F454946

General Info

Members Datasets Scaffolds Average Seq Length
496 149 992 327

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0066451|Ga0495626_0066451_253_1296
Length 347
Sequence MTGAAQVSGSAFSGWLQRKRSQWRSRTTARDGGEVVLGQRRVYILPTGAGLAFSALLLVLLVGSINYNLGLGYGLTFVAAASGLVDMILTWRNLAQLHLRAGRAPDVFAGSDVPFELHLANPTRLDRYAIWVDVDDVAEPRHALDVAAAGTVPVVLAVATAARGWRAAPRVRLSTRFPLGLFRAWSYWQPDSRALVYPFPEEDAPPLPMSGRAGMEGSGSGGSDDFGGVRSYQPGDPLRHLAWRQIARLDPALGGQLVTKHFEGGARQDLMLDFDALPPQLDLERKLSRMARWVLEAELRALPYALRIGRTEYGAAVGPAHQAACLRALALYGLPLDAGAPRAGEPQ

Samples

Sample ID Description Type Environment
1 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
32 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
33 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
36 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
37 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
38 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
39 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
40 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
41 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
53 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
54 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
60 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
61 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
62 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
63 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
64 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
74 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
75 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
76 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
77 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
78 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
79 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
97 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
144 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
145 2643221556 Massilia sp. Root1485 Isolate Unclassified
146 2643221684 Massilia sp. Root133 Isolate Unclassified
147 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
148 2842711865 Duganella sp. R-73148 Isolate Unclassified
149 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 4.03
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495626_0066451 3300048091 Bacteria 1630
2 rootH1_10000529 3300003316 Bacteria 1551
3 rootL2_10043948 3300003322 Bacteria 5226
4 rootL2_10074424 3300003322 Bacteria 3042
5 Ga0055525_1000074 3300003759 Bacteria 178058
6 Ga0070658_10219386 3300005327 Bacteria 1608
7 Ga0070680_100045826 3300005336 Bacteria 3556
8 Ga0070660_100032085 3300005339 Bacteria 3950
9 Ga0070659_100232607 3300005366 Bacteria 1523
10 Ga0068855_100026683 3300005563 Bacteria 6911
11 Ga0068855_100266241 3300005563 Bacteria 1907
12 Ga0068852_100090925 3300005616 Bacteria 2730
13 Ga0068865_100147961 3300006881 Bacteria 1778
14 Ga0105244_10004718 3300009036 Bacteria 9274
15 Ga0105243_10014738 3300009148 Bacteria 5913
16 Ga0105241_10132600 3300009174 Bacteria 2019
17 Ga0105246_10082850 3300011119 Bacteria 2290
18 Ga0209563_100003 3300025230 Bacteria 1932942
19 Ga0209677_105927 3300025253 Bacteria 3044
20 Ga0209148_1000832 3300025254 Bacteria 22046
21 Ga0207655_1015867 3300025728 Bacteria 4156
22 Ga0207705_10024094 3300025909 Bacteria 4343
23 Ga0207654_10100572 3300025911 Bacteria 1781
24 Ga0207660_10033525 3300025917 Bacteria 3553
25 Ga0207657_10021724 3300025919 Bacteria 6033
26 Ga0207687_10042659 3300025927 Bacteria 3122
27 Ga0207706_10038088 3300025933 Bacteria 4266
28 Ga0207706_10065008 3300025933 Bacteria 3212
29 Ga0207704_10013928 3300025938 Bacteria 4045
30 Ga0207679_10192591 3300025945 Bacteria 1697
31 Ga0207667_10028276 3300025949 Bacteria 6091
32 Ga0207667_10235180 3300025949 Bacteria 1876
33 Ga0316182_1334187 3300030745 Bacteria 1851
34 Ga0307509_10000033 3300031507 Bacteria 194363
35 Ga0316582_0082524 3300036647 Bacteria 2101
36 Ga0395899_0006504 3300037312 Bacteria 9052
37 Ga0395899_0013262 3300037312 Bacteria 6307
38 Ga0395899_0026536 3300037312 Bacteria 4370
39 Ga0395899_0056268 3300037312 Bacteria 2907
40 Ga0395899_0091752 3300037312 Bacteria 2200
41 Ga0395899_0191656 3300037312 Bacteria 1430
42 Ga0395900_0000640 3300037418 Bacteria 47118
43 Ga0395900_0001977 3300037418 Bacteria 23135
44 Ga0395900_0020062 3300037418 Bacteria 6816
45 Ga0395900_0032174 3300037418 Bacteria 5392
46 Ga0395900_0052333 3300037418 Bacteria 4203
47 Ga0395900_0083002 3300037418 Bacteria 3292
48 Ga0395900_0107686 3300037418 Bacteria 2863
49 Ga0395900_0119545 3300037418 Bacteria 2704
50 Ga0395900_0179643 3300037418 Bacteria 2151
51 Ga0395900_0216679 3300037418 Bacteria 1931
52 Ga0395900_0348129 3300037418 Bacteria 1456
53 Ga0395898_0077525 3300037466 Bacteria 3208
