F454990

General Info

Members Datasets Scaffolds Average Seq Length
497 270 496 103

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10136320|Ga0070658_101363202
Length 122
Sequence MTIDRPIAALARAVRARKNRRMSEPFASFREFYPFYLSEHVDRTCRRLHIVGSTFVLIVLVAACVTQRWLLLLALPLIGYGFAWIGHFFFEHNRPATFKNPLYSFAGDWVMWWQVVTGRIKF

Samples

Sample ID Description Type Environment
1 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
74 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
75 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
76 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
77 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
78 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
157 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
177 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
183 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
184 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
185 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
186 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
187 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
188 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
267 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
268 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0.4
Rhizoplane 5.03
Rhizosphere 80.08
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001053 3300003187 Bacteria 20584
2 rootL2_10053478 3300003322 Bacteria 2393
3 rootH1_10079071 3300003323 Bacteria 4072
4 Ga0055526_1006012 3300003771 Bacteria 6736
5 Ga0055537_1001508 3300003773 Bacteria 8963
6 Ga0055524_1000930 3300003775 Bacteria 18855
7 Ga0055524_1001625 3300003775 Bacteria 12537
8 Ga0055534_1000595 3300003784 Bacteria 18787
9 Ga0055534_1001047 3300003784 Bacteria 12086
10 Ga0070658_10136320 3300005327 Bacteria 2048
11 Ga0070658_10582920 3300005327 Bacteria 969
12 Ga0070658_11316367 3300005327 Bacteria 627
13 Ga0070676_11340555 3300005328 Bacteria 547
14 Ga0070683_100167420 3300005329 Bacteria 2085
15 Ga0070670_100218767 3300005331 Bacteria 1657
16 Ga0070670_100733661 3300005331 Bacteria 889
17 Ga0070677_10395154 3300005333 Bacteria 727
18 Ga0068869_100069735 3300005334 Bacteria 2600
19 Ga0068869_100320536 3300005334 Bacteria 1257
20 Ga0070666_10034396 3300005335 Bacteria 3358
21 Ga0070666_10565176 3300005335 Bacteria 828
22 Ga0070680_100739581 3300005336 Bacteria 847
23 Ga0070680_101047392 3300005336 Bacteria 705
24 Ga0070682_100205233 3300005337 Bacteria 1393
25 Ga0068868_100983497 3300005338 Bacteria 771
26 Ga0070660_100073615 3300005339 Bacteria 2671
27 Ga0070660_100204198 3300005339 Bacteria 1603
28 Ga0070661_100006257 3300005344 Bacteria 8215
29 Ga0070661_100034467 3300005344 Bacteria 3670
30 Ga0070661_100272195 3300005344 Bacteria 1312
31 Ga0070661_100456541 3300005344 Bacteria 1017
32 Ga0070661_100586358 3300005344 Bacteria 900
33 Ga0070661_100677892 3300005344 Bacteria 838
34 Ga0070669_100402576 3300005353 Bacteria 1120
35 Ga0070675_101504336 3300005354 Bacteria 621
36 Ga0070671_101524767 3300005355 Bacteria 592
37 Ga0070673_100400135 3300005364 Bacteria 1228
38 Ga0070688_100617160 3300005365 Bacteria 832
39 Ga0070659_100098041 3300005366 Bacteria 2356
40 Ga0070667_100000516 3300005367 Bacteria 38903
41 Ga0070667_100032759 3300005367 Bacteria 4336
42 Ga0070667_100220782 3300005367 Bacteria 1687
43 Ga0070667_101249229 3300005367 Bacteria 695
44 Ga0070667_102336542 3300005367 Bacteria 503
45 Ga0070711_100645268 3300005439 Bacteria 887
46 Ga0070663_100000179 3300005455 Bacteria 32148
47 Ga0070663_100055161 3300005455 Bacteria 2843
48 Ga0070663_100595931 3300005455 Unclassified 929
49 Ga0070663_101712705 3300005455 Bacteria 562
50 Ga0070678_100052016 3300005456 Bacteria 2972
51 Ga0070678_100386890 3300005456 Bacteria 1211
52 Ga0070662_100216066 3300005457 Bacteria 1528
53 Ga0070662_101064418 3300005457 Bacteria 693
54 Ga0070662_101128752 3300005457 Bacteria 673
55 Ga0068867_100157126 3300005459 Bacteria 1791
56 Ga0070679_100062627 3300005530 Bacteria 3709
57 Ga0070679_100090890 3300005530 Bacteria 3040
58 Ga0070684_100069436 3300005535 Bacteria 3098
59 Ga0068853_100000506 3300005539 Bacteria 26560
60 Ga0068853_100007343 3300005539 Bacteria 8818
61 Ga0068853_100008246 3300005539 Bacteria 8364
62 Ga0068853_100010746 3300005539 Bacteria 7413
63 Ga0068853_100056315 3300005539 Bacteria 3389
64 Ga0068853_100063712 3300005539 Bacteria 3193
65 Ga0068853_100717046 3300005539 Bacteria 955
66 Ga0070672_100022530 3300005543 Bacteria 4629
67 Ga0070696_100045761 3300005546 Bacteria 3032
68 Ga0070693_100676092 3300005547 Bacteria 753
69 Ga0070665_100063827 3300005548 Bacteria 3693
70 Ga0070665_100298778 3300005548 Bacteria 1613
71 Ga0070665_100501687 3300005548 Bacteria 1225
72 Ga0068855_100006516 3300005563 Bacteria 14195
73 Ga0068855_100006601 3300005563 Bacteria 14104
74 Ga0068855_100811818 3300005563 Bacteria 993
75 Ga0068855_102043791 3300005563 Bacteria 578
76 Ga0068855_102437801 3300005563 Bacteria 521
77 Ga0070664_100522251 3300005564 Bacteria 1096
78 Ga0068857_100016475 3300005577 Bacteria 6476
79 Ga0068857_100163046 3300005577 Bacteria 2023
80 Ga0068857_100268549 3300005577 Bacteria 1567
81 Ga0068854_100274505 3300005578 Bacteria 1355
82 Ga0068854_101073993 3300005578 Bacteria 716
83 Ga0068856_100084806 3300005614 Bacteria 3147
84 Ga0068856_100229162 3300005614 Bacteria 1873
85 Ga0068852_100004511 3300005616 Bacteria 9847
86 Ga0068852_100173489 3300005616 Bacteria 2023
87 Ga0068852_100263057 3300005616 Bacteria 1657
88 Ga0068852_100983537 3300005616 Bacteria 862
89 Ga0068852_101002188 3300005616 Bacteria 854
90 Ga0068859_100000087 3300005617 Bacteria 85514
91 Ga0068859_100242416 3300005617 Bacteria 1892
92 Ga0068859_101187564 3300005617 Bacteria 840
93 Ga0068859_102368934 3300005617 Bacteria 585
94 Ga0068864_100018280 3300005618 Bacteria 5854
95 Ga0068864_100072090 3300005618 Bacteria 3009
96 Ga0068864_100378530 3300005618 Bacteria 1341
97 Ga0068864_102445544 3300005618 Bacteria 528
98 Ga0068851_10189835 3300005834 Bacteria 1142
99 Ga0068851_10240466 3300005834 Bacteria 1023
100 Ga0068851_10292434 3300005834 Unclassified 934
101 Ga0068863_100005329 3300005841 Bacteria 12689
102 Ga0068863_100010432 3300005841 Bacteria 9030
103 Ga0068863_100013890 3300005841 Bacteria 7765
104 Ga0068863_100029037 3300005841 Bacteria 5283
105 Ga0068863_100644238 3300005841 Bacteria 1051
106 Ga0068858_100085922 3300005842 Bacteria 2927
107 Ga0068858_101721780 3300005842 Bacteria 619
108 Ga0068860_100066197 3300005843 Bacteria 3432
109 Ga0068860_100145145 3300005843 Bacteria 2283
110 Ga0068860_100199723 3300005843 Bacteria 1937
111 Ga0068860_100611184 3300005843 Bacteria 1096
112 Ga0068860_102343142 3300005843 Bacteria 554
113 Ga0068862_100000047 3300005844 Bacteria 151607
114 Ga0068862_100452028 3300005844 Bacteria 1211
115 Ga0068862_100476502 3300005844 Bacteria 1181
116 Ga0068862_100708450 3300005844 Bacteria 976
117 Ga0081539_10076721 3300005985 Bacteria 1770
118 Ga0075367_10999020 3300006178 Bacteria 534
119 Ga0097621_100057412 3300006237 Bacteria 3183
120 Ga0097621_100062985 3300006237 Bacteria 3046
