacteria 4943
469 nmdc:mga06r32_138185_c1 3300050510 Bacteria 2411
470 nmdc:mga06r32_30783_c1 3300050510 Bacteria 5036
471 nmdc:mga0n895_19007_c1 3300050512 Bacteria 6375
472 nmdc:mga0n895_314959_c1 3300050512 Bacteria 1586
473 nmdc:mga0n895_624675_c1 3300050512 Bacteria 1078
474 nmdc:mga0rr50_27386_c1 3300050513 Bacteria 3990
475 nmdc:mga0rr50_618406_c1 3300050513 Bacteria 924
476 nmdc:mga0rr50_9591_c1 3300050513 Bacteria 6096
477 nmdc:mga0a205_511301_c1 3300050515 Bacteria 1058
478 nmdc:mga0a205_84393_c1 3300050515 Bacteria 3068
479 nmdc:mga0sz30_150718_c1 3300050516 Bacteria 1029
480 Ga0495601_0237194 3300053077 Bacteria 1191
481 Ga0495655_0033704 3300053083 Bacteria 1262
482 Ga0495655_0255220 3300053083 Bacteria 591
483 Ga0495595_0031235 3300053084 Bacteria 2393
484 Ga0495619_0098538 3300053085 Bacteria 1987
485 Ga0500583_0098116 3300053092 Bacteria 1432
486 Ga0500651_0365693 3300053093 Bacteria 816
487 Ga0500641_0024457 3300053096 Bacteria 2329
488 Ga0500641_0106397 3300053096 Bacteria 1206
489 Ga0500562_147700 3300053108 Bacteria 640
490 Ga0500569_018952 3300053109 Bacteria 1785
491 Ga0500561_0058078 3300053137 Bacteria 1076
492 Ga0500568_0076768 3300053139 Bacteria 1272
493 Ga0500588_0105843 3300053146 Bacteria 976
494 Ga0500603_063804 3300053150 Bacteria 1036
495 Ga0466962_0063179 3300061719 Bacteria 1768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_107519_c1 nmdc:mga03683_107519_c1_875_1210 111
2 iso_pu_bacteria 2524023210 2524465863 133
3 3300010375 Ga0105239_10649243 Ga0105239_106492432 134
4 3300013306 Ga0163162_10216696 Ga0163162_102166963 134
5 3300035692 Ga0373935_0439319 Ga0373935_0439319_66_470 134
6 3300046674 Ga0495588_0412582 Ga0495588_0412582_119_523 134
7 3300048903 Ga0496100_0137249 Ga0496100_0137249_438_842 134
8 3300048904 Ga0496101_0232477 Ga0496101_0232477_150_554 134
9 3300048905 Ga0496102_0516631 Ga0496102_0516631_258_662 134
10 3300048917 Ga0496114_0756656 Ga0496114_0756656_159_563 134
11 3300005344 Ga0070661_100243690 Ga0070661_1002436901 135
12 3300005355 Ga0070671_100713028 Ga0070671_1007130281 135
13 3300005455 Ga0070663_100073751 Ga0070663_1000737513 135
14 3300005548 Ga0070665_100013100 Ga0070665_1000131002 135
15 3300005617 Ga0068859_101196745 Ga0068859_1011967451 135
16 3300005842 Ga0068858_100741746 Ga0068858_1007417462 135
17 3300006038 Ga0075365_10016437 Ga0075365_100164374 135
18 3300006048 Ga0075363_100014770 Ga0075363_1000147706 135
19 3300006195 Ga0075366_10157772 Ga0075366_101577723 135
20 3300006353 Ga0075370_10020322 Ga0075370_100203225 135
21 3300006358 Ga0068871_100776822 Ga0068871_1007768222 135
22 3300006931 Ga0097620_101196835 Ga0097620_1011968352 135
23 3300009545 Ga0105237_12447003 Ga0105237_124470031 135
24 3300014968 Ga0157379_11541420 Ga0157379_115414201 135
25 3300025297 Ga0209758_1081625 Ga0209758_10816252 135
26 3300025900 Ga0207710_10164150 Ga0207710_101641502 135
27 3300025920 Ga0207649_10403475 Ga0207649_104034752 135
28 3300025940 Ga0207691_10685299 Ga0207691_106852992 135
29 3300026067 Ga0207678_10023509 Ga0207678_100235092 135
30 3300028379 Ga0268266_10001136 Ga0268266_1000113619 135
31 3300041452 Ga0451793_1915486 Ga0451793_1915486_65_472 135
32 3300048903 Ga0496100_0739927 Ga0496100_0739927_154_567 135
33 3300048912 Ga0496109_0723497 Ga0496109_0723497_440_853 135
34 3300050490 nmdc:mga03n38_12993_c1 nmdc:mga03n38_12993_c1_1941_2354 135
35 3300050491 nmdc:mga00v17_86774_c1 nmdc:mga00v17_86774_c1_692_1105 135
36 3300050492 nmdc:mga0yw44_31797_c1 nmdc:mga0yw44_31797_c1_1424_1837 135
37 3300050493 nmdc:mga0k408_148173_c1 nmdc:mga0k408_148173_c1_15_428 135
38 3300050494 nmdc:mga06z11_8466_c1 nmdc:mga06z11_8466_c1_2755_3168 135
39 3300050496 nmdc:mga07m45_54052_c1 nmdc:mga07m45_54052_c1_1267_1680 135
40 3300006844 Ga0075428_100302984 Ga0075428_1003029841 136
41 3300003215 JGI25153J46596_10010032 JGI25153J46596_100100321 137
42 3300003771 Ga0055526_1018086 Ga0055526_10180862 137
43 3300005333 Ga0070677_10058589 Ga0070677_100585892 137
44 3300005341 Ga0070691_10934889 Ga0070691_109348891 137
45 3300005355 Ga0070671_100148103 Ga0070671_1001481032 137