54 Ga0395898_0183647 3300037466 Bacteria 1998
55 Ga0395898_0232686 3300037466 Bacteria 1757
56 Ga0395898_0364925 3300037466 Bacteria 1377
57 Ga0395905_0155553 3300037471 Bacteria 2150
58 Ga0395905_0438252 3300037471 Bacteria 1204
59 Ga0395901_0000074 3300038443 Bacteria 138735
60 Ga0395901_0006503 3300038443 Bacteria 11827
61 Ga0395901_0035945 3300038443 Bacteria 5118
62 Ga0395901_0268238 3300038443 Bacteria 1776
63 Ga0395901_0314048 3300038443 Bacteria 1622
64 Ga0395901_0352226 3300038443 Bacteria 1519
65 Ga0439448_0000941 3300042005 Bacteria 7169
66 Ga0439455_0000453 3300042012 Bacteria 5585
67 Ga0439455_0018631 3300042012 Bacteria 1629
68 Ga0439455_0021211 3300042012 Bacteria 1547
69 Ga0450904_000235 3300042139 Bacteria 12076
70 Ga0466969_0103870 3300044656 Bacteria 1335
71 Ga0466969_0126813 3300044656 Bacteria 1185
72 Ga0466972_0005526 3300044658 Bacteria 6331
73 Ga0466972_0138136 3300044658 Bacteria 1147
74 Ga0466965_0013471 3300044683 Bacteria 3858
75 Ga0466965_0017593 3300044683 Bacteria 3418
76 Ga0466965_0082376 3300044683 Bacteria 1627
77 Ga0466966_0009460 3300044684 Bacteria 6456
78 Ga0466966_0010336 3300044684 Bacteria 6196
79 Ga0466966_0011361 3300044684 Bacteria 5907
80 Ga0466966_0021995 3300044684 Bacteria 4186
81 Ga0466966_0089057 3300044684 Bacteria 1917
82 Ga0466966_0089417 3300044684 Bacteria 1913
83 Ga0466961_0097541 3300044693 Bacteria 1853
84 Ga0466963_0081947 3300044694 Bacteria 2186
85 Ga0466964_0000520 3300044706 Bacteria 12008
86 Ga0466964_0001850 3300044706 Bacteria 7369
87 Ga0466968_0001796 3300044735 Bacteria 7744
88 Ga0466957_0000269 3300044842 Bacteria 25178
89 Ga0466957_0079338 3300044842 Bacteria 2042
90 Ga0466959_0004250 3300045049 Bacteria 9555
91 Ga0466959_0169728 3300045049 Bacteria 1530
92 Ga0466958_0209543 3300045836 Bacteria 1241
93 Ga0466958_0229467 3300045836 Bacteria 1185
94 Ga0466967_0012416 3300045976 Bacteria 6513
95 Ga0466967_0027658 3300045976 Bacteria 4720
96 Ga0495617_000169 3300046452 Bacteria 41491
97 Ga0495627_002042 3300046453 Bacteria 10354
98 Ga0495627_042527 3300046453 Bacteria 1392
99 Ga0495603_0037693 3300046455 Bacteria 2900
100 Ga0495603_0085913 3300046455 Bacteria 1841
101 Ga0495590_0000041 3300046457 Bacteria 121084
102 Ga0495590_0007150 3300046457 Bacteria 4318
103 Ga0495591_000213 3300046458 Bacteria 58510
104 Ga0495629_0004116 3300046459 Bacteria 10909
105 Ga0495629_0012571 3300046459 Bacteria 6131
106 Ga0495629_0034581 3300046459 Bacteria 3572
107 Ga0495638_0002032 3300046460 Bacteria 17205
108 Ga0495638_0008959 3300046460 Bacteria 7056
109 Ga0495638_0048744 3300046460 Bacteria 2650
110 Ga0495653_0008152 3300046463 Bacteria 8577
111 Ga0495653_0079119 3300046463 Bacteria 2435
112 Ga0495650_0000048 3300046471 Bacteria 334427
113 Ga0495650_0000274 3300046471 Bacteria 98605
114 Ga0495650_0000292 3300046471 Bacteria 92418
115 Ga0495650_0005922 3300046471 Bacteria 7768
116 Ga0495650_0038031 3300046471 Bacteria 2088
117 Ga0495582_0006182 3300046473 Bacteria 6665
118 Ga0495582_0007319 3300046473 Bacteria 6116
119 Ga0495582_0131072 3300046473 Bacteria 1416
120 Ga0495605_0000437 3300046474 Bacteria 37678
121 Ga0495605_0004510 3300046474 Bacteria 8156
122 Ga0495605_0008233 3300046474 Bacteria 5897
123 Ga0495605_0009915 3300046474 Bacteria 5340
124 Ga0495605_0020683 3300046474 Bacteria 3495
125 Ga0495605_0024515 3300046474 Bacteria 3155
126 Ga0495605_0044598 3300046474 Bacteria 2191
127 Ga0495639_0089196 3300046475 Bacteria 1445
128 Ga0495584_0000007 3300046491 Bacteria 294820
129 Ga0495584_0001275 3300046491 Bacteria 15333
130 Ga0495584_0001307 3300046491 Bacteria 15158
131 Ga0495584_0001980 3300046491 Bacteria 11794
132 Ga0495584_0002264 3300046491 Bacteria 10976
133 Ga0495584_0002519 3300046491 Bacteria 10373
134 Ga0495584_0003799 3300046491 Bacteria 8219
135 Ga0495584_0004883 3300046491 Bacteria 7163
136 Ga0495585_0000090 3300046492 Bacteria 95790
137 Ga0495585_0000518 3300046492 Bacteria 36483
138 Ga0495585_0001876 3300046492 Bacteria 15842
139 Ga0495585_0002276 3300046492 Bacteria 13866
140 Ga0495585_0003841 3300046492 Bacteria 9994
141 Ga0495585_0011278 3300046492 Bacteria 5291
142 Ga0495585_0027178 3300046492 Bacteria 3266
143 Ga0495585_0037366 3300046492 Bacteria 2735
144 Ga0495585_0042194 3300046492 Bacteria 2556
145 Ga0495585_0048148 3300046492 Bacteria 2371
146 Ga0495585_0057965 3300046492 Bacteria 2136
147 Ga0495585_0093394 3300046492 Bacteria 1618
148 Ga0495585_0094133 3300046492 Bacteria 1610
149 Ga0495585_0095498 3300046492 Bacteria 1596
150 Ga0495594_0004656 3300046499 Bacteria 7069
151 Ga0495594_0014230 3300046499 Bacteria 4165
152 Ga0495594_0023689 3300046499 Bacteria 3291
153 Ga0495594_0025991 3300046499 Bacteria 3148
154 Ga0495594_0076876 3300046499 Bacteria 1861
155 Ga0495596_0000358 3300046500 Bacteria 29481
