F455017

General Info

Members Datasets Scaffolds Average Seq Length
497 263 994 370

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1012100|Ga0079104_10121003
Length 412
Sequence MPLPGGQTRRGLSRQTPMTQSTFASQTAAAVATVTGASLLLPASVLAVTPAAGIDQSGMPGIAPLGAGGIAGGKRPLVFGHRGASALRPEHTLAAYAKAIVDGADYVEPDLCSTKDGVLVARHEAYLSETTDVASHKQFASRKTRKTIDGEAHDGWFVDDFTLAELKTLRAVERIPQFRPGSAEYNGMFQVVTFEEIIDFVAAEAAAHGRIIGIVPELKHSTYFASVGLPLEDRFLSIIAAHDYTRRNPVQIQSFEVANLKYLRSKLGGKQGTRANLRLMQLVVGEDVRPMDVAAAGGKLTFAQMCTPAGLRDIAAYADVVAPPTRSIIPLKKDGSLAAPSSLVEDAHQAGLRIEPWTFRPENRFLAADFRNGADTARNEAGSIAEMKRYIATGIDGFFTDDPALGRAALAG

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
238 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
239 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
240 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
241 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
242 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
246 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
247 2643221645 Massilia sp. Root351 Isolate Unclassified
248 2738541297 Duganella sp. GV083 Isolate Unclassified
249 2738541357 Duganella sp. GV053 Isolate Unclassified
250 2738543003 Duganella sp. GV066 Isolate Unclassified
251 2738543026 Duganella sp. GV089 Isolate Unclassified
252 2738543029 Duganella sp. GV039 Isolate Unclassified
253 2821131069 Duganella sp. 1224 Isolate Unclassified
254 2842711865 Duganella sp. R-73148 Isolate Unclassified
255 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
256 2857553236 Duganella sp. R-74557 Isolate Unclassified
257 2857558681 Duganella sp. R-74565 Isolate Unclassified
258 2857564685 Duganella sp. R-74599 Isolate Unclassified
259 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
260 2904424332 Duganella sp. 1411 Isolate Rhizosphere
261 2919476304 Duganella sp. 3397 Isolate Unclassified
262 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
263 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 0
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 0.4
Rhizoplane 1.41
Rhizosphere 76.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1012100 3300006946 Bacteria 2734
2 JGI24739J22299_10001696 3300001989 Bacteria 8374
3 JGI24739J22299_10018418 3300001989 Bacteria 2510
4 JGI24739J22299_10021643 3300001989 Bacteria 2287
5 JGI24737J22298_10000864 3300001990 Bacteria 10811
6 JGI24737J22298_10002862 3300001990 Bacteria 6112
7 JGI24735J21928_10001679 3300002067 Bacteria 7828
8 JGI24738J21930_10003391 3300002075 Bacteria 4028
9 JGI24751J29686_10000387 3300002459 Bacteria 14778
10 JGI25158J39367_1000633 3300002739 Bacteria 6946
11 JGI25165J46597_1000188 3300003214 Bacteria 92329
12 JGI25153J46596_10033832 3300003215 Bacteria 1680
13 rootL2_10106073 3300003322 Bacteria 2609
14 JGI25161J50226_1000390 3300003374 Bacteria 22180
15 Ga0055525_1000028 3300003759 Bacteria 331683
16 Ga0055529_1000407 3300003763 Bacteria 45450
17 Ga0055526_1000366 3300003771 Bacteria 36475
18 Ga0055526_1000591 3300003771 Bacteria 28506
19 Ga0055537_1000062 3300003773 Bacteria 77862
20 Ga0055537_1000451 3300003773 Bacteria 26082
21 Ga0055524_1002341 3300003775 Bacteria 9852
22 Ga0055534_1000019 3300003784 Bacteria 137920
23 Ga0055528_1000048 3300003790 Bacteria 95179
24 Ga0055543_1000450 3300004625 Bacteria 24809
25 Ga0055543_1005027 3300004625 Bacteria 3452
26 Ga0065165_1000111 3300005262 Bacteria 136009
27 Ga0065165_1001392 3300005262 Bacteria 26467
28 Ga0070658_10041598 3300005327 Bacteria 3708
29 Ga0070658_10070822 3300005327 Bacteria 2855
30 Ga0070670_100000003 3300005331 Bacteria 529510
31 Ga0068869_100000848 3300005334 Bacteria 17540
32 Ga0070666_10012477 3300005335 Bacteria 5361
33 Ga0068868_100000154 3300005338 Bacteria 44616
34 Ga0070660_100000544 3300005339 Bacteria 25288
35 Ga0070660_100102891 3300005339 Bacteria 2264
36 Ga0070660_100149194 3300005339 Bacteria 1879
37 Ga0070668_100002381 3300005347 Bacteria 13811
38 Ga0070669_100000084 3300005353 Bacteria 91046
39 Ga0070675_100008581 3300005354 Bacteria 7934