121 Ga0097621_100265332 3300006237 Bacteria 1507
122 Ga0068871_100078166 3300006358 Bacteria 2735
123 Ga0068871_100099239 3300006358 Bacteria 2437
124 Ga0097620_100000087 3300006931 Bacteria 85514
125 Ga0097620_100242419 3300006931 Bacteria 1892
126 Ga0097620_101187570 3300006931 Bacteria 840
127 Ga0097620_102369128 3300006931 Bacteria 585
128 Ga0099826_10000004 3300006948 Bacteria 802669
129 Ga0099794_10028367 3300007265 Bacteria 2604
130 Ga0105240_10152160 3300009093 Bacteria 2754
131 Ga0105240_11373228 3300009093 Bacteria 743
132 Ga0105245_10691817 3300009098 Bacteria 1052
133 Ga0105245_11846962 3300009098 Bacteria 657
134 Ga0105247_10104147 3300009101 Bacteria 1817
135 Ga0114129_10013048 3300009147 Bacteria 11835
136 Ga0105243_10013440 3300009148 Bacteria 6190
137 Ga0105241_10033654 3300009174 Bacteria 3848
138 Ga0105241_10087935 3300009174 Bacteria 2446
139 Ga0105241_10093673 3300009174 Bacteria 2374
140 Ga0105241_10334483 3300009174 Bacteria 1310
141 Ga0105242_10073946 3300009176 Bacteria 2835
142 Ga0105242_10097735 3300009176 Bacteria 2483
143 Ga0105248_10001744 3300009177 Bacteria 24189
144 Ga0105248_10111494 3300009177 Bacteria 3085
145 Ga0105248_10571037 3300009177 Bacteria 1276
146 Ga0105248_10578864 3300009177 Bacteria 1267
147 Ga0105248_10659355 3300009177 Bacteria 1181
148 Ga0105237_10001431 3300009545 Bacteria 31552
149 Ga0105237_10003624 3300009545 Bacteria 18232
150 Ga0105237_10108768 3300009545 Bacteria 2763
151 Ga0105237_10490407 3300009545 Bacteria 1235
152 Ga0105238_10016479 3300009551 Bacteria 7481
153 Ga0105238_10045612 3300009551 Bacteria 4428
154 Ga0105238_10087157 3300009551 Bacteria 3109
155 Ga0105249_10439577 3300009553 Bacteria 1341
156 Ga0105249_10844425 3300009553 Bacteria 981
157 Ga0105239_10003013 3300010375 Bacteria 20986
158 Ga0105239_10022844 3300010375 Bacteria 6895
159 Ga0105239_10025713 3300010375 Bacteria 6483
160 Ga0105239_10032893 3300010375 Bacteria 5698
161 Ga0105239_10139953 3300010375 Bacteria 2696
162 Ga0105239_10462502 3300010375 Bacteria 1440
163 Ga0105239_11627632 3300010375 Bacteria 747
164 Ga0105246_10012861 3300011119 Bacteria 5234
165 Ga0105246_10088199 3300011119 Bacteria 2228
166 Ga0157328_1006393 3300012478 Bacteria 716
167 Ga0157318_1015197 3300012482 Bacteria 626
168 Ga0157323_1000845 3300012495 Bacteria 1414
169 Ga0157314_1012596 3300012500 Bacteria 763
170 Ga0157316_1017140 3300012510 Bacteria 752
171 Ga0157326_1072693 3300012513 Bacteria 548
172 Ga0157373_10019061 3300013100 Bacteria 4994
173 Ga0157373_10045918 3300013100 Bacteria 3118
174 Ga0157373_10473549 3300013100 Bacteria 903
175 Ga0157370_10012698 3300013104 Bacteria 8717
176 Ga0157370_10107924 3300013104 Bacteria 2603
177 Ga0157370_10572813 3300013104 Bacteria 1035
178 Ga0157370_11144755 3300013104 Bacteria 703
179 Ga0157369_10009281 3300013105 Bacteria 11251
180 Ga0157369_10033104 3300013105 Bacteria 5682
181 Ga0157374_10107154 3300013296 Bacteria 2685
182 Ga0157374_10140456 3300013296 Bacteria 2344
183 Ga0157374_11116765 3300013296 Bacteria 809
184 Ga0157378_11092207 3300013297 Bacteria 834
185 Ga0163162_10044573 3300013306 Bacteria 4443
186 Ga0163162_10050185 3300013306 Bacteria 4184
187 Ga0163162_10375239 3300013306 Bacteria 1555
188 Ga0163162_11405898 3300013306 Unclassified 794
189 Ga0157372_10003965 3300013307 Bacteria 15903
190 Ga0157372_11931594 3300013307 Bacteria 678
191 Ga0157375_10098867 3300013308 Bacteria 2996
192 Ga0163163_10010667 3300014325 Bacteria 8281
193 Ga0163163_11275529 3300014325 Unclassified 797
194 Ga0157380_11988351 3300014326 Bacteria 643
195 Ga0157379_10003264 3300014968 Bacteria 13736
196 Ga0157376_10004728 3300014969 Bacteria 9486
197 Ga0157376_10015834 3300014969 Bacteria 5707
198 Ga0157376_10316081 3300014969 Bacteria 1483
199 Ga0157376_10316437 3300014969 Bacteria 1482
200 Ga0182006_1133978 3300015261 Bacteria 850
201 Ga0182005_1003337 3300015265 Bacteria 5474
202 Ga0163161_10239814 3300017792 Bacteria 1410
203 Ga0213876_10497771 3300021384 Bacteria 648
204 Ga0209565_1000147 3300025263 Bacteria 96886
205 Ga0209675_1000436 3300025291 Bacteria 33133
206 Ga0209025_1003128 3300025294 Bacteria 16186
207 Ga0209564_1000651 3300025295 Bacteria 51999
208 Ga0209758_1000013 3300025297 Bacteria 873003
209 Ga0209758_1048408 3300025297 Bacteria 1512
210 Ga0209256_1000259 3300025299 Bacteria 94161
211 Ga0209051_1162052 3300025303 Bacteria 511
212 Ga0207697_10164886 3300025315 Bacteria 968
213 Ga0207656_10016322 3300025321 Bacteria 2890
214 Ga0207655_1181731 3300025728 Bacteria 642
215 Ga0207692_10165397 3300025898 Bacteria 1278
216 Ga0207710_10650608 3300025900 Bacteria 552
217 Ga0207680_10022918 3300025903 Bacteria 3402
218 Ga0207680_10042371 3300025903 Bacteria 2662
219 Ga0207647_10009858 3300025904 Bacteria 6766
220 Ga0207705_11231386 3300025909 Unclassified 573
221 Ga0207654_10159794 3300025911 Bacteria 1455
222 Ga0207707_10101165 3300025912 Bacteria 2519
223 Ga0207707_10820971 3300025912 Bacteria 773
224 Ga0207695_10000359 3300025913 Bacteria 104462
225 Ga0207671_10004912 3300025914 Bacteria 12554
226 Ga0207671_10043985 3300025914 Bacteria 3302
227 Ga0207671_10408481 3300025914 Bacteria 1080
228 Ga0207663_10209054 3300025916 Bacteria 1413
229 Ga0207660_10709531 3300025917 Bacteria 820
230 Ga0207657_10023031 3300025919 Bacteria 5810
231 Ga0207657_10023149 3300025919 Bacteria 5790
232 Ga0207649_10001229 3300025920 Bacteria 15386
233 Ga0207649_10121292 3300025920 Bacteria 1763
234 Ga0207649_10214626 3300025920 Bacteria 1367
235 Ga0207649_10604941 3300025920 Bacteria 843
236 Ga0207652_10928795 3300025921 Bacteria 767
237 Ga0207652_11676418 3300025921 Bacteria 540
238 Ga0207694_10087564 3300025924 Bacteria 2453
239 Ga0207694_10126682 3300025924 Bacteria 2043
240 Ga0207650_10174291 3300025925 Bacteria 1711
241 Ga0207650_10336945 3300025925 Bacteria 1238
242 Ga0207687_10442058 3300025927 Bacteria 1077
243 Ga0207687_11291344 3300025927 Bacteria 627
244 Ga0207644_10253264 3300025931 Bacteria 1405
245 Ga0207690_10143005 3300025932 Bacteria 1765
246 Ga0207706_10513336 3300025933 Bacteria 1034
247 Ga0207706_10716988 3300025933 Bacteria 854
248 Ga0207686_10059782 3300025934 Bacteria 2409
249 Ga0207686_10387423 3300025934 Bacteria 1061
250 Ga0207709_10000853 3300025935 Bacteria 23315
251 Ga0207709_10042229 3300025935 Bacteria 2741
252 Ga0207691_10004898 3300025940 Bacteria 12938
253 Ga0207711_10003349 3300025941 Bacteria 13882
254 Ga0207711_10236023 3300025941 Bacteria 1676
255 Ga0207711_10391725 3300025941 Bacteria 1290
256 Ga0207689_10019026 3300025942 Bacteria 5792
257 Ga0207661_10164391 3300025944 Bacteria 1927
258 Ga0207661_10640220 3300025944 Unclassified 977
259 Ga0207679_10714471 3300025945 Bacteria 910
260 Ga0207679_11157384 3300025945 Bacteria 710
261 Ga0207667_10023219 3300025949 Bacteria 6831
262 Ga0207667_10029957 3300025949 Bacteria 5895
263 Ga0207667_10035375 3300025949 Bacteria 5357
264 Ga0207667_10134967 3300025949 Bacteria 2541
265 Ga0207651_10082381 3300025960 Bacteria 2323
266 Ga0207712_10107530 3300025961 Bacteria 2086
267 Ga0207712_10417176 3300025961 Bacteria 1131
268 Ga0207668_10073147 3300025972 Bacteria 2455