156 Ga0495596_0001356 3300046500 Bacteria 14127
157 Ga0495596_0002301 3300046500 Bacteria 10377
158 Ga0495596_0002413 3300046500 Bacteria 10083
159 Ga0495596_0003641 3300046500 Bacteria 7737
160 Ga0495596_0005536 3300046500 Bacteria 5946
161 Ga0495596_0008039 3300046500 Bacteria 4713
162 Ga0495596_0010546 3300046500 Bacteria 4020
163 Ga0495596_0013941 3300046500 Bacteria 3394
164 Ga0495596_0017029 3300046500 Bacteria 3014
165 Ga0495596_0031731 3300046500 Bacteria 2108
166 Ga0495607_0000192 3300046501 Bacteria 65020
167 Ga0495607_0000842 3300046501 Bacteria 29026
168 Ga0495607_0004098 3300046501 Bacteria 10891
169 Ga0495607_0022500 3300046501 Bacteria 3957
170 Ga0495607_0032820 3300046501 Bacteria 3164
171 Ga0495607_0036909 3300046501 Bacteria 2939
172 Ga0495607_0039388 3300046501 Bacteria 2822
173 Ga0495607_0041660 3300046501 Bacteria 2726
174 Ga0495607_0048562 3300046501 Bacteria 2481
175 Ga0495607_0069052 3300046501 Bacteria 1979
176 Ga0495607_0069722 3300046501 Bacteria 1966
177 Ga0495583_0000075 3300046506 Bacteria 177074
178 Ga0495583_0000904 3300046506 Bacteria 35256
179 Ga0495583_0001226 3300046506 Bacteria 27295
180 Ga0495583_0003804 3300046506 Bacteria 11205
181 Ga0495583_0005304 3300046506 Bacteria 8806
182 Ga0495583_0005483 3300046506 Bacteria 8600
183 Ga0495583_0006108 3300046506 Bacteria 7944
184 Ga0495583_0035005 3300046506 Bacteria 2401
185 Ga0495583_0059352 3300046506 Bacteria 1715
186 Ga0495583_0100020 3300046506 Bacteria 1238
187 Ga0495606_0001578 3300046507 Bacteria 29867
188 Ga0495606_0003940 3300046507 Bacteria 15272
189 Ga0495606_0014953 3300046507 Bacteria 6019
190 Ga0495606_0024377 3300046507 Bacteria 4360
191 Ga0495606_0033693 3300046507 Bacteria 3529
192 Ga0495606_0035906 3300046507 Bacteria 3383
193 Ga0495606_0198939 3300046507 Bacteria 1143
194 Ga0495610_0000038 3300046512 Bacteria 181669
195 Ga0495610_0002531 3300046512 Bacteria 15253
196 Ga0495610_0022076 3300046512 Bacteria 3487
197 Ga0495616_0000280 3300046513 Bacteria 41320
198 Ga0495616_0006521 3300046513 Bacteria 7049
199 Ga0495616_0008101 3300046513 Bacteria 6255
200 Ga0495616_0009320 3300046513 Bacteria 5752
201 Ga0495616_0015278 3300046513 Bacteria 4270
202 Ga0495616_0015921 3300046513 Bacteria 4169
203 Ga0495616_0024205 3300046513 Bacteria 3259
204 Ga0495616_0024320 3300046513 Bacteria 3249
205 Ga0495616_0025061 3300046513 Bacteria 3191
206 Ga0495616_0033830 3300046513 Bacteria 2659
207 Ga0495616_0043555 3300046513 Bacteria 2279
208 Ga0495616_0050908 3300046513 Bacteria 2069
209 Ga0495616_0079409 3300046513 Bacteria 1572
210 Ga0495631_0001139 3300046518 Bacteria 16486
211 Ga0495631_0001371 3300046518 Bacteria 14849
212 Ga0495631_0006767 3300046518 Bacteria 5884
213 Ga0495631_0010968 3300046518 Bacteria 4473
214 Ga0495631_0016200 3300046518 Bacteria 3560
215 Ga0495631_0020900 3300046518 Bacteria 3053
216 Ga0495631_0065525 3300046518 Bacteria 1572
217 Ga0495632_0000098 3300046519 Bacteria 88691
218 Ga0495632_0000153 3300046519 Bacteria 71012
219 Ga0495632_0001553 3300046519 Bacteria 18940
220 Ga0495632_0004558 3300046519 Bacteria 9391
221 Ga0495632_0005186 3300046519 Bacteria 8690
222 Ga0495632_0009268 3300046519 Bacteria 5946
223 Ga0495632_0009270 3300046519 Bacteria 5944
224 Ga0495637_0000845 3300046520 Bacteria 20211
225 Ga0495637_0019910 3300046520 Bacteria 3094
226 Ga0495643_0000115 3300046522 Bacteria 130423
227 Ga0495643_0012096 3300046522 Bacteria 5217
228 Ga0495643_0026792 3300046522 Bacteria 3247
229 Ga0495643_0045561 3300046522 Bacteria 2380
230 Ga0495643_0061970 3300046522 Bacteria 1981
231 Ga0495643_0132234 3300046522 Bacteria 1251
232 Ga0495644_0001890 3300046523 Bacteria 8432
233 Ga0495644_0006177 3300046523 Bacteria 4658
234 Ga0495644_0008803 3300046523 Bacteria 3882
235 Ga0495644_0027165 3300046523 Bacteria 2169
236 Ga0495644_0030838 3300046523 Bacteria 2024
237 Ga0495644_0063176 3300046523 Bacteria 1391
238 Ga0495644_0074328 3300046523 Bacteria 1278
239 Ga0495648_0000091 3300046524 Bacteria 113822
240 Ga0495648_0003989 3300046524 Bacteria 12773
241 Ga0495648_0007968 3300046524 Bacteria 8402
242 Ga0495648_0022010 3300046524 Bacteria 4399
243 Ga0495648_0027563 3300046524 Bacteria 3800
244 Ga0495648_0029503 3300046524 Bacteria 3640
245 Ga0495663_0032408 3300046525 Bacteria 1556
246 Ga0495666_0000042 3300046526 Bacteria 47032
247 Ga0495666_0023676 3300046526 Bacteria 3036
248 Ga0495642_0000236 3300046528 Bacteria 31451
249 Ga0495642_0000447 3300046528 Bacteria 21771
250 Ga0495642_0016309 3300046528 Bacteria 2894
251 Ga0495642_0021540 3300046528 Bacteria 2535
252 Ga0495642_0024463 3300046528 Bacteria 2389
253 Ga0495642_0029994 3300046528 Bacteria 2174
254 Ga0495642_0036807 3300046528 Bacteria 1978
255 Ga0495642_0054796 3300046528 Bacteria 1644