40 Ga0070671_100001022 3300005355 Bacteria 20561
41 Ga0070671_100011487 3300005355 Bacteria 7121
42 Ga0070674_100001435 3300005356 Bacteria 12682
43 Ga0070673_100000023 3300005364 Bacteria 91936
44 Ga0070659_100059344 3300005366 Bacteria 3021
45 Ga0070659_100149929 3300005366 Bacteria 1902
46 Ga0070667_100000886 3300005367 Bacteria 27667
47 Ga0070667_100001390 3300005367 Bacteria 21662
48 Ga0070667_100093295 3300005367 Bacteria 2592
49 Ga0070662_100015094 3300005457 Bacteria 5168
50 Ga0070681_10010127 3300005458 Bacteria 9293
51 Ga0068867_100000007 3300005459 Bacteria 148726
52 Ga0068853_100119408 3300005539 Bacteria 2350
53 Ga0070672_100288368 3300005543 Bacteria 1389
54 Ga0070693_100008581 3300005547 Bacteria 5047
55 Ga0070665_100000388 3300005548 Bacteria 64921
56 Ga0068855_100000029 3300005563 Bacteria 171278
57 Ga0068857_100015770 3300005577 Bacteria 6612
58 Ga0068854_100000027 3300005578 Bacteria 117836
59 Ga0068856_100004098 3300005614 Bacteria 14566
60 Ga0068856_100247632 3300005614 Bacteria 1797
61 Ga0068852_100004278 3300005616 Bacteria 10072
62 Ga0068859_100002121 3300005617 Bacteria 20201
63 Ga0068859_100321934 3300005617 Bacteria 1640
64 Ga0068864_100000005 3300005618 Bacteria 400840
65 Ga0068866_10012667 3300005718 Bacteria 3680
66 Ga0068863_100001275 3300005841 Bacteria 25115
67 Ga0068863_100001578 3300005841 Bacteria 22542
68 Ga0068860_100000013 3300005843 Bacteria 323055
69 Ga0068862_100000697 3300005844 Bacteria 34312
70 Ga0068862_100030628 3300005844 Bacteria 4535
71 Ga0097621_100002061 3300006237 Bacteria 13748
72 Ga0068871_100002074 3300006358 Bacteria 13555
73 Ga0068865_100000010 3300006881 Bacteria 159548
74 Ga0097620_100002121 3300006931 Bacteria 20201
75 Ga0097620_100321933 3300006931 Bacteria 1640
76 Ga0105251_10000574 3300009011 Bacteria 34289
77 Ga0105240_10070818 3300009093 Bacteria 4313
78 Ga0105240_10110430 3300009093 Bacteria 3328
79 Ga0105245_10002089 3300009098 Bacteria 18117
80 Ga0105243_10000950 3300009148 Bacteria 27049
81 Ga0105243_10042667 3300009148 Bacteria 3552
82 Ga0105241_10084693 3300009174 Bacteria 2489
83 Ga0105242_10000210 3300009176 Bacteria 45627
84 Ga0105248_10001468 3300009177 Bacteria 26237
85 Ga0105248_10001700 3300009177 Bacteria 24495
86 Ga0105248_10007301 3300009177 Bacteria 12126
87 Ga0105237_10155826 3300009545 Bacteria 2281
88 Ga0105238_10027777 3300009551 Bacteria 5766
89 Ga0105249_10000417 3300009553 Bacteria 40603
90 Ga0105249_10027062 3300009553 Bacteria 5173
91 Ga0105239_10000980 3300010375 Bacteria 40069
92 Ga0105239_10004123 3300010375 Bacteria 17464
93 Ga0105239_10046782 3300010375 Bacteria 4741
94 Ga0105246_10000472 3300011119 Bacteria 21681
95 Ga0157371_10083142 3300013102 Bacteria 2267
96 Ga0157370_10000203 3300013104 Bacteria 75249
97 Ga0157374_10000830 3300013296 Bacteria 27049
98 Ga0157378_10001477 3300013297 Bacteria 21228
99 Ga0157372_10012786 3300013307 Bacteria 8944
100 Ga0157372_10021148 3300013307 Bacteria 7027
101 Ga0157372_10200471 3300013307 Bacteria 2311
102 Ga0157372_10311479 3300013307 Bacteria 1832
103 Ga0157372_10633681 3300013307 Bacteria 1245
104 Ga0157375_10002120 3300013308 Bacteria 17145
105 Ga0157380_10000041 3300014326 Bacteria 75943
106 Ga0182008_10000357 3300014497 Bacteria 35568
107 Ga0157376_10000047 3300014969 Bacteria 107974
108 Ga0182006_1000002 3300015261 Bacteria 887990
109 Ga0182006_1000021 3300015261 Bacteria 280808
110 Ga0182007_10000162 3300015262 Bacteria 46148
111 Ga0182007_10015196 3300015262 Bacteria 2879
112 Ga0182005_1000020 3300015265 Bacteria 278671
113 Ga0182005_1000029 3300015265 Bacteria 214132
114 Ga0163161_10050708 3300017792 Bacteria 3004
115 Ga0213872_10000975 3300021361 Bacteria 19998
116 Ga0213872_10001897 3300021361 Bacteria 12851
117 Ga0213872_10008134 3300021361 Bacteria 5089
118 Ga0209436_100062 3300025208 Bacteria 56841
119 Ga0209563_100011 3300025230 Bacteria 1187808
120 Ga0209646_1000087 3300025246 Bacteria 193273
121 Ga0209026_1002441 3300025250 Bacteria 6982
122 Ga0209026_1002852 3300025250 Bacteria 6102