269 Ga0207668_11450835 3300025972 Bacteria 619
270 Ga0207640_10043967 3300025981 Bacteria 2859
271 Ga0207658_10000027 3300025986 Bacteria 174626
272 Ga0207658_10017200 3300025986 Bacteria 4982
273 Ga0207658_10259244 3300025986 Bacteria 1481
274 Ga0207658_10354676 3300025986 Bacteria 1278
275 Ga0207703_10050324 3300026035 Bacteria 3372
276 Ga0207639_10000494 3300026041 Bacteria 27267
277 Ga0207639_10000544 3300026041 Bacteria 25870
278 Ga0207639_10004534 3300026041 Bacteria 9362
279 Ga0207639_10008455 3300026041 Bacteria 7055
280 Ga0207639_10034585 3300026041 Bacteria 3735
281 Ga0207639_10348913 3300026041 Bacteria 1321
282 Ga0207639_10579017 3300026041 Bacteria 1033
283 Ga0207678_10000703 3300026067 Bacteria 30545
284 Ga0207678_10200230 3300026067 Bacteria 1707
285 Ga0207678_10601121 3300026067 Bacteria 964
286 Ga0207678_10633523 3300026067 Unclassified 939
287 Ga0207678_10698098 3300026067 Bacteria 893
288 Ga0207702_10595680 3300026078 Bacteria 1084
289 Ga0207702_11856555 3300026078 Bacteria 594
290 Ga0207641_10019305 3300026088 Bacteria 5594
291 Ga0207641_10030355 3300026088 Bacteria 4477
292 Ga0207641_10034712 3300026088 Bacteria 4197
293 Ga0207641_10350557 3300026088 Bacteria 1407
294 Ga0207641_10625951 3300026088 Bacteria 1055
295 Ga0207641_10861258 3300026088 Bacteria 898
296 Ga0207648_10147368 3300026089 Bacteria 2076
297 Ga0207676_10023790 3300026095 Bacteria 4526
298 Ga0207676_10300646 3300026095 Bacteria 1465
299 Ga0207676_11392001 3300026095 Unclassified 697
300 Ga0207674_10006961 3300026116 Bacteria 13237
301 Ga0207674_10117996 3300026116 Bacteria 2623
302 Ga0207674_10482710 3300026116 Bacteria 1198
303 Ga0207675_101773844 3300026118 Bacteria 637
304 Ga0207683_10086273 3300026121 Bacteria 2790
305 Ga0207683_10399057 3300026121 Bacteria 1265
306 Ga0207683_11593454 3300026121 Bacteria 602
307 Ga0207698_10457090 3300026142 Bacteria 1234
308 Ga0207698_10837317 3300026142 Bacteria 924
309 Ga0209371_1000011 3300027312 Bacteria 848456
310 Ga0209996_1071626 3300027395 Unclassified 539
311 Ga0209282_1000027 3300027666 Bacteria 159842
312 Ga0209588_1099892 3300027671 Bacteria 934
313 Ga0268266_10022244 3300028379 Bacteria 5403
314 Ga0268266_10115605 3300028379 Bacteria 2382
315 Ga0268266_10309868 3300028379 Bacteria 1475
316 Ga0268265_10000852 3300028380 Bacteria 28635
317 Ga0268265_10054499 3300028380 Bacteria 3035
318 Ga0268265_10393162 3300028380 Bacteria 1279
319 Ga0268265_11105738 3300028380 Bacteria 787
320 Ga0268264_10046430 3300028381 Bacteria 3607
321 Ga0268264_10409180 3300028381 Unclassified 1305
322 Ga0268264_10861442 3300028381 Bacteria 908
323 Ga0268264_11445241 3300028381 Bacteria 698
324 Ga0268264_11956600 3300028381 Bacteria 596
325 Ga0268256_1000011 3300030500 Bacteria 848625
326 Ga0307511_10249225 3300030521 Bacteria 856
327 Ga0307513_10154637 3300031456 Bacteria 2196
328 Ga0316575_10004609 3300031665 Bacteria 4857
329 Ga0316579_10001664 3300031691 Bacteria 8158
330 Ga0316578_10008886 3300031728 Bacteria 5137
331 Ga0307413_10878186 3300031824 Bacteria 760
332 Ga0307410_10458709 3300031852 Bacteria 1041
333 Ga0307410_10531945 3300031852 Bacteria 972
334 Ga0307409_100355550 3300031995 Bacteria 1384
335 Ga0307414_11025770 3300032004 Bacteria 760
336 Ga0307411_10258388 3300032005 Bacteria 1374
337 Ga0316583_10002154 3300032133 Bacteria 6782
338 Ga0316574_0678516 3300035398 Bacteria 633
339 Ga0316582_0003077 3300036647 Bacteria 8060
340 Ga0395905_1365931 3300037471 Bacteria 612
341 Ga0316581_0002657 3300037588 Bacteria 4315
342 Ga0436365_0726370 3300039437 Bacteria 591
343 Ga0436365_0727982 3300039437 Bacteria 501
344 Ga0436365_0992110 3300039437 Bacteria 1517
345 Ga0451789_0582913 3300041443 Bacteria 544
346 Ga0451791_1781082 3300041451 Bacteria 3237
347 Ga0451793_0143457 3300041452 Bacteria 2301
348 Ga0451797_1145139 3300041453 Bacteria 614
349 Ga0451795_1283102 3300041456 Bacteria 1518
350 Ga0451795_1327168 3300041456 Bacteria 510
351 Ga0451795_1572229 3300041456 Bacteria 1432
352 Ga0451800_0191401 3300041459 Bacteria 903
353 Ga0451800_0525012 3300041459 Bacteria 769
354 Ga0451802_0147241 3300041460 Bacteria 565
355 Ga0451802_0508877 3300041460 Bacteria 3507
356 Ga0451802_1420924 3300041460 Bacteria 762
357 Ga0451807_1052813 3300041486 Bacteria 503
358 Ga0451807_2721666 3300041486 Bacteria 660
359 Ga0451833_0533652 3300041491 Bacteria 811
360 Ga0451833_0744947 3300041491 Bacteria 878
361 Ga0451837_0102454 3300041494 Bacteria 542
362 Ga0451841_0445351 3300041498 Unclassified 1214
363 Ga0451841_1340308 3300041498 Bacteria 1106
364 Ga0451845_0002327 3300041501 Bacteria 652
365 Ga0451845_0966534 3300041501 Bacteria 548
366 Ga0451847_0503852 3300041503 Bacteria 957
367 Ga0451849_0761270 3300041505 Bacteria 564
368 Ga0451849_1441068 3300041505 Bacteria 757
369 Ga0451843_1414858 3300041509 Bacteria 608
370 Ga0451855_1607838 3300041511 Bacteria 591
371 Ga0451853_0253368 3300041512 Unclassified 655
372 Ga0451853_0565038 3300041512 Bacteria 701
373 Ga0451853_2545572 3300041512 Bacteria 1661
374 Ga0450908_000131 3300042184 Bacteria 15327
375 Ga0466959_0178947 3300045049 Bacteria 1484
376 Ga0451576_0113040 3300045051 Bacteria 2826
377 Ga0466967_0541146 3300045976 Bacteria 1146
378 Ga0495590_0050700 3300046457 Bacteria 1449
379 Ga0495638_0017835 3300046460 Bacteria 4725
380 Ga0495605_0001084 3300046474 Bacteria 18138
381 Ga0495584_0110584 3300046491 Bacteria 1390
382 Ga0495596_0000168 3300046500 Bacteria 45938
383 Ga0495607_0014649 3300046501 Bacteria 5098
384 Ga0495610_0000660 3300046512 Bacteria 33544
385 Ga0495616_0001950 3300046513 Bacteria 13878
386 Ga0495631_0051765 3300046518 Bacteria 1794
387 Ga0495648_0039048 3300046524 Bacteria 3026
388 Ga0495598_0003996 3300046537 Bacteria 3166
389 Ga0495609_0003113 3300046538 Bacteria 9707
390 Ga0495621_0137059 3300046539 Bacteria 955
391 Ga0495597_0065420 3300046542 Bacteria 1577
392 Ga0495656_0001146 3300046615 Bacteria 8596
393 Ga0495611_0013060 3300046648 Bacteria 3532
394 Ga0495659_0077777 3300046664 Bacteria 1254
395 Ga0495661_0120979 3300046665 Bacteria 1446
396 Ga0495657_0537173 3300046675 Bacteria 680
397 Ga0495671_0038473 3300046692 Bacteria 2418
398 Ga0495649_0023739 3300046694 Bacteria 3425
399 Ga0495589_0058010 3300046794 Bacteria 1904
400 Ga0495636_0113986 3300047318 Bacteria 1191
401 Ga0495672_0029733 3300047320 Bacteria 3436
402 Ga0495685_042142 3300047447 Bacteria 1558
403 Ga0495686_0098788 3300047472 Bacteria 1763
404 Ga0496102_1911156 3300048905 Bacteria 510
405 Ga0496103_0754028 3300048906 Bacteria 615
406 Ga0496104_1399625 3300048907 Bacteria 602
407 Ga0496106_1234497 3300048909 Bacteria 582
408 Ga0496107_1242694 3300048910 Bacteria 534
409 Ga0496108_0060450 3300048911 Bacteria 3188
410 Ga0496109_0063503 3300048912 Bacteria 3378
411 Ga0496109_0951886 3300048912 Bacteria 796
412 Ga0496111_0066086 3300048914 Bacteria 2625
413 Ga0496112_1006659 3300048915 Bacteria 753
414 Ga0496115_0000063 3300048918 Bacteria 100073
415 Ga0496116_0004502 3300048919 Bacteria 13267
416 Ga0496116_0006982 3300048919 Bacteria 10118
417 Ga0496117_0008293 3300048920 Bacteria 9887
