F454948

General Info

Members Datasets Scaffolds Average Seq Length
496 266 992 157

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0148446|Ga0496111_0148446_1060_1533
Length 157
Sequence MSETIPREQSRADATAVRRLAYSDLPGVISIERRSFPAPWSLAMFVLELSKPSGICLAATSGDELLGYLVCSRYDQVWHLMNVAVSPDRRRRGVASGLIRHLLEETGRGGELPITLEVRVSNREAIAMYEGLGFRSAGVRPRYYQDNGEDALIMWLD

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
158 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
264 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 12.7
Rhizosphere 82.06
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0148446 3300048914 Bacteria 1739
2 CNAas_1006915 3300000532 Bacteria 733
3 JGI24746J21847_1000048 3300001977 Bacteria 11824
4 JGI24034J26672_10010515 3300002239 Bacteria 1376
5 JGI24742J22300_10019848 3300002244 Bacteria 1143
6 JGI25406J46586_10046762 3300003203 Bacteria 1479
7 Ga0070683_100019627 3300005329 Bacteria 6005
8 Ga0070683_100053231 3300005329 Bacteria 3751
9 Ga0070683_100106093 3300005329 Bacteria 2648
10 Ga0070690_100118147 3300005330 Bacteria 1777
11 Ga0070677_10000037 3300005333 Bacteria 40212
12 Ga0070666_10069888 3300005335 Bacteria 2388
13 Ga0070682_100000011 3300005337 Bacteria 266253
14 Ga0070682_100000030 3300005337 Bacteria 182768
15 Ga0068868_100002102 3300005338 Bacteria 13721
16 Ga0070691_10000908 3300005341 Bacteria 12026
17 Ga0070661_100000608 3300005344 Bacteria 26695
18 Ga0070669_100451069 3300005353 Bacteria 1060
19 Ga0070674_100000002 3300005356 Bacteria 271088
20 Ga0070674_100000007 3300005356 Bacteria 145531
21 Ga0070688_100000412 3300005365 Bacteria 21692
22 Ga0070688_100022008 3300005365 Bacteria 3730
23 Ga0070688_100303465 3300005365 Bacteria 1155
24 Ga0070688_100672970 3300005365 Bacteria 799
25 Ga0070659_100301183 3300005366 Bacteria 1337
26 Ga0070667_100001123 3300005367 Bacteria 24412
27 Ga0070714_100062407 3300005435 Bacteria 3203
28 Ga0070714_100819408 3300005435 Bacteria 902
29 Ga0070713_100096958 3300005436 Bacteria 2547
30 Ga0070711_100001735 3300005439 Bacteria 12093
31 Ga0070700_100094352 3300005441 Bacteria 1959
32 Ga0070678_100383579 3300005456 Bacteria 1216
33 Ga0070678_100794935 3300005456 Bacteria 859
34 Ga0070662_100000002 3300005457 Bacteria 253208
35 Ga0068867_100000204 3300005459 Bacteria 39518
36 Ga0070685_10000013 3300005466 Bacteria 120875
37 Ga0070685_10007592 3300005466 Bacteria 5547
38 Ga0070685_10085369 3300005466 Bacteria 1901
39 Ga0070679_100000181 3300005530 Bacteria 50834
40 Ga0070684_100012567 3300005535 Bacteria 6792
41 Ga0070684_100074570 3300005535 Bacteria 2991
42 Ga0070684_100083172 3300005535 Bacteria 2835
43 Ga0070684_100258796 3300005535 Bacteria 1592
44 Ga0068853_100025258 3300005539 Bacteria 4985
45 Ga0070672_100000083 3300005543 Bacteria 44812
46 Ga0070686_100339038 3300005544 Bacteria 1126
47 Ga0070693_100000987 3300005547 Bacteria 12667
48 Ga0070665_100000040 3300005548 Bacteria 305480
49 Ga0070665_100119714 3300005548 Bacteria 2635
50 Ga0070665_100348798 3300005548 Bacteria 1485
51 Ga0068855_100328389 3300005563 Bacteria 1689
52 Ga0068855_100456808 3300005563 Bacteria 1393
53 Ga0068857_100274783 3300005577 Bacteria 1549
54 Ga0068854_100000363 3300005578 Bacteria 29001
55 Ga0068854_100023409 3300005578 Bacteria 4219
56 Ga0068856_100000237 3300005614 Bacteria 59854
57 Ga0068856_100027399 3300005614 Bacteria 5559
58 Ga0068852_100000002 3300005616 Bacteria 268221
59 Ga0068852_100012193 3300005616 Bacteria 6514
60 Ga0068852_101055372 3300005616 Bacteria 832
61 Ga0068866_10000003 3300005718 Bacteria 281675
62 Ga0068866_10001295 3300005718 Bacteria 10823
63 Ga0068861_100246154 3300005719 Bacteria 1523
64 Ga0068861_100342948 3300005719 Bacteria 1308
65 Ga0068851_10004739 3300005834 Bacteria 6157
66 Ga0068863_100001530 3300005841 Bacteria 22860
67 Ga0068858_100000120 3300005842 Bacteria 81766
68 Ga0068858_100006738 3300005842 Bacteria 11178
69 Ga0068858_100083875 3300005842 Bacteria 2964
70 Ga0068860_100056918 3300005843 Bacteria 3716
71 Ga0068860_100057465 3300005843 Bacteria 3698
72 Ga0068860_100956121 3300005843 Bacteria 874
73 Ga0068862_100005726 3300005844 Bacteria 10368
74 Ga0081455_10041414 3300005937 Bacteria 4050
75 Ga0081538_10143624 3300005981 Bacteria 1095
76 Ga0081540_1000123 3300005983 Bacteria 81914
77 Ga0081540_1000639 3300005983 Bacteria 33299
78 Ga0081540_1071063 3300005983 Bacteria 1609
79 Ga0081540_1196929 3300005983 Bacteria 736
80 Ga0081539_10004533 3300005985 Bacteria 15247
81 Ga0081539_10136440 3300005985 Bacteria 1198
82 Ga0081539_10166595 3300005985 Bacteria 1045
83 Ga0070715_10000001 3300006163 Bacteria 693690
84 Ga0070715_10110490 3300006163 Bacteria 1296