123 Ga0209148_1000061 3300025254 Bacteria 349575
124 Ga0209148_1001013 3300025254 Bacteria 17719
125 Ga0209233_1000120 3300025261 Bacteria 233311
126 Ga0209565_1000017 3300025263 Bacteria 462438
127 Ga0209455_1000330 3300025272 Bacteria 45609
128 Ga0209455_1000692 3300025272 Bacteria 19864
129 Ga0209673_1000007 3300025273 Bacteria 634477
130 Ga0209130_1000139 3300025284 Bacteria 115951
131 Ga0209130_1000336 3300025284 Bacteria 53924
132 Ga0209675_1000009 3300025291 Bacteria 562872
133 Ga0209025_1008705 3300025294 Bacteria 7242
134 Ga0209564_1000009 3300025295 Bacteria 950196
135 Ga0209564_1000036 3300025295 Bacteria 423455
136 Ga0209564_1000045 3300025295 Bacteria 376549
137 Ga0209758_1000456 3300025297 Bacteria 68269
138 Ga0209256_1000091 3300025299 Bacteria 210945
139 Ga0207655_1006948 3300025728 Bacteria 7419
140 Ga0207655_1009877 3300025728 Bacteria 5873
141 Ga0207713_1002768 3300025735 Bacteria 12413
142 Ga0207642_10007810 3300025899 Bacteria 3631
143 Ga0207647_10005555 3300025904 Bacteria 9227
144 Ga0207647_10040018 3300025904 Bacteria 2954
145 Ga0207647_10150770 3300025904 Bacteria 1359
146 Ga0207705_10000316 3300025909 Bacteria 44059
147 Ga0207705_10000963 3300025909 Bacteria 23546
148 Ga0207705_10009514 3300025909 Bacteria 7072
149 Ga0207654_10091068 3300025911 Bacteria 1859
150 Ga0207695_10041776 3300025913 Bacteria 4905
151 Ga0207695_10132278 3300025913 Bacteria 2451
152 Ga0207671_10001304 3300025914 Bacteria 29270
153 Ga0207671_10103565 3300025914 Bacteria 2158
154 Ga0207657_10003918 3300025919 Bacteria 15794
155 Ga0207657_10121410 3300025919 Bacteria 2150
156 Ga0207657_10122603 3300025919 Bacteria 2138
157 Ga0207681_10000005 3300025923 Bacteria 555724
158 Ga0207694_10045106 3300025924 Bacteria 3405
159 Ga0207694_10048035 3300025924 Bacteria 3302
160 Ga0207650_10000004 3300025925 Bacteria 743372
161 Ga0207659_10024690 3300025926 Bacteria 4031
162 Ga0207644_10001031 3300025931 Bacteria 17843
163 Ga0207644_10159172 3300025931 Bacteria 1754
164 Ga0207690_10008359 3300025932 Bacteria 6144
165 Ga0207706_10004690 3300025933 Bacteria 12810
166 Ga0207706_10031591 3300025933 Bacteria 4717
167 Ga0207706_10111154 3300025933 Bacteria 2410
168 Ga0207686_10033791 3300025934 Bacteria 3055
169 Ga0207709_10000050 3300025935 Bacteria 234391
170 Ga0207709_10046973 3300025935 Bacteria 2623
171 Ga0207669_10041392 3300025937 Bacteria 2681
172 Ga0207704_10000020 3300025938 Bacteria 148847
173 Ga0207711_10001028 3300025941 Bacteria 26716
174 Ga0207711_10002707 3300025941 Bacteria 15647
175 Ga0207711_10005807 3300025941 Bacteria 10429
176 Ga0207689_10001541 3300025942 Bacteria 21894
177 Ga0207667_10000035 3300025949 Bacteria 301056
178 Ga0207651_10000005 3300025960 Bacteria 246132
179 Ga0207712_10000308 3300025961 Bacteria 44940
180 Ga0207668_10000772 3300025972 Bacteria 19601
181 Ga0207640_10000145 3300025981 Bacteria 51603
182 Ga0207640_10015331 3300025981 Bacteria 4434
183 Ga0207658_10000067 3300025986 Bacteria 116584
184 Ga0207658_10003849 3300025986 Bacteria 10572
185 Ga0207658_10010932 3300025986 Bacteria 6179
186 Ga0207677_10000373 3300026023 Bacteria 31103
187 Ga0207703_10179181 3300026035 Bacteria 1869
188 Ga0207639_10007809 3300026041 Bacteria 7304
189 Ga0207702_10012620 3300026078 Bacteria 7034
190 Ga0207641_10004468 3300026088 Bacteria 12112
191 Ga0207641_10004653 3300026088 Bacteria 11842
192 Ga0207648_10000017 3300026089 Bacteria 148699
193 Ga0207676_10000006 3300026095 Bacteria 681936
194 Ga0207674_10029429 3300026116 Bacteria 5782
195 Ga0207683_10029414 3300026121 Bacteria 4757
196 Ga0207698_10000712 3300026142 Bacteria 19239
197 Ga0207698_10091126 3300026142 Bacteria 2495
198 Ga0207698_10109382 3300026142 Bacteria 2312
199 Ga0209281_1011866 3300027111 Bacteria 1936
200 Ga0268266_10001970 3300028379 Bacteria 23039
201 Ga0268265_10000616 3300028380 Bacteria 35508
202 Ga0268264_10000039 3300028381 Bacteria 376641
203 Ga0268264_10000913 3300028381 Bacteria 30954
204 Ga0268264_10020157 3300028381 Bacteria 5449