256 Ga0495642_0062337 3300046528 Bacteria 1548
257 Ga0495642_0064149 3300046528 Bacteria 1528
258 Ga0495642_0115828 3300046528 Bacteria 1148
259 Ga0495654_0038674 3300046530 Bacteria 2384
260 Ga0495665_0002193 3300046531 Bacteria 10569
261 Ga0495665_0057068 3300046531 Bacteria 2060
262 Ga0495640_0025928 3300046533 Bacteria 4245
263 Ga0495587_0009835 3300046536 Bacteria 6108
264 Ga0495609_0000022 3300046538 Bacteria 279488
265 Ga0495609_0003209 3300046538 Bacteria 9493
266 Ga0495609_0004129 3300046538 Bacteria 8071
267 Ga0495609_0013733 3300046538 Bacteria 3819
268 Ga0495609_0016051 3300046538 Bacteria 3494
269 Ga0495609_0027059 3300046538 Bacteria 2622
270 Ga0495597_0000259 3300046542 Bacteria 48309
271 Ga0495597_0000355 3300046542 Bacteria 40841
272 Ga0495597_0000612 3300046542 Bacteria 29260
273 Ga0495597_0001465 3300046542 Bacteria 16925
274 Ga0495597_0001482 3300046542 Bacteria 16793
275 Ga0495597_0002595 3300046542 Bacteria 11287
276 Ga0495597_0006284 3300046542 Bacteria 6155
277 Ga0495597_0045894 3300046542 Bacteria 1937
278 Ga0495597_0055973 3300046542 Bacteria 1728
279 Ga0495597_0085313 3300046542 Bacteria 1345
280 Ga0495597_0118164 3300046542 Bacteria 1107
281 Ga0495622_0026492 3300046557 Bacteria 2706
282 Ga0495622_0030188 3300046557 Bacteria 2533
283 Ga0495622_0062762 3300046557 Bacteria 1719
284 Ga0495633_0000110 3300046558 Bacteria 110302
285 Ga0495633_0001935 3300046558 Bacteria 15068
286 Ga0495633_0003386 3300046558 Bacteria 10666
287 Ga0495633_0003688 3300046558 Bacteria 10108
288 Ga0495633_0008292 3300046558 Bacteria 5873
289 Ga0495633_0009032 3300046558 Bacteria 5545
290 Ga0495633_0009759 3300046558 Bacteria 5275
291 Ga0495633_0016703 3300046558 Bacteria 3776
292 Ga0495633_0021668 3300046558 Bacteria 3211
293 Ga0495633_0087399 3300046558 Bacteria 1449
294 Ga0495656_0002331 3300046615 Bacteria 6280
295 Ga0495656_0002998 3300046615 Bacteria 5672
296 Ga0495656_0047980 3300046615 Bacteria 1813
297 Ga0495668_0000131 3300046616 Bacteria 112755
298 Ga0495668_0002112 3300046616 Bacteria 17165
299 Ga0495668_0004173 3300046616 Bacteria 10424
300 Ga0495668_0009705 3300046616 Bacteria 5881
301 Ga0495668_0010381 3300046616 Bacteria 5636
302 Ga0495668_0011778 3300046616 Bacteria 5214
303 Ga0495668_0031756 3300046616 Bacteria 2975
304 Ga0495668_0048338 3300046616 Bacteria 2360
305 Ga0495668_0099485 3300046616 Bacteria 1591
306 Ga0495668_0137707 3300046616 Bacteria 1336
307 Ga0495634_0133718 3300046642 Bacteria 1579
308 Ga0495611_0011253 3300046648 Bacteria 3793
309 Ga0495611_0011530 3300046648 Bacteria 3748
310 Ga0495611_0015294 3300046648 Bacteria 3279
311 Ga0495611_0106251 3300046648 Bacteria 1305
312 Ga0495611_0112489 3300046648 Bacteria 1268
313 Ga0495625_0001138 3300046660 Bacteria 34313
314 Ga0495625_0040746 3300046660 Bacteria 3384
315 Ga0495625_0080692 3300046660 Bacteria 2265
316 Ga0495635_0004285 3300046663 Bacteria 9876
317 Ga0495659_0032477 3300046664 Bacteria 1827
318 Ga0495659_0087825 3300046664 Bacteria 1190
319 Ga0495661_0000502 3300046665 Bacteria 40792
320 Ga0495661_0000588 3300046665 Bacteria 37543
321 Ga0495661_0000845 3300046665 Bacteria 28543
322 Ga0495661_0002733 3300046665 Bacteria 13429
323 Ga0495661_0003393 3300046665 Bacteria 11786
324 Ga0495661_0007006 3300046665 Bacteria 7884
325 Ga0495661_0007521 3300046665 Bacteria 7594
326 Ga0495661_0022296 3300046665 Bacteria 4120
327 Ga0495661_0035378 3300046665 Bacteria 3134
328 Ga0495661_0043354 3300046665 Bacteria 2766
329 Ga0495661_0062491 3300046665 Bacteria 2205
330 Ga0495661_0062965 3300046665 Bacteria 2195
331 Ga0495588_0000148 3300046674 Bacteria 100600
332 Ga0495588_0003156 3300046674 Bacteria 7137
333 Ga0495588_0006101 3300046674 Bacteria 5410
334 Ga0495588_0013341 3300046674 Bacteria 3913
335 Ga0495588_0014951 3300046674 Bacteria 3725
336 Ga0495588_0016232 3300046674 Bacteria 3597
337 Ga0495588_0124982 3300046674 Bacteria 1356
338 Ga0495623_0013200 3300046679 Bacteria 5355
339 Ga0495623_0194018 3300046679 Bacteria 1171
340 Ga0495669_0000190 3300046684 Bacteria 38101
341 Ga0495669_0001521 3300046684 Bacteria 9560
342 Ga0495669_0001970 3300046684 Bacteria 8432
343 Ga0495669_0002428 3300046684 Bacteria 7620
344 Ga0495669_0004036 3300046684 Bacteria 6038
345 Ga0495670_0006400 3300046691 Bacteria 5785
346 Ga0495670_0054116 3300046691 Bacteria 2010
347 Ga0495671_0003528 3300046692 Bacteria 9568
348 Ga0495671_0006391 3300046692 Bacteria 6810
349 Ga0495671_0009410 3300046692 Bacteria 5456
350 Ga0495671_0035172 3300046692 Bacteria 2545
351 Ga0495649_0000570 3300046694 Bacteria 31172
352 Ga0495649_0001119 3300046694 Bacteria 20870
353 Ga0495649_0012062 3300046694 Bacteria 5042
354 Ga0495649_0036495 3300046694 Bacteria 2700
355 Ga0495649_0050997 3300046694 Bacteria 2244
356 Ga0495649_0116895 3300046694 Bacteria 1411