418 Ga0496117_0272339 3300048920 Bacteria 911
419 Ga0496117_0346568 3300048920 Bacteria 769
420 Ga0496118_0000166 3300048921 Bacteria 119204
421 Ga0496118_0002462 3300048921 Bacteria 24896
422 Ga0496118_0034630 3300048921 Bacteria 4115
423 Ga0496118_0040893 3300048921 Bacteria 3678
424 Ga0496119_0487320 3300048922 Bacteria 575
425 Ga0496121_0044407 3300048924 Bacteria 3833
426 Ga0496121_0349785 3300048924 Bacteria 985
427 Ga0496122_0000852 3300048925 Bacteria 57400
428 Ga0496122_0001090 3300048925 Bacteria 47119
429 Ga0496122_0002722 3300048925 Bacteria 24525
430 Ga0496122_0377040 3300048925 Bacteria 729
431 Ga0496123_0000107 3300048926 Bacteria 166923
432 Ga0496123_0001286 3300048926 Bacteria 35803
433 Ga0496123_0001781 3300048926 Bacteria 28388
434 Ga0496123_0132132 3300048926 Bacteria 1380
435 Ga0496125_0116397 3300048928 Bacteria 1920
436 Ga0496125_0443651 3300048928 Bacteria 745
437 Ga0496126_0001050 3300048929 Bacteria 46705
438 Ga0496126_0011579 3300048929 Bacteria 9106
439 Ga0496126_0230897 3300048929 Bacteria 1550
440 Ga0496126_0660530 3300048929 Bacteria 817
441 Ga0496126_0876496 3300048929 Bacteria 682
442 Ga0501031_0000500 3300049568 Bacteria 22913
443 Ga0501031_0097010 3300049568 Bacteria 1924
444 Ga0501032_0001022 3300049569 Bacteria 22469
445 Ga0501032_0193218 3300049569 Bacteria 1330
446 Ga0501032_0577171 3300049569 Bacteria 716
447 Ga0501033_0130665 3300049570 Bacteria 1819
448 Ga0501033_0294553 3300049570 Bacteria 1143
449 Ga0501033_0362032 3300049570 Bacteria 1015
450 Ga0501034_0002785 3300049571 Bacteria 20482
451 Ga0501034_0142118 3300049571 Bacteria 2379
452 Ga0501036_0023183 3300049572 Bacteria 5226
453 Ga0501037_0000464 3300049573 Bacteria 33005
454 Ga0501037_0708539 3300049573 Bacteria 669
455 Ga0501038_0001196 3300049574 Bacteria 23593
456 Ga0501038_0054328 3300049574 Bacteria 3445
457 Ga0501039_0015694 3300049575 Bacteria 5794
458 Ga0501039_0314902 3300049575 Bacteria 1230
459 Ga0501043_0047276 3300049579 Bacteria 3383
460 Ga0501043_0065925 3300049579 Bacteria 2843
461 Ga0501046_0001769 3300049580 Bacteria 20634
462 Ga0501047_0018037 3300049581 Bacteria 6764
463 Ga0501047_0023810 3300049581 Bacteria 5879
464 Ga0501048_0015054 3300049582 Bacteria 5718
465 Ga0501067_0358810 3300049583 Bacteria 813
466 Ga0501067_0510385 3300049583 Bacteria 673
467 Ga0501068_0573522 3300049584 Bacteria 734
468 Ga0501069_0115614 3300049585 Bacteria 1530
469 Ga0501070_0008020 3300049586 Bacteria 8942
470 Ga0501070_0034560 3300049586 Bacteria 4226
471 Ga0501070_1089761 3300049586 Bacteria 616
472 Ga0501072_0016805 3300049588 Bacteria 5620
473 Ga0501073_0022243 3300049589 Bacteria 4568
474 Ga0501073_0027275 3300049589 Bacteria 4086
475 Ga0501074_0067892 3300049590 Bacteria 2563
476 Ga0501079_0640176 3300049741 Bacteria 837
477 Ga0501080_0019165 3300049742 Bacteria 6336
478 Ga0501080_0028127 3300049742 Bacteria 5227
479 Ga0501080_0612241 3300049742 Bacteria 966
480 Ga0501083_0075973 3300049744 Bacteria 2230
481 Ga0501035_0001719 3300049822 Bacteria 22121
482 Ga0501035_0310240 3300049822 Bacteria 1327
483 Ga0501035_0319164 3300049822 Bacteria 1305
484 Ga0501035_0366573 3300049822 Bacteria 1203
485 Ga0501044_0051890 3300049823 Bacteria 4228
486 Ga0501044_0067009 3300049823 Bacteria 3658
487 Ga0501044_0441581 3300049823 Bacteria 1209
488 Ga0501044_0463352 3300049823 Bacteria 1172
489 nmdc:mga05p37_43643_c1 3300050507 Bacteria 5516
490 Ga0500610_0000208 3300053079 Bacteria 18047
491 Ga0500643_002262 3300053087 Bacteria 10119
492 Ga0500651_0083859 3300053093 Bacteria 1971
493 Ga0500597_000187 3300053120 Bacteria 12754
494 Ga0500638_116005 3300053162 Bacteria 1231
495 Ga0501084_0334928 3300054114 Bacteria 1278
496 Ga0501082_1408028 3300060353 Bacteria 609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10582920 Ga0070658_105829202 100
2 3300005328 Ga0070676_11340555 Ga0070676_113405551 100
3 3300005334 Ga0068869_100320536 Ga0068869_1003205362 100
4 3300005335 Ga0070666_10034396 Ga0070666_100343963 100
5 3300005344 Ga0070661_100456541 Ga0070661_1004565412 100
6 3300005344 Ga0070661_100586358 Ga0070661_1005863582 100
7 3300005344 Ga0070661_100677892 Ga0070661_1006778922 100
8 3300005364 Ga0070673_100400135 Ga0070673_1004001352 100
9 3300005367 Ga0070667_100000516 Ga0070667_10000051629 100
10 3300005367 Ga0070667_100032759 Ga0070667_1000327593 100
11 3300005367 Ga0070667_100220782 Ga0070667_1002207822 100
12 3300005367 Ga0070667_102336542 Ga0070667_1023365421 100
13 3300005439 Ga0070711_100645268 Ga0070711_1006452682 100
14 3300005455 Ga0070663_100000179 Ga0070663_1000001795 100
15 3300005455 Ga0070663_100055161 Ga0070663_1000551614 100
16 3300005455 Ga0070663_100595931 Ga0070663_1005959312 100
17 3300005457 Ga0070662_100216066 Ga0070662_1002160661 100
18 3300005457 Ga0070662_101064418 Ga0070662_1010644181 100
19 3300005539 Ga0068853_100000506 Ga0068853_1000005063 100
20 3300005539 Ga0068853_100007343 Ga0068853_1000073438 100
21 3300005539 Ga0068853_100010746 Ga0068853_1000107466 100
22 3300005539 Ga0068853_100056315 Ga0068853_1000563152 100
23 3300005548 Ga0070665_100063827 Ga0070665_1000638274 100
24 3300005548 Ga0070665_100298778 Ga0070665_1002987783 100
25 3300005563 Ga0068855_100006601 Ga0068855_1000066015 100
26 3300005563 Ga0068855_100811818 Ga0068855_1008118182 100
27 3300005564 Ga0070664_100522251 Ga0070664_1005222512 100
28 3300005577 Ga0068857_100163046 Ga0068857_1001630461 100
29 3300005577 Ga0068857_100268549 Ga0068857_1002685492 100
30 3300005578 Ga0068854_101073993 Ga0068854_1010739932 100
31 3300005617 Ga0068859_100000087 Ga0068859_10000008750 100
32 3300005617 Ga0068859_101187564 Ga0068859_1011875642 100
33 3300005617 Ga0068859_102368934 Ga0068859_1023689342 100
34 3300005618 Ga0068864_100072090 Ga0068864_1000720903 100
35 3300005834 Ga0068851_10189835 Ga0068851_101898352 100
36 3300005841 Ga0068863_100010432 Ga0068863_1000104323 100
37 3300005841 Ga0068863_100029037 Ga0068863_1000290377 100
38 3300005842 Ga0068858_101721780 Ga0068858_1017217801 100
39 3300005843 Ga0068860_100066197 Ga0068860_1000661972 100
40 3300005843 Ga0068860_100145145 Ga0068860_1001451453 100
41 3300005843 Ga0068860_100611184 Ga0068860_1006111842 100
42 3300005844 Ga0068862_100000047 Ga0068862_10000004785 100
43 3300005844 Ga0068862_100476502 Ga0068862_1004765022 100
44 3300005985 Ga0081539_10076721 Ga0081539_100767211 100
45 3300006178 Ga0075367_10999020 Ga0075367_109990202 100
46 3300006931 Ga0097620_100000087 Ga0097620_10000008750 100
47 3300006931 Ga0097620_101187570 Ga0097620_1011875702 100
48 3300006931 Ga0097620_102369128 Ga0097620_1023691281 100
49 3300009093 Ga0105240_10152160 Ga0105240_101521602 100
50 3300009101 Ga0105247_10104147 Ga0105247_101041472 100
51 3300009177 Ga0105248_10001744 Ga0105248_1000174414 100
52 3300009177 Ga0105248_10578864 Ga0105248_105788642 100
53 3300009545 Ga0105237_10001431 Ga0105237_1000143126 100
54 3300009545 Ga0105237_10108768 Ga0105237_101087683 100
55 3300009545 Ga0105237_10490407 Ga0105237_104904072 100
56 3300009553 Ga0105249_10439577 Ga0105249_104395772 100
57 3300010375 Ga0105239_10003013 Ga0105239_100030134 100