205 Ga0307515_10136714 3300028794 Bacteria 2659
206 Ga0307513_10046357 3300031456 Bacteria 4740
207 Ga0307509_10000022 3300031507 Bacteria 247822
208 Ga0307414_10128848 3300032004 Bacteria 1960
209 Ga0395899_0002116 3300037312 Bacteria 16321
210 Ga0395900_0000322 3300037418 Bacteria 70864
211 Ga0395900_0108389 3300037418 Bacteria 2853
212 Ga0395905_0082091 3300037471 Bacteria 3020
213 Ga0395905_0118935 3300037471 Bacteria 2483
214 Ga0395901_0000332 3300038443 Bacteria 57814
215 Ga0395901_0000712 3300038443 Bacteria 38055
216 Ga0395901_0559257 3300038443 Bacteria 1158
217 Ga0237819_02012 3300038705 Bacteria 4528
218 Ga0436361_0089506 3300039447 Bacteria 38272
219 Ga0436361_0471040 3300039447 Bacteria 15880
220 Ga0436361_0887554 3300039447 Bacteria 20445
221 Ga0436361_1096673 3300039447 Bacteria 2304
222 Ga0451806_567525 3300041462 Bacteria 4260
223 Ga0451807_2303118 3300041486 Bacteria 3580
224 Ga0451833_0691704 3300041491 Bacteria 1744
225 Ga0439448_0000332 3300042005 Bacteria 10506
226 Ga0439448_0003494 3300042005 Bacteria 4352
227 Ga0439455_0000252 3300042012 Bacteria 6482
228 Ga0439455_0000304 3300042012 Bacteria 6168
229 Ga0439458_0000255 3300042157 Bacteria 12956
230 Ga0439458_0000305 3300042157 Bacteria 12201
231 Ga0466972_0002161 3300044658 Bacteria 9648
232 Ga0466965_0029309 3300044683 Bacteria 2678
233 Ga0466965_0155838 3300044683 Bacteria 1196
234 Ga0466968_0072018 3300044735 Bacteria 1506
235 Ga0466970_0027698 3300044765 Bacteria 2974
236 Ga0466960_0012052 3300044901 Bacteria 3639
237 Ga0466959_0224286 3300045049 Bacteria 1302
238 Ga0466958_0030310 3300045836 Bacteria 3212
239 Ga0466958_0191697 3300045836 Bacteria 1299
240 Ga0495617_000006 3300046452 Bacteria 398279
241 Ga0495617_002143 3300046452 Bacteria 8114
242 Ga0495617_003370 3300046452 Bacteria 6022
243 Ga0495617_013183 3300046452 Bacteria 2815
244 Ga0495627_000005 3300046453 Bacteria 630805
245 Ga0495590_0000003 3300046457 Bacteria 478593
246 Ga0495638_0000198 3300046460 Bacteria 86199
247 Ga0495638_0011182 3300046460 Bacteria 6198
248 Ga0495653_0000011 3300046463 Bacteria 272314
249 Ga0495650_0000015 3300046471 Bacteria 557595
250 Ga0495650_0000131 3300046471 Bacteria 174698
251 Ga0495650_0000189 3300046471 Bacteria 133931
252 Ga0495650_0000339 3300046471 Bacteria 83278
253 Ga0495650_0001195 3300046471 Bacteria 27437
254 Ga0495650_0017461 3300046471 Bacteria 3597
255 Ga0495605_0000003 3300046474 Bacteria 491502
256 Ga0495639_0019942 3300046475 Bacteria 2927
257 Ga0495584_0001074 3300046491 Bacteria 16979
258 Ga0495584_0004303 3300046491 Bacteria 7675
259 Ga0495584_0004746 3300046491 Bacteria 7276
260 Ga0495585_0001792 3300046492 Bacteria 16324
261 Ga0495585_0001983 3300046492 Bacteria 15214
262 Ga0495585_0004903 3300046492 Bacteria 8574
263 Ga0495596_0000359 3300046500 Bacteria 29317
264 Ga0495596_0012606 3300046500 Bacteria 3612
265 Ga0495607_0004417 3300046501 Bacteria 10356
266 Ga0495607_0005378 3300046501 Bacteria 9187
267 Ga0495607_0005421 3300046501 Bacteria 9135
268 Ga0495607_0006440 3300046501 Bacteria 8264
269 Ga0495607_0021458 3300046501 Bacteria 4063
270 Ga0495583_0000033 3300046506 Bacteria 246882
271 Ga0495583_0000060 3300046506 Bacteria 199091
272 Ga0495583_0000165 3300046506 Bacteria 111940
273 Ga0495583_0000265 3300046506 Bacteria 86085
274 Ga0495583_0053552 3300046506 Bacteria 1831
275 Ga0495606_0000068 3300046507 Bacteria 179653
276 Ga0495606_0000304 3300046507 Bacteria 84652
277 Ga0495606_0001448 3300046507 Bacteria 31815
278 Ga0495606_0001581 3300046507 Bacteria 29777
279 Ga0495606_0001638 3300046507 Bacteria 29168
280 Ga0495606_0001656 3300046507 Bacteria 28966
281 Ga0495606_0008588 3300046507 Bacteria 8841
282 Ga0495606_0011131 3300046507 Bacteria 7373
283 Ga0495606_0079839 3300046507 Bacteria 2037
284 Ga0495606_0117352 3300046507 Bacteria 1597
285 Ga0495606_0162843 3300046507 Bacteria 1300
286 Ga0495610_0000004 3300046512 Bacteria 1006135
287 Ga0495610_0000669 3300046512 Bacteria 33348
288 Ga0495610_0027246 3300046512 Bacteria 3039