85 Ga0070712_100004387 3300006175 Bacteria 8711
86 Ga0097621_100651940 3300006237 Bacteria 966
87 Ga0075433_10014316 3300006852 Bacteria 6479
88 Ga0068865_100000134 3300006881 Bacteria 38568
89 Ga0105240_10407549 3300009093 Bacteria 1530
90 Ga0105240_10617969 3300009093 Bacteria 1191
91 Ga0111539_10689128 3300009094 Bacteria 1189
92 Ga0105245_10000026 3300009098 Bacteria 163660
93 Ga0105245_10000143 3300009098 Bacteria 67618
94 Ga0105245_10002179 3300009098 Bacteria 17745
95 Ga0105245_10012210 3300009098 Bacteria 7471
96 Ga0105245_10303667 3300009098 Bacteria 1567
97 Ga0105247_10121750 3300009101 Bacteria 1691
98 Ga0105243_10027253 3300009148 Bacteria 4376
99 Ga0105243_10053227 3300009148 Bacteria 3210
100 Ga0105241_10069970 3300009174 Bacteria 2722
101 Ga0105242_10032261 3300009176 Bacteria 4188
102 Ga0105242_10105713 3300009176 Bacteria 2391
103 Ga0105248_10000020 3300009177 Bacteria 284637
104 Ga0105248_10117972 3300009177 Bacteria 2993
105 Ga0105238_10000009 3300009551 Bacteria 288729
106 Ga0105249_10000070 3300009553 Bacteria 147277
107 Ga0105249_10627246 3300009553 Unclassified 1131
108 Ga0105249_11054213 3300009553 Bacteria 882
109 Ga0105239_10476537 3300010375 Bacteria 1418
110 Ga0105239_11092735 3300010375 Bacteria 918
111 Ga0105246_11119237 3300011119 Bacteria 720
112 Ga0157369_10000014 3300013105 Bacteria 266411
113 Ga0157374_10013277 3300013296 Bacteria 7186
114 Ga0157374_11972016 3300013296 Bacteria 610
115 Ga0157378_10051353 3300013297 Bacteria 3669
116 Ga0157378_10093267 3300013297 Bacteria 2741
117 Ga0157378_11257173 3300013297 Bacteria 781
118 Ga0163162_10325302 3300013306 Bacteria 1670
119 Ga0157372_10000060 3300013307 Bacteria 122372
120 Ga0157375_10003070 3300013308 Bacteria 14493
121 Ga0157375_10004333 3300013308 Bacteria 12321
122 Ga0157375_11241477 3300013308 Bacteria 875
123 Ga0163163_10483151 3300014325 Bacteria 1300
124 Ga0163163_11158041 3300014325 Bacteria 836
125 Ga0157380_10023476 3300014326 Bacteria 4652
126 Ga0157379_10033468 3300014968 Bacteria 4583
127 Ga0157379_10058054 3300014968 Bacteria 3459
128 Ga0157379_10105847 3300014968 Bacteria 2525
129 Ga0163161_10021169 3300017792 Bacteria 4571
130 Ga0163161_11708957 3300017792 Bacteria 558
131 Ga0224712_10155727 3300022467 Bacteria 1016
132 Ga0207656_10021074 3300025321 Bacteria 2599
133 Ga0207656_10028797 3300025321 Bacteria 2283
134 Ga0207682_10000018 3300025893 Bacteria 66215
135 Ga0207642_10000002 3300025899 Bacteria 658166
136 Ga0207642_10000634 3300025899 Bacteria 10772
137 Ga0207710_10000997 3300025900 Bacteria 14813
138 Ga0207680_10000567 3300025903 Bacteria 17482
139 Ga0207685_10000005 3300025905 Bacteria 289944
140 Ga0207654_10106053 3300025911 Bacteria 1739
141 Ga0207695_10425791 3300025913 Bacteria 1211
142 Ga0207695_10518784 3300025913 Bacteria 1073
143 Ga0207693_10015036 3300025915 Bacteria 6213
144 Ga0207663_10042943 3300025916 Bacteria 2765
145 Ga0207663_10080051 3300025916 Bacteria 2135
146 Ga0207649_10000003 3300025920 Bacteria 388908
147 Ga0207652_10000371 3300025921 Bacteria 46723
148 Ga0207681_10772865 3300025923 Bacteria 801
149 Ga0207694_10000004 3300025924 Bacteria 967075
150 Ga0207650_10182994 3300025925 Bacteria 1671
151 Ga0207659_10000368 3300025926 Bacteria 27047
152 Ga0207687_10000017 3300025927 Bacteria 237310
153 Ga0207687_10000020 3300025927 Bacteria 228407
154 Ga0207687_10001467 3300025927 Bacteria 16198
155 Ga0207687_10010029 3300025927 Bacteria 6197
156 Ga0207664_10229876 3300025929 Bacteria 1612
157 Ga0207664_10995519 3300025929 Bacteria 751
158 Ga0207690_10240805 3300025932 Bacteria 1393
159 Ga0207706_10000001 3300025933 Bacteria 423014
160 Ga0207686_10181970 3300025934 Bacteria 1491
161 Ga0207709_10013906 3300025935 Bacteria 4443
162 Ga0207709_10161357 3300025935 Bacteria 1564
163 Ga0207670_10010569 3300025936 Bacteria 5325
164 Ga0207670_10036018 3300025936 Bacteria 3215
165 Ga0207669_10000001 3300025937 Bacteria 377747
166 Ga0207669_10000003 3300025937 Bacteria 252239
167 Ga0207704_10000110 3300025938 Bacteria 45277
168 Ga0207665_10063868 3300025939 Bacteria 2501
169 Ga0207691_10000641 3300025940 Bacteria 34560
170 Ga0207711_10000006 3300025941 Bacteria 792692
171 Ga0207661_10000867 3300025944 Bacteria 19843
172 Ga0207661_10011021 3300025944 Bacteria 6533
173 Ga0207661_10018898 3300025944 Bacteria 5129
174 Ga0207661_10033030 3300025944 Bacteria 4014
175 Ga0207661_11231173 3300025944 Bacteria 688
176 Ga0207679_10327214 3300025945 Bacteria 1329
177 Ga0207667_10456553 3300025949 Bacteria 1298
178 Ga0207651_10037230 3300025960 Bacteria 3185
179 Ga0207712_10000019 3300025961 Bacteria 317060
180 Ga0207712_10026616 3300025961 Bacteria 3855