46 3300005364 Ga0070673_101694160 Ga0070673_1016941601 137
47 3300005365 Ga0070688_100561755 Ga0070688_1005617552 137
48 3300005437 Ga0070710_10425649 Ga0070710_104256492 137
49 3300005614 Ga0068856_100513735 Ga0068856_1005137352 137
50 3300006051 Ga0075364_10573886 Ga0075364_105738862 137
51 3300006173 Ga0070716_100034174 Ga0070716_1000341744 137
52 3300006175 Ga0070712_100073635 Ga0070712_1000736351 137
53 3300006177 Ga0075362_10086410 Ga0075362_100864103 137
54 3300006195 Ga0075366_10722754 Ga0075366_107227541 137
55 3300007788 Ga0099795_10043944 Ga0099795_100439442 137
56 3300009176 Ga0105242_10343862 Ga0105242_103438622 137
57 3300009177 Ga0105248_10168417 Ga0105248_101684174 137
58 3300009545 Ga0105237_10106632 Ga0105237_101066323 137
59 3300009553 Ga0105249_11597093 Ga0105249_115970931 137
60 3300010159 Ga0099796_10009289 Ga0099796_100092893 137
61 3300010375 Ga0105239_10409962 Ga0105239_104099621 137
62 3300011119 Ga0105246_10339704 Ga0105246_103397042 137
63 3300013296 Ga0157374_11393289 Ga0157374_113932891 137
64 3300013306 Ga0163162_11215176 Ga0163162_112151761 137
65 3300025295 Ga0209564_1000755 Ga0209564_100075541 137
66 3300025297 Ga0209758_1005478 Ga0209758_10054784 137
67 3300025893 Ga0207682_10059177 Ga0207682_100591773 137
68 3300025898 Ga0207692_10022084 Ga0207692_100220841 137
69 3300025915 Ga0207693_10009325 Ga0207693_100093259 137
70 3300025931 Ga0207644_10799820 Ga0207644_107998201 137
71 3300025939 Ga0207665_10023296 Ga0207665_100232965 137
72 3300025941 Ga0207711_10756306 Ga0207711_107563061 137
73 3300025944 Ga0207661_10972709 Ga0207661_109727091 137
74 3300025960 Ga0207651_11538812 Ga0207651_115388121 137
75 3300025961 Ga0207712_11470247 Ga0207712_114702471 137
76 3300025972 Ga0207668_11815114 Ga0207668_118151141 137
77 3300026023 Ga0207677_10633401 Ga0207677_106334012 137
78 3300026035 Ga0207703_11065545 Ga0207703_110655452 137
79 3300026121 Ga0207683_10128981 Ga0207683_101289814 137
80 3300026142 Ga0207698_10568036 Ga0207698_105680361 137
81 3300027512 Ga0209179_1008779 Ga0209179_10087792 137
82 3300027671 Ga0209588_1019784 Ga0209588_10197843 137
83 3300031995 Ga0307409_101698202 Ga0307409_1016982022 137
84 3300032126 Ga0307415_100801028 Ga0307415_1008010282 137
85 3300034816 Ga0373930_0019370 Ga0373930_0019370_620_1129 137
86 3300034819 Ga0373958_0037953 Ga0373958_0037953_293_802 137
87 3300035084 Ga0373928_0023752 Ga0373928_0023752_621_1130 137
88 3300035170 Ga0373943_0289074 Ga0373943_0289074_100_567 137
89 3300035171 Ga0373946_0176394 Ga0373946_0176394_535_1002 137
90 3300035171 Ga0373946_0650910 Ga0373946_0650910_107_520 137
91 3300035691 Ga0373931_0003428 Ga0373931_0003428_2114_2623 137
92 3300035695 Ga0373927_0039246 Ga0373927_0039246_710_1177 137
93 3300035725 Ga0373947_0079581 Ga0373947_0079581_735_1244 137
94 3300035725 Ga0373947_0165966 Ga0373947_0165966_305_718 137
95 3300037068 Ga0373925_0013452 Ga0373925_0013452_4902_5369 137
96 3300046452 Ga0495617_180806 Ga0495617_180806_183_596 137
97 3300046460 Ga0495638_0557939 Ga0495638_0557939_130_549 137
98 3300046499 Ga0495594_0656553 Ga0495594_0656553_52_519 137
99 3300046500 Ga0495596_0117331 Ga0495596_0117331_401_814 137
100 3300046523 Ga0495644_0091283 Ga0495644_0091283_152_565 137
101 3300046648 Ga0495611_0098496 Ga0495611_0098496_393_812 137
102 3300047319 Ga0495674_0550823 Ga0495674_0550823_302_769 137
103 3300048903 Ga0496100_0198462 Ga0496100_0198462_649_1158 137
104 3300048904 Ga0496101_0075055 Ga0496101_0075055_1220_1729 137
105 3300048905 Ga0496102_0484942 Ga0496102_0484942_346_855 137
106 3300048907 Ga0496104_0156668 Ga0496104_0156668_1530_2039 137
107 3300048908 Ga0496105_0184881 Ga0496105_0184881_397_906 137
108 3300048909 Ga0496106_0740323 Ga0496106_0740323_304_717 137
109 3300048912 Ga0496109_0633094 Ga0496109_0633094_75_488 137
110 3300048913 Ga0496110_0557313 Ga0496110_0557313_554_967 137
111 3300048914 Ga0496111_0377439 Ga0496111_0377439_177_686 137
112 3300048915 Ga0496112_0012229 Ga0496112_0012229_2894_3403 137
113 3300048917 Ga0496114_0476359 Ga0496114_0476359_71_484 137
114 3300048918 Ga0496115_0019746 Ga0496115_0019746_1104_1613 137