357 Ga0495589_0000372 3300046794 Bacteria 34449
358 Ga0495589_0000607 3300046794 Bacteria 24164
359 Ga0495589_0001022 3300046794 Bacteria 16928
360 Ga0495589_0006415 3300046794 Bacteria 6210
361 Ga0495589_0006872 3300046794 Bacteria 5982
362 Ga0495589_0010241 3300046794 Bacteria 4873
363 Ga0495589_0022055 3300046794 Bacteria 3252
364 Ga0495589_0033301 3300046794 Bacteria 2589
365 Ga0495600_0009115 3300046809 Bacteria 6119
366 Ga0495660_0000279 3300046810 Bacteria 47712
367 Ga0495660_0001188 3300046810 Bacteria 18326
368 Ga0495660_0003864 3300046810 Bacteria 9156
369 Ga0495660_0009516 3300046810 Bacteria 5664
370 Ga0495660_0017974 3300046810 Bacteria 4068
371 Ga0495660_0065212 3300046810 Bacteria 1944
372 Ga0495660_0080321 3300046810 Bacteria 1711
373 Ga0495660_0106598 3300046810 Bacteria 1435
374 Ga0495581_0004051 3300047315 Bacteria 8438
375 Ga0495581_0128819 3300047315 Bacteria 1474
376 Ga0495604_0016876 3300047317 Bacteria 5837
377 Ga0495604_0023133 3300047317 Bacteria 4959
378 Ga0495604_0023814 3300047317 Bacteria 4885
379 Ga0495604_0072415 3300047317 Bacteria 2604
380 Ga0495636_0005214 3300047318 Bacteria 5097
381 Ga0495674_0002462 3300047319 Bacteria 18093
382 Ga0495672_0000111 3300047320 Bacteria 130829
383 Ga0495672_0001227 3300047320 Bacteria 25827
384 Ga0495672_0001633 3300047320 Bacteria 21818
385 Ga0495672_0002075 3300047320 Bacteria 18813
386 Ga0495672_0003087 3300047320 Bacteria 14570
387 Ga0495672_0008770 3300047320 Bacteria 7409
388 Ga0495672_0074392 3300047320 Bacteria 1913
389 Ga0495676_0000177 3300047321 Bacteria 50096
390 Ga0495676_0024911 3300047321 Bacteria 5171
391 Ga0495676_0081425 3300047321 Bacteria 2454
392 Ga0495680_0028927 3300047322 Bacteria 4541
393 Ga0495683_0000069 3300047323 Bacteria 110339
394 Ga0495683_0000443 3300047323 Bacteria 32710
395 Ga0495683_0003214 3300047323 Bacteria 9545
396 Ga0495683_0006989 3300047323 Bacteria 6129
397 Ga0495683_0027465 3300047323 Bacteria 2910
398 Ga0495683_0031356 3300047323 Bacteria 2709
399 Ga0495687_000113 3300047443 Bacteria 123712
400 Ga0495687_000140 3300047443 Bacteria 109311
401 Ga0495687_000175 3300047443 Bacteria 94911
402 Ga0495687_000812 3300047443 Bacteria 33554
403 Ga0495687_001203 3300047443 Bacteria 24777
404 Ga0495687_026903 3300047443 Bacteria 2699
405 Ga0495687_099188 3300047443 Bacteria 1097
406 Ga0495675_0016072 3300047444 Bacteria 4732
407 Ga0495675_0048121 3300047444 Bacteria 2712
408 Ga0495677_0000002 3300047445 Bacteria 346767
409 Ga0495677_0000582 3300047445 Bacteria 14997
410 Ga0495677_0002320 3300047445 Bacteria 7490
411 Ga0495677_0003787 3300047445 Bacteria 5848
412 Ga0495677_0005023 3300047445 Bacteria 5045
413 Ga0495677_0005815 3300047445 Bacteria 4666
414 Ga0495677_0011779 3300047445 Bacteria 3195
415 Ga0495677_0034106 3300047445 Bacteria 1856
416 Ga0495679_004942 3300047446 Bacteria 6012
417 Ga0495679_008640 3300047446 Bacteria 4125
418 Ga0495679_010803 3300047446 Bacteria 3562
419 Ga0495685_017048 3300047447 Bacteria 2485
420 Ga0495685_020394 3300047447 Bacteria 2277
421 Ga0495673_0015238 3300047469 Bacteria 3966
422 Ga0495681_0000176 3300047470 Bacteria 53867
423 Ga0495681_0000223 3300047470 Bacteria 47318
424 Ga0495681_0005915 3300047470 Bacteria 8113
425 Ga0495681_0006254 3300047470 Bacteria 7847
426 Ga0495681_0017809 3300047470 Bacteria 3933
427 Ga0495681_0019446 3300047470 Bacteria 3708
428 Ga0495681_0025005 3300047470 Bacteria 3131
429 Ga0495681_0052468 3300047470 Bacteria 1913
430 Ga0495681_0069106 3300047470 Bacteria 1605
431 Ga0495686_0001927 3300047472 Bacteria 20680
432 Ga0495686_0002104 3300047472 Bacteria 19507
433 Ga0495686_0006186 3300047472 Bacteria 9247
434 Ga0495593_0002900 3300047673 Bacteria 10333
435 Ga0495602_0011403 3300048088 Bacteria 9192
436 Ga0495614_0004219 3300048089 Bacteria 6473
437 Ga0495626_0000076 3300048091 Bacteria 131125
438 Ga0495626_0000712 3300048091 Bacteria 31224
439 Ga0495626_0000990 3300048091 Bacteria 24434
440 Ga0495626_0002169 3300048091 Bacteria 14132
441 Ga0495626_0003813 3300048091 Bacteria 9462
442 Ga0495626_0006213 3300048091 Bacteria 6823
443 Ga0495626_0016555 3300048091 Bacteria 3742
444 Ga0495626_0018616 3300048091 Bacteria 3483
445 Ga0495626_0019483 3300048091 Bacteria 3395
446 Ga0495626_0026598 3300048091 Bacteria 2817
447 Ga0495626_0040246 3300048091 Bacteria 2208
448 Ga0495626_0061749 3300048091 Bacteria 1703
449 Ga0496100_0013237 3300048903 Bacteria 4750
450 Ga0496100_0075059 3300048903 Bacteria 2267
451 Ga0496101_0050884 3300048904 Bacteria 2983
452 Ga0496102_0004631 3300048905 Bacteria 11638
453 Ga0496102_0134353 3300048905 Bacteria 2317
454 Ga0496103_0016677 3300048906 Bacteria 4386
455 Ga0496106_0039136 3300048909 Bacteria 3551
456 Ga0496106_0069902 3300048909 Bacteria 2681