181 Ga0207712_10395574 3300025961 Unclassified 1160
182 Ga0207640_10000110 3300025981 Bacteria 61907
183 Ga0207640_10005989 3300025981 Bacteria 6645
184 Ga0207658_10000724 3300025986 Bacteria 28537
185 Ga0207658_10182655 3300025986 Bacteria 1737
186 Ga0207677_10000362 3300026023 Bacteria 31866
187 Ga0207677_10004995 3300026023 Bacteria 7161
188 Ga0207703_10000018 3300026035 Bacteria 271377
189 Ga0207703_10000170 3300026035 Bacteria 75814
190 Ga0207703_10233624 3300026035 Bacteria 1650
191 Ga0207639_10007449 3300026041 Bacteria 7464
192 Ga0207639_10087562 3300026041 Bacteria 2483
193 Ga0207708_10127228 3300026075 Bacteria 1989
194 Ga0207708_10130501 3300026075 Bacteria 1964
195 Ga0207702_10000251 3300026078 Bacteria 62222
196 Ga0207702_10007011 3300026078 Bacteria 9640
197 Ga0207641_10000016 3300026088 Bacteria 307363
198 Ga0207648_10000643 3300026089 Bacteria 39180
199 Ga0207674_10280873 3300026116 Bacteria 1613
200 Ga0207675_100445021 3300026118 Bacteria 1283
201 Ga0207683_10031544 3300026121 Bacteria 4599
202 Ga0207683_10412863 3300026121 Bacteria 1243
203 Ga0207683_10432745 3300026121 Bacteria 1212
204 Ga0207683_11744216 3300026121 Bacteria 572
205 Ga0207698_10000004 3300026142 Bacteria 313614
206 Ga0207698_10006867 3300026142 Bacteria 7121
207 Ga0207428_10558653 3300027907 Bacteria 827
208 Ga0268266_10000045 3300028379 Bacteria 312955
209 Ga0268266_10111412 3300028379 Bacteria 2425
210 Ga0268266_11201915 3300028379 Bacteria 733
211 Ga0268265_10004189 3300028380 Bacteria 10094
212 Ga0268264_10012280 3300028381 Bacteria 7049
213 Ga0268264_10042357 3300028381 Bacteria 3769
214 Ga0268264_10253874 3300028381 Bacteria 1635
215 Ga0265337_1000034 3300028556 Bacteria 60151
216 Ga0265326_10000041 3300028558 Bacteria 83872
217 Ga0265318_10218035 3300028577 Bacteria 697
218 Ga0265322_10000004 3300028654 Bacteria 275155
219 Ga0265336_10014153 3300028666 Bacteria 2647
220 Ga0265338_10158296 3300028800 Bacteria 1752
221 Ga0265324_10237727 3300029957 Bacteria 618
222 Ga0307511_10045873 3300030521 Bacteria 3605
223 Ga0265328_10003370 3300031239 Bacteria 7064
224 Ga0265320_10000029 3300031240 Bacteria 159627
225 Ga0265329_10003419 3300031242 Bacteria 6923
226 Ga0265339_10006278 3300031249 Bacteria 7813
227 Ga0265331_10000526 3300031250 Bacteria 35306
228 Ga0265327_10000015 3300031251 Bacteria 496677
229 Ga0265316_10016243 3300031344 Bacteria 6463
230 Ga0265313_10040058 3300031595 Bacteria 2319
231 Ga0265314_10000119 3300031711 Bacteria 122334
232 Ga0307405_10483394 3300031731 Bacteria 989
233 Ga0307415_100003139 3300032126 Bacteria 8373
234 Ga0373953_0123258 3300035117 Bacteria 1102
235 Ga0373935_1056439 3300035692 Bacteria 604
236 Ga0373937_0018727 3300036401 Bacteria 6188
237 Ga0395900_0474103 3300037418 Bacteria 1205
238 Ga0395900_0746971 3300037418 Bacteria 909
239 Ga0395900_0908271 3300037418 Bacteria 804
240 Ga0395900_1045810 3300037418 Bacteria 735
241 Ga0395898_0195388 3300037466 Bacteria 1933
242 Ga0395905_0515418 3300037471 Bacteria 1096
243 Ga0395905_0912525 3300037471 Bacteria 781
244 Ga0395905_1090058 3300037471 Bacteria 702
245 Ga0436364_1035306 3300037853 Bacteria 1083
246 Ga0395901_0180203 3300038443 Bacteria 2216
247 Ga0395901_1355843 3300038443 Bacteria 671
248 Ga0451807_0042816 3300041486 Bacteria 811
249 Ga0451839_0200805 3300041496 Bacteria 904
250 Ga0451845_0860192 3300041501 Bacteria 706
251 Ga0451853_2679834 3300041512 Bacteria 9437
252 Ga0451853_3964082 3300041512 Bacteria 902
253 Ga0466963_0000043 3300044694 Bacteria 40976
254 Ga0466963_0076444 3300044694 Bacteria 2261
255 Ga0466963_0331809 3300044694 Bacteria 1071
256 Ga0466963_0403703 3300044694 Bacteria 964
257 Ga0466957_0000293 3300044842 Bacteria 24503
258 Ga0466967_0000006 3300045976 Bacteria 144065
259 Ga0466967_0268647 3300045976 Bacteria 1634
260 Ga0495592_0158857 3300046454 Bacteria 1557
261 Ga0495603_0000033 3300046455 Bacteria 57940
262 Ga0495603_0000391 3300046455 Bacteria 24052
263 Ga0495603_0007880 3300046455 Bacteria 6423
264 Ga0495603_0204902 3300046455 Bacteria 1140
265 Ga0495591_114202 3300046458 Bacteria 662
266 Ga0495591_122506 3300046458 Bacteria 634
267 Ga0495629_0001657 3300046459 Bacteria 17477
268 Ga0495629_0010304 3300046459 Bacteria 6809
269 Ga0495629_0031498 3300046459 Bacteria 3755
270 Ga0495629_0092576 3300046459 Bacteria 2110
271 Ga0495629_0218475 3300046459 Bacteria 1315
272 Ga0495638_0015861 3300046460 Bacteria 5049
273 Ga0495641_0000014 3300046461 Bacteria 140908
274 Ga0495641_0022653 3300046461 Bacteria 3137
275 Ga0495641_0170627 3300046461 Bacteria 973
276 Ga0495651_0395099 3300046462 Bacteria 904
277 Ga0495653_0015144 3300046463 Bacteria 6287