115 3300048924 Ga0496121_0237950 Ga0496121_0237950_146_559 137
116 3300048925 Ga0496122_0093188 Ga0496122_0093188_519_932 137
117 3300048927 Ga0496124_0238547 Ga0496124_0238547_661_1074 137
118 3300048929 Ga0496126_0011852 Ga0496126_0011852_5554_5967 137
119 3300049662 Ga0501222_015334 Ga0501222_015334_568_987 137
120 3300053092 Ga0500583_0098116 Ga0500583_0098116_380_799 137
121 3300002075 JGI24738J21930_10039071 JGI24738J21930_100390712 138
122 3300005295 Ga0065707_10411836 Ga0065707_104118362 138
123 3300005327 Ga0070658_10102491 Ga0070658_101024914 138
124 3300005328 Ga0070676_10032552 Ga0070676_100325522 138
125 3300005328 Ga0070676_10920933 Ga0070676_109209331 138
126 3300005329 Ga0070683_100014532 Ga0070683_1000145327 138
127 3300005331 Ga0070670_100202578 Ga0070670_1002025782 138
128 3300005331 Ga0070670_100447193 Ga0070670_1004471932 138
129 3300005334 Ga0068869_100073753 Ga0068869_1000737533 138
130 3300005334 Ga0068869_100667149 Ga0068869_1006671491 138
131 3300005335 Ga0070666_10260339 Ga0070666_102603392 138
132 3300005335 Ga0070666_10555555 Ga0070666_105555551 138
133 3300005336 Ga0070680_100056302 Ga0070680_1000563024 138
134 3300005337 Ga0070682_100000221 Ga0070682_10000022122 138
135 3300005337 Ga0070682_100036436 Ga0070682_1000364364 138
136 3300005338 Ga0068868_100061212 Ga0068868_1000612122 138
137 3300005338 Ga0068868_100071036 Ga0068868_1000710361 138
138 3300005339 Ga0070660_100323778 Ga0070660_1003237782 138
139 3300005340 Ga0070689_101404892 Ga0070689_1014048921 138
140 3300005341 Ga0070691_10240693 Ga0070691_102406931 138
141 3300005344 Ga0070661_100090117 Ga0070661_1000901174 138
142 3300005345 Ga0070692_10308265 Ga0070692_103082651 138
143 3300005345 Ga0070692_10671824 Ga0070692_106718241 138
144 3300005347 Ga0070668_100073611 Ga0070668_1000736112 138
145 3300005347 Ga0070668_100194020 Ga0070668_1001940203 138
146 3300005353 Ga0070669_100179644 Ga0070669_1001796441 138
147 3300005354 Ga0070675_100451557 Ga0070675_1004515572 138
148 3300005355 Ga0070671_100201808 Ga0070671_1002018082 138
149 3300005355 Ga0070671_100300849 Ga0070671_1003008493 138
150 3300005356 Ga0070674_100973734 Ga0070674_1009737342 138
151 3300005364 Ga0070673_100071969 Ga0070673_1000719693 138
152 3300005364 Ga0070673_100940013 Ga0070673_1009400132 138
153 3300005365 Ga0070688_100422816 Ga0070688_1004228162 138
154 3300005366 Ga0070659_100228300 Ga0070659_1002283003 138
155 3300005367 Ga0070667_100370376 Ga0070667_1003703762 138
156 3300005434 Ga0070709_10554435 Ga0070709_105544352 138
157 3300005435 Ga0070714_100342717 Ga0070714_1003427171 138
158 3300005436 Ga0070713_100009306 Ga0070713_1000093062 138
159 3300005439 Ga0070711_100583234 Ga0070711_1005832341 138
160 3300005440 Ga0070705_101682567 Ga0070705_1016825671 138
161 3300005441 Ga0070700_100290777 Ga0070700_1002907771 138
162 3300005441 Ga0070700_101261072 Ga0070700_1012610721 138
163 3300005444 Ga0070694_100143654 Ga0070694_1001436542 138
164 3300005444 Ga0070694_100391491 Ga0070694_1003914911 138
165 3300005445 Ga0070708_100025495 Ga0070708_1000254951 138
166 3300005455 Ga0070663_100004680 Ga0070663_1000046806 138
167 3300005455 Ga0070663_100026089 Ga0070663_1000260893 138
168 3300005456 Ga0070678_100045978 Ga0070678_1000459783 138
169 3300005456 Ga0070678_100175261 Ga0070678_1001752612 138
170 3300005457 Ga0070662_101849616 Ga0070662_1018496161 138
171 3300005458 Ga0070681_10017662 Ga0070681_100176628 138
172 3300005458 Ga0070681_10139323 Ga0070681_101393233 138
173 3300005458 Ga0070681_10572560 Ga0070681_105725602 138
174 3300005458 Ga0070681_10974530 Ga0070681_109745302 138
175 3300005458 Ga0070681_11431742 Ga0070681_114317421 138
176 3300005459 Ga0068867_100506098 Ga0068867_1005060982 138
177 3300005459 Ga0068867_102053583 Ga0068867_1020535831 138
178 3300005466 Ga0070685_11310440 Ga0070685_113104401 138
179 3300005467 Ga0070706_100003954 Ga0070706_10000395415 138
180 3300005467 Ga0070706_100148753 Ga0070706_1001487532 138
181 3300005467 Ga0070706_100670797 Ga0070706_1006707971 138
182 3300005468 Ga0070707_100239877 Ga0070707_1002398772 138