457 Ga0496108_0107095 3300048911 Bacteria 2387
458 Ga0496108_0221386 3300048911 Bacteria 1644
459 Ga0496108_0626507 3300048911 Bacteria 936
460 Ga0496110_0000243 3300048913 Bacteria 35431
461 Ga0496112_0151904 3300048915 Bacteria 2283
462 Ga0496112_0373531 3300048915 Bacteria 1367
463 Ga0496113_0016984 3300048916 Bacteria 5040
464 Ga0496113_0021117 3300048916 Bacteria 4590
465 Ga0496115_0013880 3300048918 Bacteria 6098
466 Ga0496115_0016753 3300048918 Bacteria 5585
467 Ga0496115_0085950 3300048918 Bacteria 2566
468 Ga0496115_0126503 3300048918 Bacteria 2105
469 Ga0496122_0000653 3300048925 Bacteria 70150
470 Ga0496122_0005404 3300048925 Bacteria 15246
471 Ga0496122_0010513 3300048925 Bacteria 9518
472 Ga0496122_0076349 3300048925 Bacteria 2358
473 Ga0496123_0000196 3300048926 Bacteria 122955
474 Ga0496123_0001616 3300048926 Bacteria 30439
475 Ga0496123_0011232 3300048926 Bacteria 7790
476 Ga0496123_0082635 3300048926 Bacteria 1946
477 Ga0496124_0003749 3300048927 Bacteria 18310
478 Ga0496124_0016394 3300048927 Bacteria 7047
479 Ga0496124_0091042 3300048927 Bacteria 2486
480 Ga0496125_0003203 3300048928 Bacteria 20205
481 Ga0495678_000250 3300049459 Bacteria 60174
482 Ga0495678_000518 3300049459 Bacteria 37613
483 Ga0495678_000681 3300049459 Bacteria 31236
484 Ga0495678_003559 3300049459 Bacteria 9546
485 Ga0495678_008117 3300049459 Bacteria 5343
486 Ga0495678_009420 3300049459 Bacteria 4834
487 Ga0495678_016458 3300049459 Bacteria 3380
488 Ga0495682_0000301 3300049460 Bacteria 37472
489 Ga0501035_0004164 3300049822 Bacteria 13745
490 Ga0500618_000201 3300053125 Bacteria 47558
491 Ga0500586_000027 3300053145 Bacteria 26027
492 2643801085 2643221556 Bacteria 7251154
493 2644472829 2643221684 Bacteria 7145183
494 2809142297 2808606418 Bacteria 6724496
495 2842715075 2842711865 Bacteria 7155354
496 8047675174 8047673197 Bacteria 7395230
497 Ga0495626_0066451
498 rootH1_10000529
499 rootL2_10043948
500 rootL2_10074424
501 Ga0055525_1000074
502 Ga0070658_10219386
503 Ga0070680_100045826
504 Ga0070660_100032085
505 Ga0070659_100232607
506 Ga0068855_100026683
507 Ga0068855_100266241
508 Ga0068852_100090925
509 Ga0068865_100147961
510 Ga0105244_10004718
511 Ga0105243_10014738
512 Ga0105241_10132600
513 Ga0105246_10082850
514 Ga0209563_100003
515 Ga0209677_105927
516 Ga0209148_1000832
517 Ga0207655_1015867
518 Ga0207705_10024094
519 Ga0207654_10100572
520 Ga0207660_10033525
521 Ga0207657_10021724
522 Ga0207687_10042659
523 Ga0207706_10038088
524 Ga0207706_10065008
525 Ga0207704_10013928
526 Ga0207679_10192591
527 Ga0207667_10028276
528 Ga0207667_10235180
529 Ga0316182_1334187
530 Ga0307509_10000033
531 Ga0316582_0082524
532 Ga0395899_0006504
533 Ga0395899_0013262
534 Ga0395899_0026536
535 Ga0395899_0056268
536 Ga0395899_0091752
537 Ga0395899_0191656
538 Ga0395900_0000640
539 Ga0395900_0001977
540 Ga0395900_0020062
541 Ga0395900_0032174
542 Ga0395900_0052333
543 Ga0395900_0083002
544 Ga0395900_0107686
545 Ga0395900_0119545
546 Ga0395900_0179643
547 Ga0395900_0216679
548 Ga0395900_0348129
549 Ga0395898_0077525
550 Ga0395898_0183647
551 Ga0395898_0232686
552 Ga0395898_0364925
553 Ga0395905_0155553
554 Ga0395905_0438252
555 Ga0395901_0000074
556 Ga0395901_0006503
557 Ga0395901_0035945
558 Ga0395901_0268238
559 Ga0395901_0314048
560 Ga0395901_0352226
561 Ga0439448_0000941
562 Ga0439455_0000453
563 Ga0439455_0018631
564 Ga0439455_0021211
565 Ga0450904_000235
566 Ga0466969_0103870
567 Ga0466969_0126813
568 Ga0466972_0005526
569 Ga0466972_0138136
570 Ga0466965_0013471
571 Ga0466965_0017593
572 Ga0466965_0082376
573 Ga0466966_0009460
574 Ga0466966_0010336
575 Ga0466966_0011361
576 Ga0466966_0021995
577 Ga0466966_0089057
578 Ga0466966_0089417
579 Ga0466961_0097541
580 Ga0466963_0081947
581 Ga0466964_0000520
582 Ga0466964_0001850
583 Ga0466968_0001796
584 Ga0466957_0000269
585 Ga0466957_0079338
586 Ga0466959_0004250
587 Ga0466959_0169728
588 Ga0466958_0209543
589 Ga0466958_0229467
590 Ga0466967_0012416
591 Ga0466967_0027658
592 Ga0495617_000169
593 Ga0495627_002042
594 Ga0495627_042527
595 Ga0495603_0037693
596 Ga0495603_0085913
597 Ga0495590_0000041
598 Ga0495590_0007150
599 Ga0495591_000213
600 Ga0495629_0004116
601 Ga0495629_0012571
602 Ga0495629_0034581
603 Ga0495638_0002032
604 Ga0495638_0008959
605 Ga0495638_0048744
606 Ga0495653_0008152
607 Ga0495653_0079119
608 Ga0495650_0000048
609 Ga0495650_0000274
610 Ga0495650_0000292
611 Ga0495650_0005922
612 Ga0495650_0038031
613 Ga0495582_0006182
614 Ga0495582_0007319
615 Ga0495582_0131072
616 Ga0495605_0000437
617 Ga0495605_0004510
618 Ga0495605_0008233
619 Ga0495605_0009915
620 Ga0495605_0020683
621 Ga0495605_0024515
622 Ga0495605_0044598
623 Ga0495639_0089196
624 Ga0495584_0000007
625 Ga0495584_0001275
626 Ga0495584_0001307
627 Ga0495584_0001980