289 Ga0495616_0001483 3300046513 Bacteria 16267
290 Ga0495616_0008581 3300046513 Bacteria 6037
291 Ga0495616_0017476 3300046513 Bacteria 3956
292 Ga0495616_0089918 3300046513 Bacteria 1455
293 Ga0495616_0131214 3300046513 Bacteria 1148
294 Ga0495631_0000750 3300046518 Bacteria 20777
295 Ga0495631_0001299 3300046518 Bacteria 15314
296 Ga0495632_0003011 3300046519 Bacteria 12299
297 Ga0495632_0082001 3300046519 Bacteria 1537
298 Ga0495637_0000747 3300046520 Bacteria 21946
299 Ga0495643_0000106 3300046522 Bacteria 138657
300 Ga0495643_0000902 3300046522 Bacteria 31450
301 Ga0495643_0032393 3300046522 Bacteria 2902
302 Ga0495643_0066802 3300046522 Bacteria 1896
303 Ga0495644_0000624 3300046523 Bacteria 14822
304 Ga0495644_0000854 3300046523 Bacteria 12569
305 Ga0495648_0000087 3300046524 Bacteria 116394
306 Ga0495648_0000456 3300046524 Bacteria 44289
307 Ga0495648_0008685 3300046524 Bacteria 7964
308 Ga0495648_0022146 3300046524 Bacteria 4383
309 Ga0495648_0052523 3300046524 Bacteria 2475
310 Ga0495642_0000767 3300046528 Bacteria 15723
311 Ga0495642_0007637 3300046528 Bacteria 4146
312 Ga0495642_0065706 3300046528 Bacteria 1511
313 Ga0495654_0000035 3300046530 Bacteria 192768
314 Ga0495609_0000293 3300046538 Bacteria 46162
315 Ga0495609_0000996 3300046538 Bacteria 20156
316 Ga0495609_0002236 3300046538 Bacteria 12103
317 Ga0495609_0010890 3300046538 Bacteria 4344
318 Ga0495609_0014079 3300046538 Bacteria 3765
319 Ga0495609_0021580 3300046538 Bacteria 2971
320 Ga0495609_0042192 3300046538 Bacteria 2049
321 Ga0495597_0000119 3300046542 Bacteria 71150
322 Ga0495597_0000273 3300046542 Bacteria 46966
323 Ga0495622_0000004 3300046557 Bacteria 258984
324 Ga0495622_0000498 3300046557 Bacteria 24660
325 Ga0495622_0008114 3300046557 Bacteria 4866
326 Ga0495622_0034780 3300046557 Bacteria 2350
327 Ga0495633_0000617 3300046558 Bacteria 33789
328 Ga0495633_0001445 3300046558 Bacteria 18469
329 Ga0495633_0001486 3300046558 Bacteria 18179
330 Ga0495633_0005153 3300046558 Bacteria 8095
331 Ga0495633_0007281 3300046558 Bacteria 6397
332 Ga0495633_0007560 3300046558 Bacteria 6235
333 Ga0495633_0012880 3300046558 Bacteria 4427
334 Ga0495633_0016536 3300046558 Bacteria 3801
335 Ga0495656_0001555 3300046615 Bacteria 7501
336 Ga0495656_0008629 3300046615 Bacteria 3645
337 Ga0495656_0058264 3300046615 Bacteria 1675
338 Ga0495668_0000018 3300046616 Bacteria 417480
339 Ga0495668_0000104 3300046616 Bacteria 134968
340 Ga0495668_0001257 3300046616 Bacteria 25275
341 Ga0495668_0001909 3300046616 Bacteria 18614
342 Ga0495668_0043248 3300046616 Bacteria 2506
343 Ga0495611_0000992 3300046648 Bacteria 15071
344 Ga0495611_0001776 3300046648 Bacteria 10398
345 Ga0495625_0000038 3300046660 Bacteria 211808
346 Ga0495625_0000335 3300046660 Bacteria 71730
347 Ga0495625_0010738 3300046660 Bacteria 7538
348 Ga0495625_0043220 3300046660 Bacteria 3269
349 Ga0495625_0060507 3300046660 Bacteria 2683
350 Ga0495625_0097716 3300046660 Bacteria 2020
351 Ga0495625_0134330 3300046660 Bacteria 1673
352 Ga0495625_0151662 3300046660 Bacteria 1557
353 Ga0495659_0000397 3300046664 Bacteria 16662
354 Ga0495661_0000324 3300046665 Bacteria 52421
355 Ga0495661_0022896 3300046665 Bacteria 4060
356 Ga0495661_0046638 3300046665 Bacteria 2644
357 Ga0495661_0061247 3300046665 Bacteria 2234
358 Ga0495588_0000172 3300046674 Bacteria 81934
359 Ga0495588_0067834 3300046674 Bacteria 1852
360 Ga0495669_0001330 3300046684 Bacteria 10221
361 Ga0495669_0037689 3300046684 Bacteria 2140
362 Ga0495670_0000931 3300046691 Bacteria 14148
363 Ga0495670_0002420 3300046691 Bacteria 9211
364 Ga0495670_0015948 3300046691 Bacteria 3693
365 Ga0495671_0000001 3300046692 Bacteria 1169494
366 Ga0495671_0006624 3300046692 Bacteria 6678
367 Ga0495671_0014070 3300046692 Bacteria 4313
368 Ga0495671_0035481 3300046692 Bacteria 2532
369 Ga0495589_0024804 3300046794 Bacteria 3046
370 Ga0495660_0000126 3300046810 Bacteria 84046
371 Ga0495660_0001205 3300046810 Bacteria 18096
372 Ga0495660_0008367 3300046810 Bacteria 6052