183 3300005468 Ga0070707_100336420 Ga0070707_1003364202 138
184 3300005468 Ga0070707_101439549 Ga0070707_1014395491 138
185 3300005471 Ga0070698_100085836 Ga0070698_1000858364 138
186 3300005518 Ga0070699_100055894 Ga0070699_1000558942 138
187 3300005530 Ga0070679_100027556 Ga0070679_1000275567 138
188 3300005535 Ga0070684_100078687 Ga0070684_1000786874 138
189 3300005539 Ga0068853_100003590 Ga0068853_10000359013 138
190 3300005546 Ga0070696_100183633 Ga0070696_1001836332 138
191 3300005547 Ga0070693_100155060 Ga0070693_1001550602 138
192 3300005548 Ga0070665_100135598 Ga0070665_1001355984 138
193 3300005548 Ga0070665_100142934 Ga0070665_1001429342 138
194 3300005548 Ga0070665_100176827 Ga0070665_1001768271 138
195 3300005549 Ga0070704_100261456 Ga0070704_1002614562 138
196 3300005563 Ga0068855_100460714 Ga0068855_1004607143 138
197 3300005564 Ga0070664_100260739 Ga0070664_1002607392 138
198 3300005564 Ga0070664_100496003 Ga0070664_1004960032 138
199 3300005577 Ga0068857_100046709 Ga0068857_1000467093 138
200 3300005577 Ga0068857_100220672 Ga0068857_1002206723 138
201 3300005577 Ga0068857_101101025 Ga0068857_1011010252 138
202 3300005578 Ga0068854_100353313 Ga0068854_1003533131 138
203 3300005614 Ga0068856_100944477 Ga0068856_1009444772 138
204 3300005615 Ga0070702_100594126 Ga0070702_1005941261 138
205 3300005616 Ga0068852_100062363 Ga0068852_1000623632 138
206 3300005617 Ga0068859_100157976 Ga0068859_1001579762 138
207 3300005618 Ga0068864_100031862 Ga0068864_1000318626 138
208 3300005618 Ga0068864_100189671 Ga0068864_1001896714 138
209 3300005719 Ga0068861_100311293 Ga0068861_1003112933 138
210 3300005719 Ga0068861_100455250 Ga0068861_1004552502 138
211 3300005719 Ga0068861_101478870 Ga0068861_1014788701 138
212 3300005840 Ga0068870_10329634 Ga0068870_103296342 138
213 3300005842 Ga0068858_100119536 Ga0068858_1001195364 138
214 3300005843 Ga0068860_100369734 Ga0068860_1003697342 138
215 3300005843 Ga0068860_102578571 Ga0068860_1025785711 138
216 3300005844 Ga0068862_100315519 Ga0068862_1003155192 138
217 3300005844 Ga0068862_102334027 Ga0068862_1023340271 138
218 3300005937 Ga0081455_10528597 Ga0081455_105285972 138
219 3300005983 Ga0081540_1026662 Ga0081540_10266623 138
220 3300006028 Ga0070717_10000460 Ga0070717_1000046011 138
221 3300006028 Ga0070717_10283116 Ga0070717_102831162 138
222 3300006038 Ga0075365_10075675 Ga0075365_100756753 138
223 3300006042 Ga0075368_10067325 Ga0075368_100673252 138
224 3300006048 Ga0075363_100253343 Ga0075363_1002533432 138
225 3300006051 Ga0075364_10058712 Ga0075364_100587124 138
226 3300006163 Ga0070715_10004544 Ga0070715_100045447 138
227 3300006178 Ga0075367_10487685 Ga0075367_104876852 138
228 3300006178 Ga0075367_10592423 Ga0075367_105924231 138
229 3300006178 Ga0075367_10882358 Ga0075367_108823581 138
230 3300006186 Ga0075369_10032572 Ga0075369_100325724 138
231 3300006237 Ga0097621_100119193 Ga0097621_1001191932 138
232 3300006237 Ga0097621_100170504 Ga0097621_1001705043 138
233 3300006353 Ga0075370_10295151 Ga0075370_102951512 138
234 3300006358 Ga0068871_100031423 Ga0068871_1000314235 138
235 3300006358 Ga0068871_100104460 Ga0068871_1001044604 138
236 3300006844 Ga0075428_100057254 Ga0075428_1000572544 138
237 3300006844 Ga0075428_100573781 Ga0075428_1005737812 138
238 3300006846 Ga0075430_101071662 Ga0075430_1010716621 138
239 3300006847 Ga0075431_100025151 Ga0075431_1000251513 138
240 3300006847 Ga0075431_100026738 Ga0075431_1000267383 138
241 3300006847 Ga0075431_100479679 Ga0075431_1004796792 138
242 3300006852 Ga0075433_10030210 Ga0075433_100302104 138
243 3300006852 Ga0075433_10080018 Ga0075433_100800184 138
244 3300006852 Ga0075433_10152117 Ga0075433_101521172 138
245 3300006852 Ga0075433_10378559 Ga0075433_103785591 138
246 3300006871 Ga0075434_100017827 Ga0075434_1000178273 138
247 3300006871 Ga0075434_100019717 Ga0075434_1000197172 138
248 3300006871 Ga0075434_100020491 Ga0075434_1000204918 138
249 3300006871 Ga0075434_100853761 Ga0075434_1008537612 138
250 3300006880 Ga0075429_100071979 Ga0075429_1000719792 138
251 3300006880 Ga0075429_100754097 Ga0075429_1007540971 138