628 Ga0495584_0002264
629 Ga0495584_0002519
630 Ga0495584_0003799
631 Ga0495584_0004883
632 Ga0495585_0000090
633 Ga0495585_0000518
634 Ga0495585_0001876
635 Ga0495585_0002276
636 Ga0495585_0003841
637 Ga0495585_0011278
638 Ga0495585_0027178
639 Ga0495585_0037366
640 Ga0495585_0042194
641 Ga0495585_0048148
642 Ga0495585_0057965
643 Ga0495585_0093394
644 Ga0495585_0094133
645 Ga0495585_0095498
646 Ga0495594_0004656
647 Ga0495594_0014230
648 Ga0495594_0023689
649 Ga0495594_0025991
650 Ga0495594_0076876
651 Ga0495596_0000358
652 Ga0495596_0001356
653 Ga0495596_0002301
654 Ga0495596_0002413
655 Ga0495596_0003641
656 Ga0495596_0005536
657 Ga0495596_0008039
658 Ga0495596_0010546
659 Ga0495596_0013941
660 Ga0495596_0017029
661 Ga0495596_0031731
662 Ga0495607_0000192
663 Ga0495607_0000842
664 Ga0495607_0004098
665 Ga0495607_0022500
666 Ga0495607_0032820
667 Ga0495607_0036909
668 Ga0495607_0039388
669 Ga0495607_0041660
670 Ga0495607_0048562
671 Ga0495607_0069052
672 Ga0495607_0069722
673 Ga0495583_0000075
674 Ga0495583_0000904
675 Ga0495583_0001226
676 Ga0495583_0003804
677 Ga0495583_0005304
678 Ga0495583_0005483
679 Ga0495583_0006108
680 Ga0495583_0035005
681 Ga0495583_0059352
682 Ga0495583_0100020
683 Ga0495606_0001578
684 Ga0495606_0003940
685 Ga0495606_0014953
686 Ga0495606_0024377
687 Ga0495606_0033693
688 Ga0495606_0035906
689 Ga0495606_0198939
690 Ga0495610_0000038
691 Ga0495610_0002531
692 Ga0495610_0022076
693 Ga0495616_0000280
694 Ga0495616_0006521
695 Ga0495616_0008101
696 Ga0495616_0009320
697 Ga0495616_0015278
698 Ga0495616_0015921
699 Ga0495616_0024205
700 Ga0495616_0024320
701 Ga0495616_0025061
702 Ga0495616_0033830
703 Ga0495616_0043555
704 Ga0495616_0050908
705 Ga0495616_0079409
706 Ga0495631_0001139
707 Ga0495631_0001371
708 Ga0495631_0006767
709 Ga0495631_0010968
710 Ga0495631_0016200
711 Ga0495631_0020900
712 Ga0495631_0065525
713 Ga0495632_0000098
714 Ga0495632_0000153
715 Ga0495632_0001553
716 Ga0495632_0004558
717 Ga0495632_0005186
718 Ga0495632_0009268
719 Ga0495632_0009270
720 Ga0495637_0000845
721 Ga0495637_0019910
722 Ga0495643_0000115
723 Ga0495643_0012096
724 Ga0495643_0026792
725 Ga0495643_0045561
726 Ga0495643_0061970
727 Ga0495643_0132234
728 Ga0495644_0001890
729 Ga0495644_0006177
730 Ga0495644_0008803
731 Ga0495644_0027165
732 Ga0495644_0030838
733 Ga0495644_0063176
734 Ga0495644_0074328
735 Ga0495648_0000091
736 Ga0495648_0003989
737 Ga0495648_0007968
738 Ga0495648_0022010
739 Ga0495648_0027563
740 Ga0495648_0029503
741 Ga0495663_0032408
742 Ga0495666_0000042
743 Ga0495666_0023676
744 Ga0495642_0000236
745 Ga0495642_0000447
746 Ga0495642_0016309
747 Ga0495642_0021540
748 Ga0495642_0024463
749 Ga0495642_0029994
750 Ga0495642_0036807
751 Ga0495642_0054796
752 Ga0495642_0062337
753 Ga0495642_0064149
754 Ga0495642_0115828
755 Ga0495654_0038674
756 Ga0495665_0002193
757 Ga0495665_0057068
758 Ga0495640_0025928
759 Ga0495587_0009835
760 Ga0495609_0000022
761 Ga0495609_0003209
762 Ga0495609_0004129
763 Ga0495609_0013733
764 Ga0495609_0016051
765 Ga0495609_0027059
766 Ga0495597_0000259
767 Ga0495597_0000355
768 Ga0495597_0000612
769 Ga0495597_0001465
770 Ga0495597_0001482
771 Ga0495597_0002595
772 Ga0495597_0006284
773 Ga0495597_0045894
774 Ga0495597_0055973
775 Ga0495597_0085313
776 Ga0495597_0118164
777 Ga0495622_0026492
778 Ga0495622_0030188
779 Ga0495622_0062762
780 Ga0495633_0000110
781 Ga0495633_0001935
782 Ga0495633_0003386
783 Ga0495633_0003688
784 Ga0495633_0008292
785 Ga0495633_0009032
786 Ga0495633_0009759
787 Ga0495633_0016703
788 Ga0495633_0021668
789 Ga0495633_0087399
790 Ga0495656_0002331
791 Ga0495656_0002998
792 Ga0495656_0047980
793 Ga0495668_0000131
794 Ga0495668_0002112
795 Ga0495668_0004173
796 Ga0495668_0009705
797 Ga0495668_0010381
798 Ga0495668_0011778
799 Ga0495668_0031756
800 Ga0495668_0048338
801 Ga0495668_0099485
802 Ga0495668_0137707
803 Ga0495634_0133718
804 Ga0495611_0011253
805 Ga0495611_0011530
806 Ga0495611_0015294
807 Ga0495611_0106251
808 Ga0495611_0112489
809 Ga0495625_0001138
810 Ga0495625_0040746
811 Ga0495625_0080692
812 Ga0495635_0004285
813 Ga0495659_0032477
814 Ga0495659_0087825
815 Ga0495661_0000502
816 Ga0495661_0000588
817 Ga0495661_0000845
818 Ga0495661_0002733
819 Ga0495661_0003393
820 Ga0495661_0007006
821 Ga0495661_0007521
822 Ga0495661_0022296
823 Ga0495661_0035378
824 Ga0495661_0043354
825 Ga0495661_0062491
826 Ga0495661_0062965
827 Ga0495588_0000148
828 Ga0495588_0003156
829 Ga0495588_0006101
830 Ga0495588_0013341
831 Ga0495588_0014951
832 Ga0495588_0016232
833 Ga0495588_0124982
834 Ga0495623_0013200
835 Ga0495623_0194018
836 Ga0495669_0000190
837 Ga0495669_0001521
838 Ga0495669_0001970
839 Ga0495669_0002428
840 Ga0495669_0004036
841 Ga0495670_0006400
842 Ga0495670_0054116
843 Ga0495671_0003528
844 Ga0495671_0006391