278 Ga0495653_0058220 3300046463 Bacteria 2938
279 Ga0495653_0299537 3300046463 Bacteria 1049
280 Ga0495653_0571687 3300046463 Bacteria 697
281 Ga0495653_0599176 3300046463 Bacteria 677
282 Ga0495582_0000009 3300046473 Bacteria 123633
283 Ga0495582_0738497 3300046473 Bacteria 570
284 Ga0495662_0000001 3300046476 Bacteria 179185
285 Ga0495662_0002954 3300046476 Bacteria 8583
286 Ga0495662_0038877 3300046476 Bacteria 2299
287 Ga0495662_0200633 3300046476 Bacteria 983
288 Ga0495662_0381565 3300046476 Bacteria 692
289 Ga0495594_0000006 3300046499 Bacteria 167901
290 Ga0495594_0585896 3300046499 Bacteria 632
291 Ga0495606_0000463 3300046507 Bacteria 66752
292 Ga0495608_0000007 3300046511 Bacteria 313495
293 Ga0495608_0000361 3300046511 Bacteria 31801
294 Ga0495618_0000070 3300046514 Bacteria 72312
295 Ga0495618_0253354 3300046514 Bacteria 1104
296 Ga0495620_0000215 3300046515 Bacteria 43539
297 Ga0495628_0008170 3300046516 Bacteria 9000
298 Ga0495628_0072311 3300046516 Bacteria 2687
299 Ga0495628_0197377 3300046516 Bacteria 1517
300 Ga0495628_0240945 3300046516 Bacteria 1353
301 Ga0495630_0000060 3300046517 Bacteria 90021
302 Ga0495630_0002249 3300046517 Bacteria 13440
303 Ga0495652_0000010 3300046529 Bacteria 261584
304 Ga0495652_0007462 3300046529 Bacteria 10079
305 Ga0495640_0024363 3300046533 Bacteria 4404
306 Ga0495640_0031669 3300046533 Bacteria 3772
307 Ga0495586_0081805 3300046535 Bacteria 1775
308 Ga0495587_0308331 3300046536 Bacteria 885
309 Ga0495587_0414600 3300046536 Bacteria 748
310 Ga0495598_0004462 3300046537 Bacteria 3031
311 Ga0495621_0002501 3300046539 Bacteria 4954
312 Ga0495645_0031398 3300046543 Bacteria 3871
313 Ga0495645_0045277 3300046543 Bacteria 3210
314 Ga0495622_0000297 3300046557 Bacteria 37460
315 Ga0495667_0000045 3300046559 Bacteria 118562
316 Ga0495667_0037656 3300046559 Bacteria 3223
317 Ga0495656_0001136 3300046615 Bacteria 8648
318 Ga0495668_0024540 3300046616 Bacteria 3429
319 Ga0495634_0000045 3300046642 Bacteria 99087
320 Ga0495634_0001402 3300046642 Bacteria 21621
321 Ga0495634_0028701 3300046642 Bacteria 3860
322 Ga0495625_0000032 3300046660 Bacteria 233135
323 Ga0495625_0288905 3300046660 Bacteria 1053
324 Ga0495635_0000074 3300046663 Bacteria 62264
325 Ga0495635_0093153 3300046663 Bacteria 2060
326 Ga0495588_0001071 3300046674 Bacteria 11845
327 Ga0495588_0169278 3300046674 Bacteria 1155
328 Ga0495657_0000001 3300046675 Bacteria 445641
329 Ga0495657_0004097 3300046675 Bacteria 11689
330 Ga0495599_0047195 3300046678 Bacteria 2699
331 Ga0495599_0208885 3300046678 Bacteria 1198
332 Ga0495623_0385519 3300046679 Bacteria 757
333 Ga0495647_0000023 3300046681 Bacteria 67025
334 Ga0495647_0000063 3300046681 Bacteria 26932
335 Ga0495647_0013099 3300046681 Bacteria 2867
336 Ga0495658_0000002 3300046683 Bacteria 309651
337 Ga0495658_0005120 3300046683 Bacteria 6446
338 Ga0495658_0233517 3300046683 Bacteria 1154
339 Ga0495658_0494867 3300046683 Unclassified 782
340 Ga0495669_0000261 3300046684 Bacteria 30497
341 Ga0495669_0165031 3300046684 Bacteria 1052
342 Ga0495613_0000032 3300046689 Bacteria 139806
343 Ga0495613_0000220 3300046689 Bacteria 55692
344 Ga0495613_0130334 3300046689 Bacteria 1801
345 Ga0495613_0467384 3300046689 Bacteria 853
346 Ga0495624_0000071 3300046690 Bacteria 65995
347 Ga0495624_0000243 3300046690 Bacteria 42818
348 Ga0495624_0115319 3300046690 Bacteria 1651
349 Ga0495670_0017664 3300046691 Bacteria 3513
350 Ga0495649_0003945 3300046694 Bacteria 9799
351 Ga0495600_0003218 3300046809 Bacteria 9555
352 Ga0495600_0063488 3300046809 Bacteria 2413
353 Ga0495600_0193856 3300046809 Bacteria 1306
354 Ga0495604_0000927 3300047317 Bacteria 24398
355 Ga0495604_0001215 3300047317 Bacteria 21186
356 Ga0495674_0000010 3300047319 Bacteria 285794
357 Ga0495676_0000136 3300047321 Bacteria 55706
358 Ga0495676_0005715 3300047321 Bacteria 11405
359 Ga0495676_0014346 3300047321 Bacteria 7091
360 Ga0495680_0000472 3300047322 Bacteria 45335
361 Ga0495680_0000486 3300047322 Bacteria 44707
362 Ga0495680_0058909 3300047322 Bacteria 2966
363 Ga0495680_0066060 3300047322 Bacteria 2769
364 Ga0495680_0116046 3300047322 Bacteria 1980
365 Ga0495680_0489018 3300047322 Bacteria 837
366 Ga0495675_0000017 3300047444 Bacteria 123394
367 Ga0495675_0115419 3300047444 Bacteria 1674
368 Ga0495677_0091269 3300047445 Bacteria 1148
369 Ga0495679_019804 3300047446 Bacteria 2356
370 Ga0495685_004050 3300047447 Bacteria 4714
371 Ga0495684_0085096 3300047471 Bacteria 2398
372 Ga0495686_0066193 3300047472 Bacteria 2233
373 Ga0495593_0137049 3300047673 Bacteria 1240
374 Ga0495602_0000007 3300048088 Bacteria 273212