252 3300006881 Ga0068865_100203545 Ga0068865_1002035453 138
253 3300006881 Ga0068865_101621525 Ga0068865_1016215251 138
254 3300006914 Ga0075436_100235838 Ga0075436_1002358381 138
255 3300006914 Ga0075436_100274119 Ga0075436_1002741192 138
256 3300006931 Ga0097620_100157985 Ga0097620_1001579852 138
257 3300007076 Ga0075435_100009105 Ga0075435_1000091059 138
258 3300007076 Ga0075435_100010376 Ga0075435_1000103766 138
259 3300007076 Ga0075435_100569881 Ga0075435_1005698812 138
260 3300007076 Ga0075435_100629483 Ga0075435_1006294832 138
261 3300007265 Ga0099794_10166974 Ga0099794_101669741 138
262 3300009093 Ga0105240_10150608 Ga0105240_101506085 138
263 3300009101 Ga0105247_10936548 Ga0105247_109365481 138
264 3300009101 Ga0105247_11337007 Ga0105247_113370071 138
265 3300009147 Ga0114129_10076430 Ga0114129_100764306 138
266 3300009147 Ga0114129_10277424 Ga0114129_102774243 138
267 3300009147 Ga0114129_11567761 Ga0114129_115677611 138
268 3300009174 Ga0105241_12647853 Ga0105241_126478531 138
269 3300009551 Ga0105238_10001743 Ga0105238_100017434 138
270 3300009551 Ga0105238_11359587 Ga0105238_113595872 138
271 3300010375 Ga0105239_10232066 Ga0105239_102320663 138
272 3300010375 Ga0105239_11311462 Ga0105239_113114622 138
273 3300011119 Ga0105246_10059340 Ga0105246_100593404 138
274 3300013306 Ga0163162_10369010 Ga0163162_103690102 138
275 3300013308 Ga0157375_10295081 Ga0157375_102950812 138
276 3300014968 Ga0157379_10060147 Ga0157379_100601474 138
277 3300014968 Ga0157379_10368141 Ga0157379_103681412 138
278 3300020070 Ga0206356_10603777 Ga0206356_106037772 138
279 3300021384 Ga0213876_10521498 Ga0213876_105214982 138
280 3300025253 Ga0209677_101639 Ga0209677_10163910 138
281 3300025254 Ga0209148_1006467 Ga0209148_10064673 138
282 3300025272 Ga0209455_1001472 Ga0209455_100147212 138
283 3300025321 Ga0207656_10089015 Ga0207656_100890152 138
284 3300025900 Ga0207710_10011063 Ga0207710_100110632 138
285 3300025903 Ga0207680_10163305 Ga0207680_101633052 138
286 3300025904 Ga0207647_10023917 Ga0207647_100239172 138
287 3300025905 Ga0207685_10593758 Ga0207685_105937581 138
288 3300025907 Ga0207645_10038640 Ga0207645_100386403 138
289 3300025907 Ga0207645_10184660 Ga0207645_101846601 138
290 3300025909 Ga0207705_10234508 Ga0207705_102345083 138
291 3300025910 Ga0207684_10144602 Ga0207684_101446022 138
292 3300025910 Ga0207684_10708467 Ga0207684_107084672 138
293 3300025911 Ga0207654_10014746 Ga0207654_100147464 138
294 3300025912 Ga0207707_10001016 Ga0207707_1000101618 138
295 3300025913 Ga0207695_10511341 Ga0207695_105113412 138
296 3300025914 Ga0207671_10031884 Ga0207671_100318843 138
297 3300025914 Ga0207671_10083323 Ga0207671_100833233 138
298 3300025916 Ga0207663_10208349 Ga0207663_102083492 138
299 3300025917 Ga0207660_10000924 Ga0207660_1000092419 138
300 3300025917 Ga0207660_10965227 Ga0207660_109652271 138
301 3300025918 Ga0207662_11050334 Ga0207662_110503341 138
302 3300025919 Ga0207657_10001391 Ga0207657_1000139120 138
303 3300025919 Ga0207657_10371953 Ga0207657_103719532 138
304 3300025920 Ga0207649_10066665 Ga0207649_100666654 138
305 3300025921 Ga0207652_10003893 Ga0207652_100038939 138
306 3300025921 Ga0207652_10479758 Ga0207652_104797582 138
307 3300025922 Ga0207646_10078182 Ga0207646_100781822 138
308 3300025922 Ga0207646_10582073 Ga0207646_105820731 138
309 3300025923 Ga0207681_10882781 Ga0207681_108827811 138
310 3300025924 Ga0207694_10836320 Ga0207694_108363202 138
311 3300025925 Ga0207650_10288457 Ga0207650_102884572 138
312 3300025925 Ga0207650_10603917 Ga0207650_106039172 138
313 3300025926 Ga0207659_10133706 Ga0207659_101337061 138
314 3300025928 Ga0207700_10010911 Ga0207700_100109114 138
315 3300025929 Ga0207664_10301523 Ga0207664_103015232 138
316 3300025931 Ga0207644_10178384 Ga0207644_101783843 138
317 3300025931 Ga0207644_10273138 Ga0207644_102731383 138
318 3300025932 Ga0207690_10164702 Ga0207690_101647023 138
319 3300025932 Ga0207690_10336702 Ga0207690_103367022 138
320 3300025933 Ga0207706_10195270 Ga0207706_101952703 138
321 3300025934 Ga0207686_10256367 Ga0207686_102563672 138