845 Ga0495671_0009410
846 Ga0495671_0035172
847 Ga0495649_0000570
848 Ga0495649_0001119
849 Ga0495649_0012062
850 Ga0495649_0036495
851 Ga0495649_0050997
852 Ga0495649_0116895
853 Ga0495589_0000372
854 Ga0495589_0000607
855 Ga0495589_0001022
856 Ga0495589_0006415
857 Ga0495589_0006872
858 Ga0495589_0010241
859 Ga0495589_0022055
860 Ga0495589_0033301
861 Ga0495600_0009115
862 Ga0495660_0000279
863 Ga0495660_0001188
864 Ga0495660_0003864
865 Ga0495660_0009516
866 Ga0495660_0017974
867 Ga0495660_0065212
868 Ga0495660_0080321
869 Ga0495660_0106598
870 Ga0495581_0004051
871 Ga0495581_0128819
872 Ga0495604_0016876
873 Ga0495604_0023133
874 Ga0495604_0023814
875 Ga0495604_0072415
876 Ga0495636_0005214
877 Ga0495674_0002462
878 Ga0495672_0000111
879 Ga0495672_0001227
880 Ga0495672_0001633
881 Ga0495672_0002075
882 Ga0495672_0003087
883 Ga0495672_0008770
884 Ga0495672_0074392
885 Ga0495676_0000177
886 Ga0495676_0024911
887 Ga0495676_0081425
888 Ga0495680_0028927
889 Ga0495683_0000069
890 Ga0495683_0000443
891 Ga0495683_0003214
892 Ga0495683_0006989
893 Ga0495683_0027465
894 Ga0495683_0031356
895 Ga0495687_000113
896 Ga0495687_000140
897 Ga0495687_000175
898 Ga0495687_000812
899 Ga0495687_001203
900 Ga0495687_026903
901 Ga0495687_099188
902 Ga0495675_0016072
903 Ga0495675_0048121
904 Ga0495677_0000002
905 Ga0495677_0000582
906 Ga0495677_0002320
907 Ga0495677_0003787
908 Ga0495677_0005023
909 Ga0495677_0005815
910 Ga0495677_0011779
911 Ga0495677_0034106
912 Ga0495679_004942
913 Ga0495679_008640
914 Ga0495679_010803
915 Ga0495685_017048
916 Ga0495685_020394
917 Ga0495673_0015238
918 Ga0495681_0000176
919 Ga0495681_0000223
920 Ga0495681_0005915
921 Ga0495681_0006254
922 Ga0495681_0017809
923 Ga0495681_0019446
924 Ga0495681_0025005
925 Ga0495681_0052468
926 Ga0495681_0069106
927 Ga0495686_0001927
928 Ga0495686_0002104
929 Ga0495686_0006186
930 Ga0495593_0002900
931 Ga0495602_0011403
932 Ga0495614_0004219
933 Ga0495626_0000076
934 Ga0495626_0000712
935 Ga0495626_0000990
936 Ga0495626_0002169
937 Ga0495626_0003813
938 Ga0495626_0006213
939 Ga0495626_0016555
940 Ga0495626_0018616
941 Ga0495626_0019483
942 Ga0495626_0026598
943 Ga0495626_0040246
944 Ga0495626_0061749
945 Ga0496100_0013237
946 Ga0496100_0075059
947 Ga0496101_0050884
948 Ga0496102_0004631
949 Ga0496102_0134353
950 Ga0496103_0016677
951 Ga0496106_0039136
952 Ga0496106_0069902
953 Ga0496108_0107095
954 Ga0496108_0221386
955 Ga0496108_0626507
956 Ga0496110_0000243
957 Ga0496112_0151904
958 Ga0496112_0373531
959 Ga0496113_0016984
960 Ga0496113_0021117
961 Ga0496115_0013880
962 Ga0496115_0016753
963 Ga0496115_0085950
964 Ga0496115_0126503
965 Ga0496122_0000653
966 Ga0496122_0005404
967 Ga0496122_0010513
968 Ga0496122_0076349
969 Ga0496123_0000196
970 Ga0496123_0001616
971 Ga0496123_0011232
972 Ga0496123_0082635
973 Ga0496124_0003749
974 Ga0496124_0016394
975 Ga0496124_0091042
976 Ga0496125_0003203
977 Ga0495678_000250
978 Ga0495678_000518
979 Ga0495678_000681
980 Ga0495678_003559
981 Ga0495678_008117
982 Ga0495678_009420
983 Ga0495678_016458
984 Ga0495682_0000301
985 Ga0501035_0004164
986 Ga0500618_000201
987 Ga0500586_000027
988 2643801085
989 2644472829
990 2809142297
991 2842715075
992 8047675174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01882

DUF58

Protein of unknown function DUF58

223

306

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cml-assembly1.cif.gz_B cryo-em structure of complement c5 in complex with nanobodies unbc5-1 and unbc5-2 0.6459 59 163
7ad7-assembly1.cif.gz_A crystal structure of human complement c5 in complex with the k8 bovine knob domain peptide. 0.6337 59 163
8cem-assembly1.cif.gz_A structure of bovine native c3, re-refinement 0.6186 59 153
7akk-assembly1.cif.gz_E structure of a complement factor-receptor complex 0.616 59 158
6ru5-assembly1.cif.gz_B human complement c3 in complex with the hc3nb1 nanobody 0.6093 59 161
ID Description Score Start End Superfamily
af_P75856_152_231_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7096 54 150 2.60.40.10
af_Q4DE16_989_1083_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6983 70 135 2.60.40.10
af_Q95QQ2_289_401_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6949 59 158 2.60.40.10
af_P75856_152_231_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6879 54 150 2.60.40.10
af_A0A0R0JG07_317_442_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6871 56 165 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A162TW02-F1-model_v4 deleted 0.9001 4 165
AF-A0A359ELU0-F1-model_v4 deleted 0.8946 3 155
AF-A0A2W5HKR3-F1-model_v4 deleted 0.8938 3 170
AF-A0A7W9DH46-F1-model_v4 Uncharacterized protein (DUF58 family) 0.8839 3 147 GO:0016020
AF-A0A3D3PRR5-F1-model_v4 DUF58 domain-containing protein 0.8837 3 172 GO:0016020

Map