375 Ga0495602_0003667 3300048088 Bacteria 15918
376 Ga0495602_0031280 3300048088 Bacteria 5035
377 Ga0495602_0196575 3300048088 Bacteria 1542
378 Ga0495602_0315934 3300048088 Unclassified 1138
379 Ga0495614_0187051 3300048089 Bacteria 933
380 Ga0496100_0000001 3300048903 Bacteria 530179
381 Ga0496100_0000014 3300048903 Bacteria 174991
382 Ga0496100_0936473 3300048903 Bacteria 681
383 Ga0496101_0000004 3300048904 Bacteria 331599
384 Ga0496101_0000036 3300048904 Bacteria 175595
385 Ga0496101_1204545 3300048904 Bacteria 593
386 Ga0496102_0976081 3300048905 Bacteria 768
387 Ga0496103_0000057 3300048906 Bacteria 142223
388 Ga0496104_0000015 3300048907 Bacteria 374530
389 Ga0496104_0000024 3300048907 Bacteria 229913
390 Ga0496104_0000866 3300048907 Bacteria 26077
391 Ga0496104_0038236 3300048907 Bacteria 4490
392 Ga0496105_0000004 3300048908 Bacteria 475798
393 Ga0496105_0000013 3300048908 Bacteria 229894
394 Ga0496105_0000059 3300048908 Bacteria 86884
395 Ga0496105_0034930 3300048908 Bacteria 4137
396 Ga0496105_0748067 3300048908 Bacteria 747
397 Ga0496106_0000091 3300048909 Bacteria 71361
398 Ga0496106_0000111 3300048909 Bacteria 63431
399 Ga0496106_0000795 3300048909 Bacteria 22795
400 Ga0496106_0126652 3300048909 Bacteria 2000
401 Ga0496107_0000005 3300048910 Bacteria 281747
402 Ga0496107_0000022 3300048910 Bacteria 128991
403 Ga0496107_0012674 3300048910 Bacteria 5887
404 Ga0496108_0000006 3300048911 Bacteria 469473
405 Ga0496108_0000026 3300048911 Bacteria 172399
406 Ga0496108_0001422 3300048911 Bacteria 18875
407 Ga0496108_0009264 3300048911 Bacteria 7966
408 Ga0496108_1051529 3300048911 Bacteria 693
409 Ga0496109_0000004 3300048912 Bacteria 404818
410 Ga0496109_0000012 3300048912 Bacteria 229699
411 Ga0496109_0000056 3300048912 Bacteria 120835
412 Ga0496109_0001040 3300048912 Bacteria 22963
413 Ga0496109_0175020 3300048912 Bacteria 2014
414 Ga0496109_0415697 3300048912 Bacteria 1271
415 Ga0496109_0642730 3300048912 Bacteria 998
416 Ga0496110_0000750 3300048913 Bacteria 22419
417 Ga0496110_0013308 3300048913 Bacteria 6797
418 Ga0496110_0072871 3300048913 Bacteria 3048
419 Ga0496110_0282282 3300048913 Bacteria 1512
420 Ga0496111_0000047 3300048914 Bacteria 47782
421 Ga0496111_0050802 3300048914 Bacteria 2992
422 Ga0496111_0252334 3300048914 Bacteria 1309
423 Ga0496111_0269293 3300048914 Bacteria 1264
424 Ga0496112_0000006 3300048915 Bacteria 365227
425 Ga0496112_0000566 3300048915 Bacteria 25425
426 Ga0496112_0213911 3300048915 Bacteria 1884
427 Ga0496112_0402977 3300048915 Bacteria 1308
428 Ga0496112_0413934 3300048915 Bacteria 1287
429 Ga0496113_0000037 3300048916 Bacteria 56610
430 Ga0496113_0003344 3300048916 Bacteria 9576
431 Ga0496113_0035042 3300048916 Bacteria 3667
432 Ga0496113_0090841 3300048916 Bacteria 2353
433 Ga0496113_0183897 3300048916 Bacteria 1657
434 Ga0496113_0191710 3300048916 Bacteria 1622
435 Ga0496113_0910694 3300048916 Bacteria 695
436 Ga0496113_0935808 3300048916 Bacteria 684
437 Ga0496114_0012163 3300048917 Bacteria 6887
438 Ga0496114_0374111 3300048917 Bacteria 1261
439 Ga0496115_0000525 3300048918 Bacteria 29761
440 Ga0496115_0030753 3300048918 Bacteria 4226
441 Ga0496117_0077842 3300048920 Bacteria 2192
442 Ga0496117_0191134 3300048920 Bacteria 1166
443 Ga0496117_0413237 3300048920 Bacteria 677
444 Ga0496118_0228412 3300048921 Bacteria 1076
445 Ga0496118_0317397 3300048921 Bacteria 847
446 Ga0496119_0062828 3300048922 Bacteria 2211
447 Ga0496120_0263833 3300048923 Bacteria 803
448 Ga0496121_0008006 3300048924 Bacteria 12613
449 Ga0496124_0108892 3300048927 Bacteria 2234
450 Ga0496124_0518313 3300048927 Bacteria 795
451 Ga0496125_0048312 3300048928 Bacteria 3550
452 Ga0496125_0282058 3300048928 Bacteria 1028
453 Ga0496126_0030735 3300048929 Bacteria 5085
454 Ga0501032_0217894 3300049569 Bacteria 1243
455 Ga0501042_0030117 3300049578 Bacteria 3832
456 Ga0501042_0074672 3300049578 Bacteria 2426
457 Ga0501042_0258254 3300049578 Bacteria 1258
458 Ga0501047_0346569 3300049581 Bacteria 1322
459 Ga0501068_0049638 3300049584 Bacteria 2535
460 Ga0501068_0203026 3300049584 Bacteria 1257
461 Ga0501070_0009917 3300049586 Bacteria 8052
462 Ga0501070_0169220 3300049586 Bacteria 1800
463 Ga0501070_0319069 3300049586 Bacteria 1264
464 Ga0501071_0864780 3300049587 Bacteria 697
465 Ga0501075_0000699 3300049591 Bacteria 20775
466 Ga0501079_0773403 3300049741 Bacteria 756
467 Ga0501079_1201216 3300049741 Bacteria 597
468 Ga0501083_0029279 3300049744 Bacteria 3789
469 Ga0501044_1058016 3300049823 Bacteria 682
470 Ga0501045_0695196 3300049824 Bacteria 751
471 nmdc:mga00v17_523835_c1 3300050491 Bacteria 767
472 nmdc:mga08y16_1159395_c1 3300050511 Bacteria 745