322 3300025936 Ga0207670_11523453 Ga0207670_115234531 138
323 3300025938 Ga0207704_10133658 Ga0207704_101336581 138
324 3300025938 Ga0207704_11323176 Ga0207704_113231761 138
325 3300025939 Ga0207665_10269845 Ga0207665_102698453 138
326 3300025940 Ga0207691_10496282 Ga0207691_104962821 138
327 3300025940 Ga0207691_10619039 Ga0207691_106190392 138
328 3300025941 Ga0207711_10351249 Ga0207711_103512492 138
329 3300025941 Ga0207711_11821309 Ga0207711_118213091 138
330 3300025942 Ga0207689_10083915 Ga0207689_100839152 138
331 3300025942 Ga0207689_10717840 Ga0207689_107178402 138
332 3300025945 Ga0207679_10318278 Ga0207679_103182781 138
333 3300025945 Ga0207679_10463704 Ga0207679_104637042 138
334 3300025949 Ga0207667_10011614 Ga0207667_1001161410 138
335 3300025960 Ga0207651_10064111 Ga0207651_100641112 138
336 3300025972 Ga0207668_10197224 Ga0207668_101972243 138
337 3300025972 Ga0207668_10340694 Ga0207668_103406942 138
338 3300025981 Ga0207640_10048550 Ga0207640_100485502 138
339 3300025981 Ga0207640_10411395 Ga0207640_104113952 138
340 3300025986 Ga0207658_10675383 Ga0207658_106753832 138
341 3300026023 Ga0207677_10110732 Ga0207677_101107323 138
342 3300026035 Ga0207703_10024373 Ga0207703_100243732 138
343 3300026041 Ga0207639_10167178 Ga0207639_101671783 138
344 3300026041 Ga0207639_10185649 Ga0207639_101856493 138
345 3300026041 Ga0207639_10371451 Ga0207639_103714512 138
346 3300026067 Ga0207678_10004216 Ga0207678_1000421614 138
347 3300026067 Ga0207678_10024243 Ga0207678_100242436 138
348 3300026067 Ga0207678_10679000 Ga0207678_106790001 138
349 3300026067 Ga0207678_11032911 Ga0207678_110329112 138
350 3300026075 Ga0207708_10390452 Ga0207708_103904522 138
351 3300026078 Ga0207702_10270405 Ga0207702_102704051 138
352 3300026088 Ga0207641_10308005 Ga0207641_103080052 138
353 3300026095 Ga0207676_10062764 Ga0207676_100627644 138
354 3300026116 Ga0207674_10309414 Ga0207674_103094141 138
355 3300026118 Ga0207675_100126297 Ga0207675_1001262974 138
356 3300026118 Ga0207675_100153144 Ga0207675_1001531443 138
357 3300026118 Ga0207675_101894648 Ga0207675_1018946481 138
358 3300026121 Ga0207683_10029544 Ga0207683_100295446 138
359 3300026121 Ga0207683_10060366 Ga0207683_100603663 138
360 3300026121 Ga0207683_10155090 Ga0207683_101550904 138
361 3300026142 Ga0207698_11366829 Ga0207698_113668291 138
362 3300027866 Ga0209813_10219011 Ga0209813_102190111 138
363 3300028379 Ga0268266_10094515 Ga0268266_100945152 138
364 3300028379 Ga0268266_10192293 Ga0268266_101922932 138
365 3300028379 Ga0268266_10219898 Ga0268266_102198983 138
366 3300028380 Ga0268265_10480048 Ga0268265_104800482 138
367 3300028380 Ga0268265_11653270 Ga0268265_116532702 138
368 3300028381 Ga0268264_10171793 Ga0268264_101717932 138
369 3300028786 Ga0307517_10000098 Ga0307517_10000098110 138
370 3300028786 Ga0307517_10475056 Ga0307517_104750561 138
371 3300028794 Ga0307515_10104075 Ga0307515_101040754 138
372 3300031090 Ga0265760_10007374 Ga0265760_100073742 138
373 3300031456 Ga0307513_10210520 Ga0307513_102105201 138
374 3300031456 Ga0307513_10388635 Ga0307513_103886351 138
375 3300031616 Ga0307508_10476471 Ga0307508_104764712 138
376 3300031616 Ga0307508_10716336 Ga0307508_107163362 138
377 3300031711 Ga0265314_10051287 Ga0265314_100512871 138
378 3300031712 Ga0265342_10178301 Ga0265342_101783012 138
379 3300031730 Ga0307516_10046388 Ga0307516_100463883 138
380 3300031730 Ga0307516_10524733 Ga0307516_105247331 138
381 3300032126 Ga0307415_100297967 Ga0307415_1002979673 138
382 3300033180 Ga0307510_10085315 Ga0307510_100853154 138
383 3300033442 Ga0315911_1000005 Ga0315911_1000005253 138
384 3300035118 Ga0373954_0157631 Ga0373954_0157631_377_793 138
385 3300037466 Ga0395898_0475635 Ga0395898_0475635_244_672 138
386 3300037471 Ga0395905_0081275 Ga0395905_0081275_281_709 138
387 3300037853 Ga0436364_0581979 Ga0436364_0581979_37_453 138
388 3300039437 Ga0436365_0808674 Ga0436365_0808674_142_558 138
389 3300042157 Ga0439458_0107875 Ga0439458_0107875_157_573 138
390 3300042438 Ga0439459_0025347 Ga0439459_0025347_301_726 138
391 3300044673 Ga0453683_0145307 Ga0453683_0145307_596_1015 138