58 3300010375 Ga0105239_10025713 Ga0105239_100257132 100
59 3300010375 Ga0105239_10032893 Ga0105239_100328931 100
60 3300012478 Ga0157328_1006393 Ga0157328_10063932 100
61 3300012482 Ga0157318_1015197 Ga0157318_10151972 100
62 3300012495 Ga0157323_1000845 Ga0157323_10008453 100
63 3300012500 Ga0157314_1012596 Ga0157314_10125962 100
64 3300012513 Ga0157326_1072693 Ga0157326_10726932 100
65 3300013104 Ga0157370_11144755 Ga0157370_111447552 100
66 3300013306 Ga0163162_10375239 Ga0163162_103752392 100
67 3300015265 Ga0182005_1003337 Ga0182005_10033372 100
68 3300021384 Ga0213876_10497771 Ga0213876_104977712 100
69 3300025297 Ga0209758_1000013 Ga0209758_1000013238 100
70 3300025303 Ga0209051_1162052 Ga0209051_11620522 100
71 3300025728 Ga0207655_1181731 Ga0207655_11817311 100
72 3300025898 Ga0207692_10165397 Ga0207692_101653973 100
73 3300025900 Ga0207710_10650608 Ga0207710_106506081 100
74 3300025903 Ga0207680_10022918 Ga0207680_100229183 100
75 3300025914 Ga0207671_10043985 Ga0207671_100439853 100
76 3300025914 Ga0207671_10408481 Ga0207671_104084812 100
77 3300025916 Ga0207663_10209054 Ga0207663_102090542 100
78 3300025920 Ga0207649_10214626 Ga0207649_102146262 100
79 3300025925 Ga0207650_10336945 Ga0207650_103369452 100
80 3300025927 Ga0207687_11291344 Ga0207687_112913442 100
81 3300025933 Ga0207706_10513336 Ga0207706_105133362 100
82 3300025935 Ga0207709_10000853 Ga0207709_100008537 100
83 3300025935 Ga0207709_10042229 Ga0207709_100422294 100
84 3300025941 Ga0207711_10003349 Ga0207711_100033493 100
85 3300025945 Ga0207679_11157384 Ga0207679_111573841 100
86 3300025949 Ga0207667_10029957 Ga0207667_100299574 100
87 3300025949 Ga0207667_10035375 Ga0207667_100353759 100
88 3300025960 Ga0207651_10082381 Ga0207651_100823812 100
89 3300025961 Ga0207712_10107530 Ga0207712_101075301 100
90 3300025972 Ga0207668_10073147 Ga0207668_100731473 100
91 3300025986 Ga0207658_10000027 Ga0207658_100000274 100
92 3300025986 Ga0207658_10017200 Ga0207658_100172003 100
93 3300025986 Ga0207658_10354676 Ga0207658_103546762 100
94 3300026041 Ga0207639_10000494 Ga0207639_1000049414 100
95 3300026041 Ga0207639_10000544 Ga0207639_1000054413 100
96 3300026041 Ga0207639_10008455 Ga0207639_100084557 100
97 3300026067 Ga0207678_10000703 Ga0207678_1000070324 100
98 3300026067 Ga0207678_10200230 Ga0207678_102002302 100
99 3300026067 Ga0207678_10601121 Ga0207678_106011212 100
100 3300026067 Ga0207678_10633523 Ga0207678_106335232 100
101 3300026078 Ga0207702_11856555 Ga0207702_118565551 100
102 3300026088 Ga0207641_10034712 Ga0207641_100347127 100
103 3300026088 Ga0207641_10350557 Ga0207641_103505572 100
104 3300026088 Ga0207641_10625951 Ga0207641_106259512 100
105 3300026095 Ga0207676_10300646 Ga0207676_103006462 100
106 3300026116 Ga0207674_10117996 Ga0207674_101179962 100
107 3300026116 Ga0207674_10482710 Ga0207674_104827102 100
108 3300026118 Ga0207675_101773844 Ga0207675_1017738442 100
109 3300026142 Ga0207698_10457090 Ga0207698_104570902 100
110 3300027312 Ga0209371_1000011 Ga0209371_1000011684 100
111 3300028379 Ga0268266_10022244 Ga0268266_100222444 100
112 3300028379 Ga0268266_10115605 Ga0268266_101156051 100
113 3300028379 Ga0268266_10309868 Ga0268266_103098682 100
114 3300028380 Ga0268265_10000852 Ga0268265_1000085222 100
115 3300028380 Ga0268265_10393162 Ga0268265_103931621 100
116 3300028381 Ga0268264_10861442 Ga0268264_108614422 100
117 3300028381 Ga0268264_11445241 Ga0268264_114452412 100
118 3300030500 Ga0268256_1000011 Ga0268256_1000011684 100
119 3300031456 Ga0307513_10154637 Ga0307513_101546372 100
120 3300031824 Ga0307413_10878186 Ga0307413_108781862 100
121 3300031995 Ga0307409_100355550 Ga0307409_1003555501 100
122 3300032004 Ga0307414_11025770 Ga0307414_110257702 100
123 3300039437 Ga0436365_0992110 Ga0436365_0992110_614_916 100
124 3300041443 Ga0451789_0582913 Ga0451789_0582913_221_523 100
125 3300041451 Ga0451791_1781082 Ga0451791_1781082_1819_2121 100
126 3300041452 Ga0451793_0143457 Ga0451793_0143457_281_583 100
127 3300041453 Ga0451797_1145139 Ga0451797_1145139_298_600 100
128 3300041456 Ga0451795_1283102 Ga0451795_1283102_595_897 100
129 3300041456 Ga0451795_1327168 Ga0451795_1327168_147_449 100
130 3300041456 Ga0451795_1572229 Ga0451795_1572229_996_1298 100
131 3300041459 Ga0451800_0191401 Ga0451800_0191401_57_359 100
132 3300041459 Ga0451800_0525012 Ga0451800_0525012_139_441 100
133 3300041460 Ga0451802_0147241 Ga0451802_0147241_22_324 100
134 3300041460 Ga0451802_0508877 Ga0451802_0508877_2059_2361 100
135 3300041460 Ga0451802_1420924 Ga0451802_1420924_279_581 100
136 3300041486 Ga0451807_1052813 Ga0451807_1052813_86_388 100
137 3300041486 Ga0451807_2721666 Ga0451807_2721666_329_631 100
138 3300041491 Ga0451833_0533652 Ga0451833_0533652_198_500 100
139 3300041491 Ga0451833_0744947 Ga0451833_0744947_302_604 100
140 3300041494 Ga0451837_0102454 Ga0451837_0102454_140_442 100
141 3300041498 Ga0451841_0445351 Ga0451841_0445351_204_506 100
142 3300041498 Ga0451841_1340308 Ga0451841_1340308_298_600 100
143 3300041501 Ga0451845_0002327 Ga0451845_0002327_199_501 100
144 3300041501 Ga0451845_0966534 Ga0451845_0966534_56_358 100
145 3300041503 Ga0451847_0503852 Ga0451847_0503852_49_351 100
146 3300041505 Ga0451849_0761270 Ga0451849_0761270_139_441 100
147 3300041505 Ga0451849_1441068 Ga0451849_1441068_179_481 100
148 3300041509 Ga0451843_1414858 Ga0451843_1414858_115_417 100
149 3300041511 Ga0451855_1607838 Ga0451855_1607838_235_537 100
150 3300041512 Ga0451853_0253368 Ga0451853_0253368_27_329 100
151 3300041512 Ga0451853_0565038 Ga0451853_0565038_234_536 100
152 3300041512 Ga0451853_2545572 Ga0451853_2545572_605_907 100
153 3300042184 Ga0450908_000131 Ga0450908_000131_5150_5452 100
154 3300045049 Ga0466959_0178947 Ga0466959_0178947_750_1052 100
155 3300046460 Ga0495638_0017835 Ga0495638_0017835_4062_4364 100
156 3300046615 Ga0495656_0001146 Ga0495656_0001146_4271_4573 100
157 3300047318 Ga0495636_0113986 Ga0495636_0113986_825_1127 100
158 3300047472 Ga0495686_0098788 Ga0495686_0098788_735_1037 100
159 3300048909 Ga0496106_1234497 Ga0496106_1234497_19_321 100
160 3300048910 Ga0496107_1242694 Ga0496107_1242694_216_518 100
161 3300048911 Ga0496108_0060450 Ga0496108_0060450_1771_2073 100
162 3300048912 Ga0496109_0063503 Ga0496109_0063503_1501_1803 100
163 3300048912 Ga0496109_0951886 Ga0496109_0951886_482_784 100
164 3300048914 Ga0496111_0066086 Ga0496111_0066086_1429_1731 100
165 3300048915 Ga0496112_1006659 Ga0496112_1006659_155_457 100
166 3300048920 Ga0496117_0008293 Ga0496117_0008293_939_1241 100
167 3300048920 Ga0496117_0272339 Ga0496117_0272339_261_563 100
168 3300048920 Ga0496117_0346568 Ga0496117_0346568_120_422 100
169 3300048921 Ga0496118_0000166 Ga0496118_0000166_77039_77341 100
170 3300048921 Ga0496118_0002462 Ga0496118_0002462_24377_24679 100
171 3300048921 Ga0496118_0034630 Ga0496118_0034630_3458_3760 100
172 3300048924 Ga0496121_0349785 Ga0496121_0349785_636_938 100
173 3300048925 Ga0496122_0000852 Ga0496122_0000852_27765_28067 100
174 3300048925 Ga0496122_0002722 Ga0496122_0002722_12989_13291 100
175 3300048926 Ga0496123_0000107 Ga0496123_0000107_21220_21522 100