473 nmdc:mga0a205_13_c1 3300050515 Bacteria 111131
474 nmdc:mga0a205_337_c1 3300050515 Bacteria 35228
475 nmdc:mga0a205_869642_c1 3300050515 Bacteria 748
476 Ga0495601_0000099 3300053077 Bacteria 47704
477 Ga0495601_0000887 3300053077 Bacteria 16319
478 Ga0495601_0059700 3300053077 Bacteria 2419
479 Ga0495601_0469564 3300053077 Bacteria 813
480 Ga0500635_0272434 3300053080 Bacteria 666
481 Ga0495655_0000005 3300053083 Bacteria 257472
482 Ga0495655_0000547 3300053083 Bacteria 6176
483 Ga0495595_0000002 3300053084 Bacteria 445641
484 Ga0495595_0001245 3300053084 Bacteria 9923
485 Ga0495619_0000008 3300053085 Bacteria 305999
486 Ga0495619_0000082 3300053085 Bacteria 71788
487 Ga0495619_0000183 3300053085 Bacteria 46388
488 Ga0495619_0000376 3300053085 Bacteria 30790
489 Ga0495619_0006399 3300053085 Bacteria 7463
490 Ga0500566_0005771 3300053094 Bacteria 7354
491 Ga0500566_0084297 3300053094 Bacteria 1764
492 Ga0500595_029677 3300053119 Bacteria 1853
493 Ga0500614_000077 3300053123 Bacteria 21548
494 Ga0500628_000001 3300053129 Bacteria 564074
495 Ga0501084_0954844 3300054114 Bacteria 721
496 Ga0501082_0380888 3300060353 Bacteria 1231
497 Ga0496111_0148446
498 CNAas_1006915
499 JGI24746J21847_1000048
500 JGI24034J26672_10010515
501 JGI24742J22300_10019848
502 JGI25406J46586_10046762
503 Ga0070683_100019627
504 Ga0070683_100053231
505 Ga0070683_100106093
506 Ga0070690_100118147
507 Ga0070677_10000037
508 Ga0070666_10069888
509 Ga0070682_100000011
510 Ga0070682_100000030
511 Ga0068868_100002102
512 Ga0070691_10000908
513 Ga0070661_100000608
514 Ga0070669_100451069
515 Ga0070674_100000002
516 Ga0070674_100000007
517 Ga0070688_100000412
518 Ga0070688_100022008
519 Ga0070688_100303465
520 Ga0070688_100672970
521 Ga0070659_100301183
522 Ga0070667_100001123
523 Ga0070714_100062407
524 Ga0070714_100819408
525 Ga0070713_100096958
526 Ga0070711_100001735
527 Ga0070700_100094352
528 Ga0070678_100383579
529 Ga0070678_100794935
530 Ga0070662_100000002
531 Ga0068867_100000204
532 Ga0070685_10000013
533 Ga0070685_10007592
534 Ga0070685_10085369
535 Ga0070679_100000181
536 Ga0070684_100012567
537 Ga0070684_100074570
538 Ga0070684_100083172
539 Ga0070684_100258796
540 Ga0068853_100025258
541 Ga0070672_100000083
542 Ga0070686_100339038
543 Ga0070693_100000987
544 Ga0070665_100000040
545 Ga0070665_100119714
546 Ga0070665_100348798
547 Ga0068855_100328389
548 Ga0068855_100456808
549 Ga0068857_100274783
550 Ga0068854_100000363
551 Ga0068854_100023409
552 Ga0068856_100000237
553 Ga0068856_100027399
554 Ga0068852_100000002
555 Ga0068852_100012193
556 Ga0068852_101055372
557 Ga0068866_10000003
558 Ga0068866_10001295
559 Ga0068861_100246154
560 Ga0068861_100342948
561 Ga0068851_10004739
562 Ga0068863_100001530
563 Ga0068858_100000120
564 Ga0068858_100006738
565 Ga0068858_100083875
566 Ga0068860_100056918
567 Ga0068860_100057465
568 Ga0068860_100956121
569 Ga0068862_100005726
570 Ga0081455_10041414
571 Ga0081538_10143624
572 Ga0081540_1000123
573 Ga0081540_1000639
574 Ga0081540_1071063
575 Ga0081540_1196929
576 Ga0081539_10004533
577 Ga0081539_10136440
578 Ga0081539_10166595
579 Ga0070715_10000001
580 Ga0070715_10110490
581 Ga0070712_100004387
582 Ga0097621_100651940
583 Ga0075433_10014316
584 Ga0068865_100000134
585 Ga0105240_10407549
586 Ga0105240_10617969
587 Ga0111539_10689128
588 Ga0105245_10000026
589 Ga0105245_10000143
590 Ga0105245_10002179
591 Ga0105245_10012210
592 Ga0105245_10303667
593 Ga0105247_10121750
594 Ga0105243_10027253
595 Ga0105243_10053227
596 Ga0105241_10069970
597 Ga0105242_10032261
598 Ga0105242_10105713
599 Ga0105248_10000020
600 Ga0105248_10117972
601 Ga0105238_10000009
602 Ga0105249_10000070
603 Ga0105249_10627246
604 Ga0105249_11054213
605 Ga0105239_10476537
606 Ga0105239_11092735
607 Ga0105246_11119237
608 Ga0157369_10000014
609 Ga0157374_10013277
610 Ga0157374_11972016
611 Ga0157378_10051353
612 Ga0157378_10093267
613 Ga0157378_11257173
614 Ga0163162_10325302
615 Ga0157372_10000060
616 Ga0157375_10003070
617 Ga0157375_10004333
618 Ga0157375_11241477
619 Ga0163163_10483151
620 Ga0163163_11158041
621 Ga0157380_10023476
622 Ga0157379_10033468
623 Ga0157379_10058054
624 Ga0157379_10105847
625 Ga0163161_10021169
626 Ga0163161_11708957
627 Ga0224712_10155727
628 Ga0207656_10021074
629 Ga0207656_10028797
630 Ga0207682_10000018
631 Ga0207642_10000002
632 Ga0207642_10000634
633 Ga0207710_10000997
634 Ga0207680_10000567
635 Ga0207685_10000005
636 Ga0207654_10106053
637 Ga0207695_10425791
638 Ga0207695_10518784
639 Ga0207693_10015036
640 Ga0207663_10042943
641 Ga0207663_10080051
642 Ga0207649_10000003
643 Ga0207652_10000371