392 3300044684 Ga0466966_0783188 Ga0466966_0783188_16_432 138
393 3300044694 Ga0466963_0494927 Ga0466963_0494927_331_747 138
394 3300044719 Ga0466971_0686711 Ga0466971_0686711_33_449 138
395 3300044842 Ga0466957_0105153 Ga0466957_0105153_679_1176 138
396 3300044842 Ga0466957_0422959 Ga0466957_0422959_313_729 138
397 3300045836 Ga0466958_0791111 Ga0466958_0791111_49_465 138
398 3300045976 Ga0466967_0130167 Ga0466967_0130167_783_1250 138
399 3300045976 Ga0466967_1077883 Ga0466967_1077883_13_438 138
400 3300046460 Ga0495638_0348779 Ga0495638_0348779_254_670 138
401 3300046462 Ga0495651_0091400 Ga0495651_0091400_1343_1759 138
402 3300046474 Ga0495605_0075741 Ga0495605_0075741_432_848 138
403 3300046475 Ga0495639_0363976 Ga0495639_0363976_186_602 138
404 3300046491 Ga0495584_0097384 Ga0495584_0097384_611_1027 138
405 3300046499 Ga0495594_0070484 Ga0495594_0070484_1318_1734 138
406 3300046506 Ga0495583_0194043 Ga0495583_0194043_153_569 138
407 3300046518 Ga0495631_0368908 Ga0495631_0368908_135_551 138
408 3300046519 Ga0495632_0249773 Ga0495632_0249773_286_702 138
409 3300046520 Ga0495637_0177353 Ga0495637_0177353_201_617 138
410 3300046523 Ga0495644_0036932 Ga0495644_0036932_413_829 138
411 3300046525 Ga0495663_0173207 Ga0495663_0173207_17_433 138
412 3300046528 Ga0495642_0157888 Ga0495642_0157888_71_487 138
413 3300046538 Ga0495609_0143684 Ga0495609_0143684_303_719 138
414 3300046557 Ga0495622_0135417 Ga0495622_0135417_153_569 138
415 3300046616 Ga0495668_0029504 Ga0495668_0029504_1262_1678 138
416 3300046660 Ga0495625_0272457 Ga0495625_0272457_381_860 138
417 3300046660 Ga0495625_0572893 Ga0495625_0572893_180_596 138
418 3300046660 Ga0495625_0735860 Ga0495625_0735860_31_447 138
419 3300046684 Ga0495669_0358943 Ga0495669_0358943_151_567 138
420 3300046694 Ga0495649_0360912 Ga0495649_0360912_246_662 138
421 3300046809 Ga0495600_0148061 Ga0495600_0148061_804_1223 138
422 3300047318 Ga0495636_0097970 Ga0495636_0097970_132_548 138
423 3300047319 Ga0495674_0395793 Ga0495674_0395793_175_642 138
424 3300047320 Ga0495672_0025981 Ga0495672_0025981_2408_2824 138
425 3300047321 Ga0495676_0105143 Ga0495676_0105143_1391_1807 138
426 3300047322 Ga0495680_0339143 Ga0495680_0339143_116_577 138
427 3300047472 Ga0495686_0212111 Ga0495686_0212111_293_709 138
428 3300048091 Ga0495626_0243389 Ga0495626_0243389_18_434 138
429 3300048903 Ga0496100_0468766 Ga0496100_0468766_222_638 138
430 3300048905 Ga0496102_1414131 Ga0496102_1414131_153_569 138
431 3300048907 Ga0496104_0116018 Ga0496104_0116018_1443_1859 138
432 3300048910 Ga0496107_0319923 Ga0496107_0319923_327_743 138
433 3300048910 Ga0496107_0374863 Ga0496107_0374863_262_678 138
434 3300048910 Ga0496107_0474831 Ga0496107_0474831_394_903 138
435 3300048912 Ga0496109_1187330 Ga0496109_1187330_50_466 138
436 3300048914 Ga0496111_0859534 Ga0496111_0859534_108_524 138
437 3300048916 Ga0496113_0278216 Ga0496113_0278216_200_616 138
438 3300048918 Ga0496115_0453317 Ga0496115_0453317_180_596 138
439 3300048920 Ga0496117_0126187 Ga0496117_0126187_629_1054 138
440 3300048921 Ga0496118_0065065 Ga0496118_0065065_810_1226 138
441 3300048921 Ga0496118_0393509 Ga0496118_0393509_10_435 138
442 3300048922 Ga0496119_0250125 Ga0496119_0250125_413_838 138
443 3300048924 Ga0496121_0000265 Ga0496121_0000265_49763_50245 138
444 3300048924 Ga0496121_0011280 Ga0496121_0011280_5565_5981 138
445 3300048924 Ga0496121_0011669 Ga0496121_0011669_2141_2566 138
446 3300048924 Ga0496121_0028222 Ga0496121_0028222_598_1014 138
447 3300048924 Ga0496121_0040223 Ga0496121_0040223_255_683 138
448 3300048924 Ga0496121_0155945 Ga0496121_0155945_212_628 138
449 3300048924 Ga0496121_0627412 Ga0496121_0627412_35_451 138
450 3300048925 Ga0496122_0090249 Ga0496122_0090249_919_1347 138
451 3300048927 Ga0496124_0794302 Ga0496124_0794302_12_437 138
452 3300048928 Ga0496125_0000176 Ga0496125_0000176_29243_29671 138
453 3300048928 Ga0496125_0001764 Ga0496125_0001764_7543_7971 138
454 3300048928 Ga0496125_0096343 Ga0496125_0096343_103_519 138
455 3300048929 Ga0496126_0026811 Ga0496126_0026811_599_1051 138
456 3300048929 Ga0496126_0072217 Ga0496126_0072217_332_760 138