373 Ga0495660_0011189 3300046810 Bacteria 5208
374 Ga0495660_0066474 3300046810 Bacteria 1922
375 Ga0495636_0000323 3300047318 Bacteria 18272
376 Ga0495672_0000032 3300047320 Bacteria 295356
377 Ga0495672_0000141 3300047320 Bacteria 106630
378 Ga0495672_0006210 3300047320 Bacteria 9319
379 Ga0495672_0123895 3300047320 Bacteria 1369
380 Ga0495676_0043551 3300047321 Bacteria 3671
381 Ga0495676_0051098 3300047321 Bacteria 3310
382 Ga0495683_0004190 3300047323 Bacteria 8240
383 Ga0495683_0005815 3300047323 Bacteria 6788
384 Ga0495683_0036403 3300047323 Bacteria 2498
385 Ga0495687_000173 3300047443 Bacteria 95361
386 Ga0495687_001010 3300047443 Bacteria 28108
387 Ga0495687_002259 3300047443 Bacteria 15808
388 Ga0495687_009416 3300047443 Bacteria 5462
389 Ga0495687_017487 3300047443 Bacteria 3575
390 Ga0495677_0000185 3300047445 Bacteria 28982
391 Ga0495677_0001794 3300047445 Bacteria 8593
392 Ga0495677_0020491 3300047445 Bacteria 2397
393 Ga0495685_000027 3300047447 Bacteria 62875
394 Ga0495673_0000006 3300047469 Bacteria 908691
395 Ga0495673_0000024 3300047469 Bacteria 521349
396 Ga0495673_0000141 3300047469 Bacteria 128600
397 Ga0495673_0025814 3300047469 Bacteria 2816
398 Ga0495673_0039632 3300047469 Bacteria 2136
399 Ga0495681_0000323 3300047470 Bacteria 38034
400 Ga0495681_0000900 3300047470 Bacteria 22976
401 Ga0495681_0005585 3300047470 Bacteria 8395
402 Ga0495686_0000147 3300047472 Bacteria 139008
403 Ga0495686_0000225 3300047472 Bacteria 104121
404 Ga0495686_0000407 3300047472 Bacteria 68110
405 Ga0495686_0000844 3300047472 Bacteria 39354
406 Ga0495686_0001226 3300047472 Bacteria 29331
407 Ga0495686_0001900 3300047472 Bacteria 20870
408 Ga0495686_0009599 3300047472 Bacteria 6953
409 Ga0495686_0012927 3300047472 Bacteria 5821
410 Ga0495686_0038895 3300047472 Bacteria 3041
411 Ga0495686_0047544 3300047472 Bacteria 2708
412 Ga0495626_0063968 3300048091 Bacteria 1667
413 Ga0496102_0122660 3300048905 Bacteria 2428
414 Ga0496103_0001278 3300048906 Bacteria 17158
415 Ga0496103_0002431 3300048906 Bacteria 11721
416 Ga0496113_0022033 3300048916 Bacteria 4500
417 Ga0496116_0009789 3300048919 Bacteria 8128
418 Ga0496116_0046608 3300048919 Bacteria 2925
419 Ga0496116_0081891 3300048919 Bacteria 1999
420 Ga0496116_0099483 3300048919 Bacteria 1741
421 Ga0496117_0000001 3300048920 Bacteria 2526244
422 Ga0496117_0007559 3300048920 Bacteria 10584
423 Ga0496117_0014903 3300048920 Bacteria 6666
424 Ga0496117_0037156 3300048920 Bacteria 3632
425 Ga0496117_0100800 3300048920 Bacteria 1828
426 Ga0496118_0000008 3300048921 Bacteria 644537
427 Ga0496118_0031397 3300048921 Bacteria 4404
428 Ga0496119_0061244 3300048922 Bacteria 2249
429 Ga0496120_0046529 3300048923 Bacteria 2507
430 Ga0496120_0071956 3300048923 Bacteria 1896
431 Ga0496121_0003499 3300048924 Bacteria 22330
432 Ga0496121_0005228 3300048924 Bacteria 16801
433 Ga0496121_0005483 3300048924 Bacteria 16244
434 Ga0496121_0009467 3300048924 Bacteria 11193
435 Ga0496121_0015509 3300048924 Bacteria 7976
436 Ga0496121_0053674 3300048924 Bacteria 3375
437 Ga0496121_0056640 3300048924 Bacteria 3254
438 Ga0496122_0006027 3300048925 Bacteria 14139
439 Ga0496122_0006290 3300048925 Bacteria 13694
440 Ga0496122_0009790 3300048925 Bacteria 10009
441 Ga0496122_0017615 3300048925 Bacteria 6664
442 Ga0496122_0090148 3300048925 Bacteria 2093
443 Ga0496122_0161094 3300048925 Bacteria 1368
444 Ga0496123_0002569 3300048926 Bacteria 22100
445 Ga0496123_0003542 3300048926 Bacteria 17370
446 Ga0496123_0018098 3300048926 Bacteria 5629
447 Ga0496124_0125439 3300048927 Bacteria 2046
448 Ga0496125_0012910 3300048928 Bacteria 8247
449 Ga0496125_0018792 3300048928 Bacteria 6547
450 Ga0496125_0039508 3300048928 Bacteria 4061
451 Ga0496125_0089219 3300048928 Bacteria 2320
452 Ga0496126_0003811 3300048929 Bacteria 18697
453 Ga0496126_0050681 3300048929 Bacteria 3782
454 Ga0495678_000016 3300049459 Bacteria 303426
455 Ga0495678_000101 3300049459 Bacteria 104596
456 Ga0495678_004137 3300049459 Bacteria 8577
457 Ga0495678_009262 3300049459 Bacteria 4889