644 Ga0207681_10772865
645 Ga0207694_10000004
646 Ga0207650_10182994
647 Ga0207659_10000368
648 Ga0207687_10000017
649 Ga0207687_10000020
650 Ga0207687_10001467
651 Ga0207687_10010029
652 Ga0207664_10229876
653 Ga0207664_10995519
654 Ga0207690_10240805
655 Ga0207706_10000001
656 Ga0207686_10181970
657 Ga0207709_10013906
658 Ga0207709_10161357
659 Ga0207670_10010569
660 Ga0207670_10036018
661 Ga0207669_10000001
662 Ga0207669_10000003
663 Ga0207704_10000110
664 Ga0207665_10063868
665 Ga0207691_10000641
666 Ga0207711_10000006
667 Ga0207661_10000867
668 Ga0207661_10011021
669 Ga0207661_10018898
670 Ga0207661_10033030
671 Ga0207661_11231173
672 Ga0207679_10327214
673 Ga0207667_10456553
674 Ga0207651_10037230
675 Ga0207712_10000019
676 Ga0207712_10026616
677 Ga0207712_10395574
678 Ga0207640_10000110
679 Ga0207640_10005989
680 Ga0207658_10000724
681 Ga0207658_10182655
682 Ga0207677_10000362
683 Ga0207677_10004995
684 Ga0207703_10000018
685 Ga0207703_10000170
686 Ga0207703_10233624
687 Ga0207639_10007449
688 Ga0207639_10087562
689 Ga0207708_10127228
690 Ga0207708_10130501
691 Ga0207702_10000251
692 Ga0207702_10007011
693 Ga0207641_10000016
694 Ga0207648_10000643
695 Ga0207674_10280873
696 Ga0207675_100445021
697 Ga0207683_10031544
698 Ga0207683_10412863
699 Ga0207683_10432745
700 Ga0207683_11744216
701 Ga0207698_10000004
702 Ga0207698_10006867
703 Ga0207428_10558653
704 Ga0268266_10000045
705 Ga0268266_10111412
706 Ga0268266_11201915
707 Ga0268265_10004189
708 Ga0268264_10012280
709 Ga0268264_10042357
710 Ga0268264_10253874
711 Ga0265337_1000034
712 Ga0265326_10000041
713 Ga0265318_10218035
714 Ga0265322_10000004
715 Ga0265336_10014153
716 Ga0265338_10158296
717 Ga0265324_10237727
718 Ga0307511_10045873
719 Ga0265328_10003370
720 Ga0265320_10000029
721 Ga0265329_10003419
722 Ga0265339_10006278
723 Ga0265331_10000526
724 Ga0265327_10000015
725 Ga0265316_10016243
726 Ga0265313_10040058
727 Ga0265314_10000119
728 Ga0307405_10483394
729 Ga0307415_100003139
730 Ga0373953_0123258
731 Ga0373935_1056439
732 Ga0373937_0018727
733 Ga0395900_0474103
734 Ga0395900_0746971
735 Ga0395900_0908271
736 Ga0395900_1045810
737 Ga0395898_0195388
738 Ga0395905_0515418
739 Ga0395905_0912525
740 Ga0395905_1090058
741 Ga0436364_1035306
742 Ga0395901_0180203
743 Ga0395901_1355843
744 Ga0451807_0042816
745 Ga0451839_0200805
746 Ga0451845_0860192
747 Ga0451853_2679834
748 Ga0451853_3964082
749 Ga0466963_0000043
750 Ga0466963_0076444
751 Ga0466963_0331809
752 Ga0466963_0403703
753 Ga0466957_0000293
754 Ga0466967_0000006
755 Ga0466967_0268647
756 Ga0495592_0158857
757 Ga0495603_0000033
758 Ga0495603_0000391
759 Ga0495603_0007880
760 Ga0495603_0204902
761 Ga0495591_114202
762 Ga0495591_122506
763 Ga0495629_0001657
764 Ga0495629_0010304
765 Ga0495629_0031498
766 Ga0495629_0092576
767 Ga0495629_0218475
768 Ga0495638_0015861
769 Ga0495641_0000014
770 Ga0495641_0022653
771 Ga0495641_0170627
772 Ga0495651_0395099
773 Ga0495653_0015144
774 Ga0495653_0058220
775 Ga0495653_0299537
776 Ga0495653_0571687
777 Ga0495653_0599176
778 Ga0495582_0000009
779 Ga0495582_0738497
780 Ga0495662_0000001
781 Ga0495662_0002954
782 Ga0495662_0038877
783 Ga0495662_0200633
784 Ga0495662_0381565
785 Ga0495594_0000006
786 Ga0495594_0585896
787 Ga0495606_0000463
788 Ga0495608_0000007
789 Ga0495608_0000361
790 Ga0495618_0000070
791 Ga0495618_0253354
792 Ga0495620_0000215
793 Ga0495628_0008170
794 Ga0495628_0072311
795 Ga0495628_0197377
796 Ga0495628_0240945
797 Ga0495630_0000060
798 Ga0495630_0002249
799 Ga0495652_0000010
800 Ga0495652_0007462
801 Ga0495640_0024363
802 Ga0495640_0031669
803 Ga0495586_0081805
804 Ga0495587_0308331
805 Ga0495587_0414600
806 Ga0495598_0004462
807 Ga0495621_0002501
808 Ga0495645_0031398
809 Ga0495645_0045277
810 Ga0495622_0000297
811 Ga0495667_0000045
812 Ga0495667_0037656
813 Ga0495656_0001136
814 Ga0495668_0024540
815 Ga0495634_0000045
816 Ga0495634_0001402
817 Ga0495634_0028701
818 Ga0495625_0000032
819 Ga0495625_0288905
820 Ga0495635_0000074
821 Ga0495635_0093153
822 Ga0495588_0001071
823 Ga0495588_0169278
824 Ga0495657_0000001
825 Ga0495657_0004097
826 Ga0495599_0047195
827 Ga0495599_0208885
828 Ga0495623_0385519
829 Ga0495647_0000023
830 Ga0495647_0000063
831 Ga0495647_0013099
832 Ga0495658_0000002
833 Ga0495658_0005120
834 Ga0495658_0233517
835 Ga0495658_0494867
836 Ga0495669_0000261
837 Ga0495669_0165031
838 Ga0495613_0000032
839 Ga0495613_0000220
840 Ga0495613_0130334
841 Ga0495613_0467384
842 Ga0495624_0000071
843 Ga0495624_0000243
844 Ga0495624_0115319
845 Ga0495670_0017664
846 Ga0495649_0003945
847 Ga0495600_0003218
848 Ga0495600_0063488
849 Ga0495600_0193856