457 3300048929 Ga0496126_0084815 Ga0496126_0084815_2336_2764 138
458 3300049460 Ga0495682_0169008 Ga0495682_0169008_168_641 138
459 3300049591 Ga0501075_0775252 Ga0501075_0775252_54_473 138
460 3300050490 nmdc:mga03n38_209348_c1 nmdc:mga03n38_209348_c1_583_999 138
461 3300050490 nmdc:mga03n38_269137_c1 nmdc:mga03n38_269137_c1_32_448 138
462 3300050492 nmdc:mga0yw44_234364_c1 nmdc:mga0yw44_234364_c1_418_834 138
463 3300050493 nmdc:mga0k408_339683_c1 nmdc:mga0k408_339683_c1_192_608 138
464 3300050494 nmdc:mga06z11_93967_c1 nmdc:mga06z11_93967_c1_963_1379 138
465 3300050507 nmdc:mga05p37_18843_c1 nmdc:mga05p37_18843_c1_6659_7102 138
466 3300050507 nmdc:mga05p37_224925_c1 nmdc:mga05p37_224925_c1_584_1027 138
467 3300050507 nmdc:mga05p37_776602_c1 nmdc:mga05p37_776602_c1_354_779 138
468 3300050507 nmdc:mga05p37_954601_c1 nmdc:mga05p37_954601_c1_248_670 138
469 3300050508 nmdc:mga09592_216059_c1 nmdc:mga09592_216059_c1_983_1405 138
470 3300050508 nmdc:mga09592_24966_c1 nmdc:mga09592_24966_c1_2380_2823 138
471 3300050510 nmdc:mga06r32_138185_c1 nmdc:mga06r32_138185_c1_952_1395 138
472 3300050510 nmdc:mga06r32_30783_c1 nmdc:mga06r32_30783_c1_3746_4168 138
473 3300050512 nmdc:mga0n895_19007_c1 nmdc:mga0n895_19007_c1_4115_4543 138
474 3300050512 nmdc:mga0n895_314959_c1 nmdc:mga0n895_314959_c1_1134_1559 138
475 3300050512 nmdc:mga0n895_624675_c1 nmdc:mga0n895_624675_c1_187_630 138
476 3300050513 nmdc:mga0rr50_27386_c1 nmdc:mga0rr50_27386_c1_611_1039 138
477 3300050513 nmdc:mga0rr50_618406_c1 nmdc:mga0rr50_618406_c1_376_819 138
478 3300050513 nmdc:mga0rr50_9591_c1 nmdc:mga0rr50_9591_c1_1529_1954 138
479 3300050515 nmdc:mga0a205_511301_c1 nmdc:mga0a205_511301_c1_349_792 138
480 3300050515 nmdc:mga0a205_84393_c1 nmdc:mga0a205_84393_c1_1862_2290 138
481 3300050516 nmdc:mga0sz30_150718_c1 nmdc:mga0sz30_150718_c1_68_484 138
482 3300053077 Ga0495601_0237194 Ga0495601_0237194_567_1046 138
483 3300053083 Ga0495655_0033704 Ga0495655_0033704_478_894 138
484 3300053083 Ga0495655_0255220 Ga0495655_0255220_131_547 138
485 3300053084 Ga0495595_0031235 Ga0495595_0031235_628_1107 138
486 3300053085 Ga0495619_0098538 Ga0495619_0098538_380_859 138
487 3300053093 Ga0500651_0365693 Ga0500651_0365693_240_656 138
488 3300053096 Ga0500641_0024457 Ga0500641_0024457_1512_1928 138
489 3300053096 Ga0500641_0106397 Ga0500641_0106397_691_1113 138
490 3300053108 Ga0500562_147700 Ga0500562_147700_161_577 138
491 3300053109 Ga0500569_018952 Ga0500569_018952_546_962 138
492 3300053137 Ga0500561_0058078 Ga0500561_0058078_31_447 138
493 3300053139 Ga0500568_0076768 Ga0500568_0076768_448_864 138
494 3300053146 Ga0500588_0105843 Ga0500588_0105843_43_459 138
495 3300053150 Ga0500603_063804 Ga0500603_063804_455_871 138
496 3300061719 Ga0466962_0063179 Ga0466962_0063179_1171_1587 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

33

146

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7379 1 112
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7196 1 112
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7055 1 112
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7034 1 112
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.6914 1 112
ID Description Score Start End Superfamily
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7436 1 112 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7379 1 112 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6884 1 112 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6815 2 115 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6717 1 112 3.30.70.1060
ID Description Score Start End GO Terms
AF-J3DD56-F1-model_v4 YCII-related domain-containing protein 0.9454 1 109
AF-A0A534STC8-F1-model_v4 Bacterial transcription activator effector binding domain-containing protein 0.9432 1 135
AF-A0A178U656-F1-model_v4 Uncharacterized protein 0.9427 1 112 GO:0003677
GO:0003824
GO:0006352
GO:0016987
AF-A0A7Y6UGB1-F1-model_v4 YCII-related domain-containing protein 0.9427 1 117
AF-A5ERI2-F1-model_v4 deleted 0.9419 1 138

Feature Viewer

pLDDT pTM Quality
90.87 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map