458 Ga0495678_043885 3300049459 Bacteria 1773
459 Ga0495682_0000388 3300049460 Bacteria 31810
460 Ga0495682_0000800 3300049460 Bacteria 19901
461 Ga0495682_0010270 3300049460 Bacteria 3632
462 Ga0501036_0085766 3300049572 Bacteria 2662
463 Ga0501249_000185 3300049679 Bacteria 19045
464 Ga0501269_000195 3300049766 Bacteria 18239
465 Ga0501044_0010579 3300049823 Bacteria 10009
466 Ga0500643_001312 3300053087 Bacteria 14605
467 Ga0500566_0143230 3300053094 Bacteria 1266
468 Ga0500641_0013166 3300053096 Bacteria 3036
469 Ga0500555_000072 3300053103 Bacteria 49690
470 Ga0500594_0024621 3300053118 Bacteria 1535
471 Ga0500594_0039531 3300053118 Bacteria 1283
472 Ga0500607_001611 3300053121 Bacteria 19933
473 Ga0500608_093429 3300053122 Bacteria 1402
474 Ga0500618_000816 3300053125 Bacteria 17142
475 Ga0500586_000584 3300053145 Bacteria 7421
476 Ga0500586_001585 3300053145 Bacteria 4855
477 Ga0500616_0003309 3300053153 Bacteria 12426
478 Ga0500624_000053 3300053157 Bacteria 74086
479 Ga0500645_003142 3300053730 Bacteria 6871
480 2601670763 2600255292 Bacteria 6300551
481 2644254049 2643221645 Bacteria 7207331
482 2738824918 2738541297 Bacteria 6549566
483 2739148715 2738541357 Bacteria 6549408
484 2739190634 2738543003 Bacteria 6549560
485 2739317111 2738543026 Bacteria 6549408
486 2739335352 2738543029 Bacteria 6549249
487 2821133531 2821131069 Bacteria 6108407
488 2842716861 2842711865 Bacteria 7155354
489 2857552658 2857547612 Bacteria 6179999
490 2857553659 2857553236 Bacteria 6166726
491 2857561262 2857558681 Bacteria 6617694
492 2857565324 2857564685 Bacteria 6290584
493 2885086445 2885080285 Bacteria 6355622
494 2904426632 2904424332 Bacteria 7633521
495 2919481131 2919476304 Bacteria 5888696
496 2932414974 2932410948 Bacteria 6312192
497 2932419660 2932416698 Bacteria 6315112
498 Ga0079104_1012100
499 JGI24739J22299_10001696
500 JGI24739J22299_10018418
501 JGI24739J22299_10021643
502 JGI24737J22298_10000864
503 JGI24737J22298_10002862
504 JGI24735J21928_10001679
505 JGI24738J21930_10003391
506 JGI24751J29686_10000387
507 JGI25158J39367_1000633
508 JGI25165J46597_1000188
509 JGI25153J46596_10033832
510 rootL2_10106073
511 JGI25161J50226_1000390
512 Ga0055525_1000028
513 Ga0055529_1000407
514 Ga0055526_1000366
515 Ga0055526_1000591
516 Ga0055537_1000062
517 Ga0055537_1000451
518 Ga0055524_1002341
519 Ga0055534_1000019
520 Ga0055528_1000048
521 Ga0055543_1000450
522 Ga0055543_1005027
523 Ga0065165_1000111
524 Ga0065165_1001392
525 Ga0070658_10041598
526 Ga0070658_10070822
527 Ga0070670_100000003
528 Ga0068869_100000848
529 Ga0070666_10012477
530 Ga0068868_100000154
531 Ga0070660_100000544
532 Ga0070660_100102891
533 Ga0070660_100149194
534 Ga0070668_100002381
535 Ga0070669_100000084
536 Ga0070675_100008581
537 Ga0070671_100001022
538 Ga0070671_100011487
539 Ga0070674_100001435
540 Ga0070673_100000023
541 Ga0070659_100059344
542 Ga0070659_100149929
543 Ga0070667_100000886
544 Ga0070667_100001390
545 Ga0070667_100093295
546 Ga0070662_100015094
547 Ga0070681_10010127
548 Ga0068867_100000007
549 Ga0068853_100119408
550 Ga0070672_100288368
551 Ga0070693_100008581
552 Ga0070665_100000388
553 Ga0068855_100000029
554 Ga0068857_100015770
555 Ga0068854_100000027
556 Ga0068856_100004098
557 Ga0068856_100247632
558 Ga0068852_100004278
559 Ga0068859_100002121
560 Ga0068859_100321934
561 Ga0068864_100000005
562 Ga0068866_10012667
563 Ga0068863_100001275
564 Ga0068863_100001578
565 Ga0068860_100000013
566 Ga0068862_100000697
567 Ga0068862_100030628
568 Ga0097621_100002061
569 Ga0068871_100002074
570 Ga0068865_100000010
571 Ga0097620_100002121
572 Ga0097620_100321933
573 Ga0105251_10000574
574 Ga0105240_10070818
575 Ga0105240_10110430
576 Ga0105245_10002089
577 Ga0105243_10000950
578 Ga0105243_10042667
579 Ga0105241_10084693
580 Ga0105242_10000210
581 Ga0105248_10001468
582 Ga0105248_10001700
583 Ga0105248_10007301
584 Ga0105237_10155826
585 Ga0105238_10027777
586 Ga0105249_10000417
587 Ga0105249_10027062
588 Ga0105239_10000980