850 Ga0495604_0000927
851 Ga0495604_0001215
852 Ga0495674_0000010
853 Ga0495676_0000136
854 Ga0495676_0005715
855 Ga0495676_0014346
856 Ga0495680_0000472
857 Ga0495680_0000486
858 Ga0495680_0058909
859 Ga0495680_0066060
860 Ga0495680_0116046
861 Ga0495680_0489018
862 Ga0495675_0000017
863 Ga0495675_0115419
864 Ga0495677_0091269
865 Ga0495679_019804
866 Ga0495685_004050
867 Ga0495684_0085096
868 Ga0495686_0066193
869 Ga0495593_0137049
870 Ga0495602_0000007
871 Ga0495602_0003667
872 Ga0495602_0031280
873 Ga0495602_0196575
874 Ga0495602_0315934
875 Ga0495614_0187051
876 Ga0496100_0000001
877 Ga0496100_0000014
878 Ga0496100_0936473
879 Ga0496101_0000004
880 Ga0496101_0000036
881 Ga0496101_1204545
882 Ga0496102_0976081
883 Ga0496103_0000057
884 Ga0496104_0000015
885 Ga0496104_0000024
886 Ga0496104_0000866
887 Ga0496104_0038236
888 Ga0496105_0000004
889 Ga0496105_0000013
890 Ga0496105_0000059
891 Ga0496105_0034930
892 Ga0496105_0748067
893 Ga0496106_0000091
894 Ga0496106_0000111
895 Ga0496106_0000795
896 Ga0496106_0126652
897 Ga0496107_0000005
898 Ga0496107_0000022
899 Ga0496107_0012674
900 Ga0496108_0000006
901 Ga0496108_0000026
902 Ga0496108_0001422
903 Ga0496108_0009264
904 Ga0496108_1051529
905 Ga0496109_0000004
906 Ga0496109_0000012
907 Ga0496109_0000056
908 Ga0496109_0001040
909 Ga0496109_0175020
910 Ga0496109_0415697
911 Ga0496109_0642730
912 Ga0496110_0000750
913 Ga0496110_0013308
914 Ga0496110_0072871
915 Ga0496110_0282282
916 Ga0496111_0000047
917 Ga0496111_0050802
918 Ga0496111_0252334
919 Ga0496111_0269293
920 Ga0496112_0000006
921 Ga0496112_0000566
922 Ga0496112_0213911
923 Ga0496112_0402977
924 Ga0496112_0413934
925 Ga0496113_0000037
926 Ga0496113_0003344
927 Ga0496113_0035042
928 Ga0496113_0090841
929 Ga0496113_0183897
930 Ga0496113_0191710
931 Ga0496113_0910694
932 Ga0496113_0935808
933 Ga0496114_0012163
934 Ga0496114_0374111
935 Ga0496115_0000525
936 Ga0496115_0030753
937 Ga0496117_0077842
938 Ga0496117_0191134
939 Ga0496117_0413237
940 Ga0496118_0228412
941 Ga0496118_0317397
942 Ga0496119_0062828
943 Ga0496120_0263833
944 Ga0496121_0008006
945 Ga0496124_0108892
946 Ga0496124_0518313
947 Ga0496125_0048312
948 Ga0496125_0282058
949 Ga0496126_0030735
950 Ga0501032_0217894
951 Ga0501042_0030117
952 Ga0501042_0074672
953 Ga0501042_0258254
954 Ga0501047_0346569
955 Ga0501068_0049638
956 Ga0501068_0203026
957 Ga0501070_0009917
958 Ga0501070_0169220
959 Ga0501070_0319069
960 Ga0501071_0864780
961 Ga0501075_0000699
962 Ga0501079_0773403
963 Ga0501079_1201216
964 Ga0501083_0029279
965 Ga0501044_1058016
966 Ga0501045_0695196
967 nmdc:mga00v17_523835_c1
968 nmdc:mga08y16_1159395_c1
969 nmdc:mga0a205_13_c1
970 nmdc:mga0a205_337_c1
971 nmdc:mga0a205_869642_c1
972 Ga0495601_0000099
973 Ga0495601_0000887
974 Ga0495601_0059700
975 Ga0495601_0469564
976 Ga0500635_0272434
977 Ga0495655_0000005
978 Ga0495655_0000547
979 Ga0495595_0000002
980 Ga0495595_0001245
981 Ga0495619_0000008
982 Ga0495619_0000082
983 Ga0495619_0000183
984 Ga0495619_0000376
985 Ga0495619_0006399
986 Ga0500566_0005771
987 Ga0500566_0084297
988 Ga0500595_029677
989 Ga0500614_000077
990 Ga0500628_000001
991 Ga0501084_0954844
992 Ga0501082_0380888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

25

134

0.93

PF08445

FR47

FR47-like protein

63

143

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

26

148

0.87

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

52

136

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9246 16 155
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.9242 112 155
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9121 17 136
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.9117 16 155
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9087 17 136
ID Description Score Start End Superfamily
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9574 17 156 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9403 112 154 3.40.630.30
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.939 17 154 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9385 66 106 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9249 27 156 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A538LRL0-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.989 17 155 GO:0008080
AF-A0A7V9LFD8-F1-model_v4 Ribosomal protein S18-alanine N-acetyltransferase 0.9852 16 155 GO:0005840
GO:0008080
AF-A0A6J4S7N2-F1-model_v4 Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.128) 0.983 14 155 GO:0008999
AF-A0A419GN36-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9784 16 156 GO:0005737
GO:0008999
AF-A0A1C3FEG0-F1-model_v4 deleted 0.9754 16 156

Map