176 3300048926 Ga0496123_0001781 Ga0496123_0001781_16804_17106 100
177 3300048929 Ga0496126_0011579 Ga0496126_0011579_8122_8424 100
178 3300048929 Ga0496126_0230897 Ga0496126_0230897_989_1291 100
179 3300048929 Ga0496126_0660530 Ga0496126_0660530_21_323 100
180 3300049568 Ga0501031_0000500 Ga0501031_0000500_16557_16859 100
181 3300049568 Ga0501031_0097010 Ga0501031_0097010_852_1154 100
182 3300049569 Ga0501032_0001022 Ga0501032_0001022_16553_16855 100
183 3300049569 Ga0501032_0193218 Ga0501032_0193218_459_761 100
184 3300049570 Ga0501033_0130665 Ga0501033_0130665_1137_1439 100
185 3300049570 Ga0501033_0294553 Ga0501033_0294553_788_1090 100
186 3300049571 Ga0501034_0002785 Ga0501034_0002785_6447_6749 100
187 3300049571 Ga0501034_0142118 Ga0501034_0142118_2028_2330 100
188 3300049572 Ga0501036_0023183 Ga0501036_0023183_4833_5135 100
189 3300049573 Ga0501037_0000464 Ga0501037_0000464_15728_16030 100
190 3300049573 Ga0501037_0708539 Ga0501037_0708539_312_614 100
191 3300049574 Ga0501038_0001196 Ga0501038_0001196_17899_18201 100
192 3300049574 Ga0501038_0054328 Ga0501038_0054328_1189_1491 100
193 3300049575 Ga0501039_0015694 Ga0501039_0015694_915_1217 100
194 3300049575 Ga0501039_0314902 Ga0501039_0314902_603_905 100
195 3300049579 Ga0501043_0047276 Ga0501043_0047276_53_355 100
196 3300049579 Ga0501043_0065925 Ga0501043_0065925_129_431 100
197 3300049580 Ga0501046_0001769 Ga0501046_0001769_3359_3661 100
198 3300049581 Ga0501047_0018037 Ga0501047_0018037_2235_2537 100
199 3300049581 Ga0501047_0023810 Ga0501047_0023810_3648_3950 100
200 3300049582 Ga0501048_0015054 Ga0501048_0015054_3238_3540 100
201 3300049583 Ga0501067_0358810 Ga0501067_0358810_497_799 100
202 3300049583 Ga0501067_0510385 Ga0501067_0510385_237_539 100
203 3300049584 Ga0501068_0573522 Ga0501068_0573522_88_390 100
204 3300049585 Ga0501069_0115614 Ga0501069_0115614_1183_1485 100
205 3300049586 Ga0501070_0008020 Ga0501070_0008020_1804_2106 100
206 3300049586 Ga0501070_0034560 Ga0501070_0034560_1299_1601 100
207 3300049588 Ga0501072_0016805 Ga0501072_0016805_3698_4000 100
208 3300049589 Ga0501073_0022243 Ga0501073_0022243_3175_3477 100
209 3300049589 Ga0501073_0027275 Ga0501073_0027275_1749_2051 100
210 3300049590 Ga0501074_0067892 Ga0501074_0067892_1934_2236 100
211 3300049741 Ga0501079_0640176 Ga0501079_0640176_135_437 100
212 3300049742 Ga0501080_0019165 Ga0501080_0019165_2712_3014 100
213 3300049742 Ga0501080_0028127 Ga0501080_0028127_2183_2485 100
214 3300049742 Ga0501080_0612241 Ga0501080_0612241_397_699 100
215 3300049744 Ga0501083_0075973 Ga0501083_0075973_1630_1932 100
216 3300049822 Ga0501035_0001719 Ga0501035_0001719_6056_6358 100
217 3300049822 Ga0501035_0310240 Ga0501035_0310240_89_391 100
218 3300049822 Ga0501035_0366573 Ga0501035_0366573_597_899 100
219 3300049823 Ga0501044_0067009 Ga0501044_0067009_2569_2871 100
220 3300049823 Ga0501044_0441581 Ga0501044_0441581_269_571 100
221 3300053079 Ga0500610_0000208 Ga0500610_0000208_16445_16747 100
222 3300053087 Ga0500643_002262 Ga0500643_002262_9589_9891 100
223 3300053093 Ga0500651_0083859 Ga0500651_0083859_1172_1474 100
224 3300053120 Ga0500597_000187 Ga0500597_000187_11313_11615 100
225 3300054114 Ga0501084_0334928 Ga0501084_0334928_646_948 100
226 3300060353 Ga0501082_1408028 Ga0501082_1408028_112_414 100
227 3300005327 Ga0070658_11316367 Ga0070658_113163671 101
228 3300005331 Ga0070670_100218767 Ga0070670_1002187672 101
229 3300005331 Ga0070670_100733661 Ga0070670_1007336611 101
230 3300005333 Ga0070677_10395154 Ga0070677_103951541 101
231 3300005335 Ga0070666_10565176 Ga0070666_105651762 101
232 3300005336 Ga0070680_100739581 Ga0070680_1007395812 101
233 3300005336 Ga0070680_101047392 Ga0070680_1010473922 101
234 3300005338 Ga0068868_100983497 Ga0068868_1009834971 101
235 3300005339 Ga0070660_100073615 Ga0070660_1000736154 101
236 3300005344 Ga0070661_100006257 Ga0070661_1000062575 101
237 3300005344 Ga0070661_100272195 Ga0070661_1002721952 101
238 3300005353 Ga0070669_100402576 Ga0070669_1004025761 101
239 3300005354 Ga0070675_101504336 Ga0070675_1015043361 101
240 3300005355 Ga0070671_101524767 Ga0070671_1015247671 101
241 3300005365 Ga0070688_100617160 Ga0070688_1006171601 101
242 3300005456 Ga0070678_100052016 Ga0070678_1000520165 101
243 3300005456 Ga0070678_100386890 Ga0070678_1003868902 101
244 3300005457 Ga0070662_101128752 Ga0070662_1011287521 101
245 3300005459 Ga0068867_100157126 Ga0068867_1001571262 101
246 3300005530 Ga0070679_100062627 Ga0070679_1000626275 101
247 3300005530 Ga0070679_100090890 Ga0070679_1000908902 101
248 3300005539 Ga0068853_100008246 Ga0068853_1000082469 101
249 3300005539 Ga0068853_100717046 Ga0068853_1007170462 101
250 3300005543 Ga0070672_100022530 Ga0070672_1000225304 101
251 3300005546 Ga0070696_100045761 Ga0070696_1000457613 101
252 3300005563 Ga0068855_100006516 Ga0068855_10000651610 101
253 3300005563 Ga0068855_102043791 Ga0068855_1020437911 101
254 3300005614 Ga0068856_100229162 Ga0068856_1002291622 101
255 3300005616 Ga0068852_100004511 Ga0068852_10000451110 101
256 3300005616 Ga0068852_100263057 Ga0068852_1002630573 101
257 3300005616 Ga0068852_100983537 Ga0068852_1009835372 101
258 3300005616 Ga0068852_101002188 Ga0068852_1010021882 101
259 3300005617 Ga0068859_100242416 Ga0068859_1002424162 101
260 3300005618 Ga0068864_100018280 Ga0068864_1000182805 101
261 3300005618 Ga0068864_100378530 Ga0068864_1003785302 101
262 3300005618 Ga0068864_102445544 Ga0068864_1024455442 101
263 3300005834 Ga0068851_10292434 Ga0068851_102924342 101
264 3300005841 Ga0068863_100005329 Ga0068863_10000532911 101
265 3300005841 Ga0068863_100013890 Ga0068863_1000138905 101
266 3300005841 Ga0068863_100644238 Ga0068863_1006442382 101
267 3300005842 Ga0068858_100085922 Ga0068858_1000859225 101
268 3300005843 Ga0068860_100199723 Ga0068860_1001997233 101
269 3300005843 Ga0068860_102343142 Ga0068860_1023431421 101
270 3300005844 Ga0068862_100708450 Ga0068862_1007084502 101
271 3300006237 Ga0097621_100057412 Ga0097621_1000574124 101
272 3300006237 Ga0097621_100062985 Ga0097621_1000629852 101
273 3300006237 Ga0097621_100265332 Ga0097621_1002653323 101
274 3300006358 Ga0068871_100078166 Ga0068871_1000781661 101
275 3300006358 Ga0068871_100099239 Ga0068871_1000992393 101
276 3300006931 Ga0097620_100242419 Ga0097620_1002424192 101
277 3300007265 Ga0099794_10028367 Ga0099794_100283674 101
278 3300009093 Ga0105240_11373228 Ga0105240_113732282 101
279 3300009098 Ga0105245_10691817 Ga0105245_106918173 101
280 3300009098 Ga0105245_11846962 Ga0105245_118469622 101
281 3300009147 Ga0114129_10013048 Ga0114129_100130483 101
282 3300009174 Ga0105241_10033654 Ga0105241_100336542 101
283 3300009174 Ga0105241_10087935 Ga0105241_100879353 101
284 3300009174 Ga0105241_10334483 Ga0105241_103344832 101
285 3300009176 Ga0105242_10073946 Ga0105242_100739463 101
286 3300009176 Ga0105242_10097735 Ga0105242_100977352 101
287 3300009177 Ga0105248_10111494 Ga0105248_101114946 101
288 3300009177 Ga0105248_10571037 Ga0105248_105710372 101
289 3300009177 Ga0105248_10659355 Ga0105248_106593552 101
290 3300009545 Ga0105237_10003624 Ga0105237_1000362410 101
291 3300009551 Ga0105238_10016479 Ga0105238_100164799 101
292 3300009551 Ga0105238_10045612 Ga0105238_100456122 101
293 3300009553 Ga0105249_10844425 Ga0105249_108444253 101
294 3300010375 Ga0105239_10022844 Ga0105239_100228446 101
295 3300010375 Ga0105239_10139953 Ga0105239_101399532 101
296 3300010375 Ga0105239_11627632 Ga0105239_116276322 101
297 3300011119 Ga0105246_10012861 Ga0105246_100128614 101
298 3300013100 Ga0157373_10473549 Ga0157373_104735492 101
299 3300013104 Ga0157370_10012698 Ga0157370_100126989 101
300 3300013104 Ga0157370_10107924 Ga0157370_101079243 101
301 3300013105 Ga0157369_10009281 Ga0157369_100092816 101
302 3300013296 Ga0157374_10107154 Ga0157374_101071542 101
303 3300013296 Ga0157374_10140456 Ga0157374_101404562 101
304 3300013297 Ga0157378_11092207 Ga0157378_110922072 101
305 3300013306 Ga0163162_10050185 Ga0163162_100501852 101
306 3300013306 Ga0163162_11405898 Ga0163162_114058981 101
307 3300013307 Ga0157372_10003965 Ga0157372_100039659 101
308 3300013307 Ga0157372_11931594 Ga0157372_119315942 101
309 3300013308 Ga0157375_10098867 Ga0157375_100988672 101
310 3300014325 Ga0163163_10010667 Ga0163163_1001066710 101
311 3300014325 Ga0163163_11275529 Ga0163163_112755292 101
312 3300014326 Ga0157380_11988351 Ga0157380_119883512 101
313 3300014968 Ga0157379_10003264 Ga0157379_100032648 101
314 3300014969 Ga0157376_10004728 Ga0157376_100047287 101
315 3300014969 Ga0157376_10015834 Ga0157376_100158343 101
316 3300014969 Ga0157376_10316081 Ga0157376_103160812 101
317 3300014969 Ga0157376_10316437 Ga0157376_103164372 101
318 3300017792 Ga0163161_10239814 Ga0163161_102398142 101
319 3300025909 Ga0207705_11231386 Ga0207705_112313861 101
320 3300025911 Ga0207654_10159794 Ga0207654_101597942 101
321 3300025912 Ga0207707_10820971 Ga0207707_108209711 101
322 3300025913 Ga0207695_10000359 Ga0207695_1000035943 101
323 3300025914 Ga0207671_10004912 Ga0207671_100049129 101
324 3300025917 Ga0207660_10709531 Ga0207660_107095312 101
325 3300025919 Ga0207657_10023031 Ga0207657_100230318 101
326 3300025920 Ga0207649_10001229 Ga0207649_1000122913 101
327 3300025920 Ga0207649_10604941 Ga0207649_106049412 101
328 3300025921 Ga0207652_10928795 Ga0207652_109287952 101
329 3300025921 Ga0207652_11676418 Ga0207652_116764181 101
330 3300025924 Ga0207694_10087564 Ga0207694_100875642 101
331 3300025924 Ga0207694_10126682 Ga0207694_101266822 101
332 3300025925 Ga0207650_10174291 Ga0207650_101742912 101
333 3300025927 Ga0207687_10442058 Ga0207687_104420583 101
334 3300025931 Ga0207644_10253264 Ga0207644_102532643 101
335 3300025933 Ga0207706_10716988 Ga0207706_107169882 101
336 3300025934 Ga0207686_10059782 Ga0207686_100597822 101
337 3300025934 Ga0207686_10387423 Ga0207686_103874232 101
338 3300025940 Ga0207691_10004898 Ga0207691_100048989 101
339 3300025941 Ga0207711_10236023 Ga0207711_102360233 101
340 3300025941 Ga0207711_10391725 Ga0207711_103917251 101
341 3300025944 Ga0207661_10640220 Ga0207661_106402202 101
342 3300025945 Ga0207679_10714471 Ga0207679_107144712 101
343 3300025949 Ga0207667_10023219 Ga0207667_100232199 101
344 3300025972 Ga0207668_11450835 Ga0207668_114508351 101
345 3300026035 Ga0207703_10050324 Ga0207703_100503242 101
346 3300026041 Ga0207639_10004534 Ga0207639_1000453410 101
347 3300026041 Ga0207639_10579017 Ga0207639_105790172 101
348 3300026078 Ga0207702_10595680 Ga0207702_105956802 101
349 3300026088 Ga0207641_10019305 Ga0207641_100193052 101
350 3300026088 Ga0207641_10030355 Ga0207641_100303554 101
351 3300026088 Ga0207641_10861258 Ga0207641_108612582 101
352 3300026089 Ga0207648_10147368 Ga0207648_101473682 101
353 3300026095 Ga0207676_10023790 Ga0207676_100237905 101
354 3300026095 Ga0207676_11392001 Ga0207676_113920011 101
355 3300026121 Ga0207683_10086273 Ga0207683_100862732 101
356 3300026121 Ga0207683_10399057 Ga0207683_103990572 101
357 3300026121 Ga0207683_11593454 Ga0207683_115934542 101
358 3300026142 Ga0207698_10837317 Ga0207698_108373172 101
359 3300027395 Ga0209996_1071626 Ga0209996_10716261 101
360 3300027671 Ga0209588_1099892 Ga0209588_10998922 101
361 3300028380 Ga0268265_11105738 Ga0268265_111057382 101
362 3300028381 Ga0268264_10046430 Ga0268264_100464305 101
363 3300028381 Ga0268264_10409180 Ga0268264_104091802 101
364 3300028381 Ga0268264_11956600 Ga0268264_119566002 101
365 3300030521 Ga0307511_10249225 Ga0307511_102492252 101
366 3300037471 Ga0395905_1365931 Ga0395905_1365931_13_318 101
367 3300039437 Ga0436365_0726370 Ga0436365_0726370_235_540 101
368 3300039437 Ga0436365_0727982 Ga0436365_0727982_145_450 101
369 3300045976 Ga0466967_0541146 Ga0466967_0541146_362_667 101
370 3300046537 Ga0495598_0003996 Ga0495598_0003996_2277_2582 101
371 3300046539 Ga0495621_0137059 Ga0495621_0137059_205_510 101
372 3300046664 Ga0495659_0077777 Ga0495659_0077777_413_718 101
373 3300046675 Ga0495657_0537173 Ga0495657_0537173_108_413 101
374 3300048918 Ga0496115_0000063 Ga0496115_0000063_56705_57010 101
375 3300048921 Ga0496118_0040893 Ga0496118_0040893_472_777 101
376 3300048929 Ga0496126_0001050 Ga0496126_0001050_17246_17551 101
377 3300050507 nmdc:mga05p37_43643_c1 nmdc:mga05p37_43643_c1_1981_2286 101
378 iso_pu_bacteria 2858688981 2858695053 101
379 3300003322 rootL2_10053478 rootL2_100534782 102
380 3300003323 rootH1_10079071 rootH1_100790712 102
381 3300005337 Ga0070682_100205233 Ga0070682_1002052332 102
382 3300009148 Ga0105243_10013440 Ga0105243_100134404 102
383 3300012510 Ga0157316_1017140 Ga0157316_10171402 102
384 3300013100 Ga0157373_10019061 Ga0157373_100190615 102
385 3300015261 Ga0182006_1133978 Ga0182006_11339782 102
386 3300031852 Ga0307410_10531945 Ga0307410_105319451 102
387 3300048907 Ga0496104_1399625 Ga0496104_1399625_201_509 102
388 3300048922 Ga0496119_0487320 Ga0496119_0487320_116_424 102
389 3300048925 Ga0496122_0377040 Ga0496122_0377040_285_593 102
390 3300048926 Ga0496123_0132132 Ga0496123_0132132_795_1103 102
391 3300048928 Ga0496125_0443651 Ga0496125_0443651_124_432 102
392 3300048929 Ga0496126_0876496 Ga0496126_0876496_265_573 102
393 3300049570 Ga0501033_0362032 Ga0501033_0362032_530_838 102
394 3300049586 Ga0501070_1089761 Ga0501070_1089761_177_485 102
395 3300049822 Ga0501035_0319164 Ga0501035_0319164_613_921 102
396 3300049823 Ga0501044_0463352 Ga0501044_0463352_283_591 102
397 3300031852 Ga0307410_10458709 Ga0307410_104587092 103
398 3300032005 Ga0307411_10258388 Ga0307411_102583882 103
399 3300045051 Ga0451576_0113040 Ga0451576_0113040_172_486 104
400 3300003187 JGI25151J46595_10001053 JGI25151J46595_1000105315 105
401 3300003771 Ga0055526_1006012 Ga0055526_10060126 105
402 3300003773 Ga0055537_1001508 Ga0055537_10015088 105
403 3300003775 Ga0055524_1000930 Ga0055524_100093010 105
404 3300003775 Ga0055524_1001625 Ga0055524_10016259 105
405 3300003784 Ga0055534_1000595 Ga0055534_10005958 105
406 3300003784 Ga0055534_1001047 Ga0055534_10010478 105
407 3300005327 Ga0070658_10136320 Ga0070658_101363202 105
408 3300005329 Ga0070683_100167420 Ga0070683_1001674204 105
409 3300005334 Ga0068869_100069735 Ga0068869_1000697353 105
410 3300005339 Ga0070660_100204198 Ga0070660_1002041982 105
411 3300005344 Ga0070661_100034467 Ga0070661_1000344675 105
412 3300005366 Ga0070659_100098041 Ga0070659_1000980412 105
413 3300005367 Ga0070667_101249229 Ga0070667_1012492292 105
414 3300005455 Ga0070663_101712705 Ga0070663_1017127051 105
415 3300005535 Ga0070684_100069436 Ga0070684_1000694365 105
416 3300005539 Ga0068853_100063712 Ga0068853_1000637125 105
417 3300005547 Ga0070693_100676092 Ga0070693_1006760922 105
418 3300005548 Ga0070665_100501687 Ga0070665_1005016872 105
419 3300005563 Ga0068855_102437801 Ga0068855_1024378012 105
420 3300005577 Ga0068857_100016475 Ga0068857_1000164753 105
421 3300005578 Ga0068854_100274505 Ga0068854_1002745052 105
422 3300005614 Ga0068856_100084806 Ga0068856_1000848065 105
423 3300005616 Ga0068852_100173489 Ga0068852_1001734895 105
424 3300005834 Ga0068851_10240466 Ga0068851_102404662 105
425 3300005844 Ga0068862_100452028 Ga0068862_1004520282 105
426 3300006948 Ga0099826_10000004 Ga0099826_10000004386 105
427 3300009174 Ga0105241_10093673 Ga0105241_100936732 105
428 3300009551 Ga0105238_10087157 Ga0105238_100871575 105
429 3300010375 Ga0105239_10462502 Ga0105239_104625022 105
430 3300011119 Ga0105246_10088199 Ga0105246_100881992 105
431 3300013100 Ga0157373_10045918 Ga0157373_100459182 105
432 3300013104 Ga0157370_10572813 Ga0157370_105728132 105
433 3300013105 Ga0157369_10033104 Ga0157369_100331045 105
434 3300013296 Ga0157374_11116765 Ga0157374_111167652 105
435 3300013306 Ga0163162_10044573 Ga0163162_100445732 105
436 3300025263 Ga0209565_1000147 Ga0209565_100014710 105
437 3300025291 Ga0209675_1000436 Ga0209675_100043618 105
438 3300025294 Ga0209025_1003128 Ga0209025_10031282 105
439 3300025295 Ga0209564_1000651 Ga0209564_100065110 105
440 3300025297 Ga0209758_1048408 Ga0209758_10484083 105
441 3300025299 Ga0209256_1000259 Ga0209256_100025910 105
442 3300025315 Ga0207697_10164886 Ga0207697_101648862 105
443 3300025321 Ga0207656_10016322 Ga0207656_100163222 105
444 3300025903 Ga0207680_10042371 Ga0207680_100423712 105
445 3300025904 Ga0207647_10009858 Ga0207647_100098583 105
446 3300025912 Ga0207707_10101165 Ga0207707_101011652 105
447 3300025919 Ga0207657_10023149 Ga0207657_100231495 105
448 3300025920 Ga0207649_10121292 Ga0207649_101212923 105
449 3300025932 Ga0207690_10143005 Ga0207690_101430054 105
450 3300025942 Ga0207689_10019026 Ga0207689_100190265 105
451 3300025944 Ga0207661_10164391 Ga0207661_101643912 105
452 3300025949 Ga0207667_10134967 Ga0207667_101349672 105
453 3300025961 Ga0207712_10417176 Ga0207712_104171762 105
454 3300025981 Ga0207640_10043967 Ga0207640_100439673 105
455 3300025986 Ga0207658_10259244 Ga0207658_102592442 105
456 3300026041 Ga0207639_10034585 Ga0207639_100345854 105
457 3300026041 Ga0207639_10348913 Ga0207639_103489132 105
458 3300026067 Ga0207678_10698098 Ga0207678_106980982 105
459 3300026116 Ga0207674_10006961 Ga0207674_100069615 105
460 3300027666 Ga0209282_1000027 Ga0209282_1000027102 105
461 3300028380 Ga0268265_10054499 Ga0268265_100544995 105
462 3300031665 Ga0316575_10004609 Ga0316575_100046094 105
463 3300031691 Ga0316579_10001664 Ga0316579_100016647 105
464 3300031728 Ga0316578_10008886 Ga0316578_100088864 105
465 3300032133 Ga0316583_10002154 Ga0316583_100021546 105
466 3300035398 Ga0316574_0678516 Ga0316574_0678516_25_342 105
467 3300036647 Ga0316582_0003077 Ga0316582_0003077_3121_3438 105
468 3300037588 Ga0316581_0002657 Ga0316581_0002657_2377_2694 105
469 3300046457 Ga0495590_0050700 Ga0495590_0050700_799_1131 105
470 3300046474 Ga0495605_0001084 Ga0495605_0001084_3572_3904 105
471 3300046491 Ga0495584_0110584 Ga0495584_0110584_930_1262 105
472 3300046500 Ga0495596_0000168 Ga0495596_0000168_34257_34589 105
473 3300046501 Ga0495607_0014649 Ga0495607_0014649_1213_1545 105
474 3300046512 Ga0495610_0000660 Ga0495610_0000660_21706_22038 105
475 3300046513 Ga0495616_0001950 Ga0495616_0001950_1106_1438 105
476 3300046518 Ga0495631_0051765 Ga0495631_0051765_1113_1445 105
477 3300046524 Ga0495648_0039048 Ga0495648_0039048_1163_1495 105
478 3300046538 Ga0495609_0003113 Ga0495609_0003113_1165_1497 105
479 3300046542 Ga0495597_0065420 Ga0495597_0065420_452_784 105
480 3300046648 Ga0495611_0013060 Ga0495611_0013060_1749_2081 105
481 3300046665 Ga0495661_0120979 Ga0495661_0120979_397_729 105
482 3300046692 Ga0495671_0038473 Ga0495671_0038473_1825_2157 105
483 3300046694 Ga0495649_0023739 Ga0495649_0023739_1707_2039 105
484 3300046794 Ga0495589_0058010 Ga0495589_0058010_271_603 105
485 3300047320 Ga0495672_0029733 Ga0495672_0029733_1779_2111 105
486 3300047447 Ga0495685_042142 Ga0495685_042142_45_377 105
487 3300048905 Ga0496102_1911156 Ga0496102_1911156_90_407 105
488 3300048906 Ga0496103_0754028 Ga0496103_0754028_78_395 105
489 3300048919 Ga0496116_0004502 Ga0496116_0004502_5782_6114 105
490 3300048919 Ga0496116_0006982 Ga0496116_0006982_3414_3731 105
491 3300048924 Ga0496121_0044407 Ga0496121_0044407_1299_1631 105
492 3300048925 Ga0496122_0001090 Ga0496122_0001090_12414_12746 105
493 3300048926 Ga0496123_0001286 Ga0496123_0001286_34244_34576 105
494 3300048928 Ga0496125_0116397 Ga0496125_0116397_504_836 105
495 3300049569 Ga0501032_0577171 Ga0501032_0577171_285_617 105
496 3300049823 Ga0501044_0051890 Ga0501044_0051890_964_1296 105
497 3300053162 Ga0500638_116005 Ga0500638_116005_226_555 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

26

120

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m4w-assembly3.cif.gz_I crystal structure of mbp fused split fkbp-frb t2098l mutant in complex with rapamycin 0.6145 12 69
5wbh-assembly3.cif.gz_C structure of the frb domain of mtor bound to a substrate recruitment peptide of s6k1 0.6122 12 69
4drj-assembly1.cif.gz_B o-crystal structure of the ppiase domain of fkbp52, rapamycin and the frb fragment of mtor 0.6098 12 69
6m4u-assembly1.cif.gz_B crystal structure of fkbp-frb t2098l mutant in complex with rapamycin 0.6093 12 69
8er7-assembly1.cif.gz_B fkbp12-frb in complex with compound 12 0.6085 12 69
ID Description Score Start End Superfamily
4driB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);FKBP12-rapamycin binding domain 0.6237 12 69 1.20.120.150
4drhB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);FKBP12-rapamycin binding domain 0.6127 12 69 1.20.120.150
5wbhC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);FKBP12-rapamycin binding domain 0.6122 12 69 1.20.120.150
5wbhB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);FKBP12-rapamycin binding domain 0.6117 12 69 1.20.120.150
1fapB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);FKBP12-rapamycin binding domain 0.6102 12 69 1.20.120.150
ID Description Score Start End GO Terms
AF-B3R4F4-F1-model_v4 Transmembrane protein 0.997 8 105 GO:0016020
AF-A0A1G8ZGN1-F1-model_v4 DUF962 domain-containing protein 0.9935 9 103 GO:0016020
AF-A0A3A8E3T9-F1-model_v4 DUF962 domain-containing protein 0.9927 9 101 GO:0016020
AF-A0A4Q7CCM0-F1-model_v4 deleted 0.9918 8 102
AF-A0A657AFH8-F1-model_v4 DUF962 family protein 0.9914 9 103 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.76 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map