589 Ga0105239_10004123
590 Ga0105239_10046782
591 Ga0105246_10000472
592 Ga0157371_10083142
593 Ga0157370_10000203
594 Ga0157374_10000830
595 Ga0157378_10001477
596 Ga0157372_10012786
597 Ga0157372_10021148
598 Ga0157372_10200471
599 Ga0157372_10311479
600 Ga0157372_10633681
601 Ga0157375_10002120
602 Ga0157380_10000041
603 Ga0182008_10000357
604 Ga0157376_10000047
605 Ga0182006_1000002
606 Ga0182006_1000021
607 Ga0182007_10000162
608 Ga0182007_10015196
609 Ga0182005_1000020
610 Ga0182005_1000029
611 Ga0163161_10050708
612 Ga0213872_10000975
613 Ga0213872_10001897
614 Ga0213872_10008134
615 Ga0209436_100062
616 Ga0209563_100011
617 Ga0209646_1000087
618 Ga0209026_1002441
619 Ga0209026_1002852
620 Ga0209148_1000061
621 Ga0209148_1001013
622 Ga0209233_1000120
623 Ga0209565_1000017
624 Ga0209455_1000330
625 Ga0209455_1000692
626 Ga0209673_1000007
627 Ga0209130_1000139
628 Ga0209130_1000336
629 Ga0209675_1000009
630 Ga0209025_1008705
631 Ga0209564_1000009
632 Ga0209564_1000036
633 Ga0209564_1000045
634 Ga0209758_1000456
635 Ga0209256_1000091
636 Ga0207655_1006948
637 Ga0207655_1009877
638 Ga0207713_1002768
639 Ga0207642_10007810
640 Ga0207647_10005555
641 Ga0207647_10040018
642 Ga0207647_10150770
643 Ga0207705_10000316
644 Ga0207705_10000963
645 Ga0207705_10009514
646 Ga0207654_10091068
647 Ga0207695_10041776
648 Ga0207695_10132278
649 Ga0207671_10001304
650 Ga0207671_10103565
651 Ga0207657_10003918
652 Ga0207657_10121410
653 Ga0207657_10122603
654 Ga0207681_10000005
655 Ga0207694_10045106
656 Ga0207694_10048035
657 Ga0207650_10000004
658 Ga0207659_10024690
659 Ga0207644_10001031
660 Ga0207644_10159172
661 Ga0207690_10008359
662 Ga0207706_10004690
663 Ga0207706_10031591
664 Ga0207706_10111154
665 Ga0207686_10033791
666 Ga0207709_10000050
667 Ga0207709_10046973
668 Ga0207669_10041392
669 Ga0207704_10000020
670 Ga0207711_10001028
671 Ga0207711_10002707
672 Ga0207711_10005807
673 Ga0207689_10001541
674 Ga0207667_10000035
675 Ga0207651_10000005
676 Ga0207712_10000308
677 Ga0207668_10000772
678 Ga0207640_10000145
679 Ga0207640_10015331
680 Ga0207658_10000067
681 Ga0207658_10003849
682 Ga0207658_10010932
683 Ga0207677_10000373
684 Ga0207703_10179181
685 Ga0207639_10007809
686 Ga0207702_10012620
687 Ga0207641_10004468
688 Ga0207641_10004653
689 Ga0207648_10000017
690 Ga0207676_10000006
691 Ga0207674_10029429
692 Ga0207683_10029414
693 Ga0207698_10000712
694 Ga0207698_10091126
695 Ga0207698_10109382
696 Ga0209281_1011866
697 Ga0268266_10001970
698 Ga0268265_10000616
699 Ga0268264_10000039
700 Ga0268264_10000913
701 Ga0268264_10020157
702 Ga0307515_10136714
703 Ga0307513_10046357
704 Ga0307509_10000022
705 Ga0307414_10128848
706 Ga0395899_0002116
707 Ga0395900_0000322
708 Ga0395900_0108389
709 Ga0395905_0082091
710 Ga0395905_0118935
711 Ga0395901_0000332
712 Ga0395901_0000712
713 Ga0395901_0559257
714 Ga0237819_02012
715 Ga0436361_0089506
716 Ga0436361_0471040
717 Ga0436361_0887554
718 Ga0436361_1096673
719 Ga0451806_567525
720 Ga0451807_2303118
721 Ga0451833_0691704
722 Ga0439448_0000332
723 Ga0439448_0003494
724 Ga0439455_0000252
725 Ga0439455_0000304
726 Ga0439458_0000255
727 Ga0439458_0000305
728 Ga0466972_0002161
729 Ga0466965_0029309
730 Ga0466965_0155838
731 Ga0466968_0072018
732 Ga0466970_0027698
733 Ga0466960_0012052
734 Ga0466959_0224286
735 Ga0466958_0030310
736 Ga0466958_0191697
737 Ga0495617_000006
738 Ga0495617_002143
739 Ga0495617_003370
740 Ga0495617_013183
741 Ga0495627_000005
742 Ga0495590_0000003
743 Ga0495638_0000198
744 Ga0495638_0011182
745 Ga0495653_0000011
746 Ga0495650_0000015
747 Ga0495650_0000131
748 Ga0495650_0000189
749 Ga0495650_0000339
750 Ga0495650_0001195
751 Ga0495650_0017461
752 Ga0495605_0000003
753 Ga0495639_0019942
754 Ga0495584_0001074
755 Ga0495584_0004303
756 Ga0495584_0004746
757 Ga0495585_0001792
758 Ga0495585_0001983
759 Ga0495585_0004903
760 Ga0495596_0000359
761 Ga0495596_0012606
762 Ga0495607_0004417
763 Ga0495607_0005378
764 Ga0495607_0005421
765 Ga0495607_0006440
766 Ga0495607_0021458
767 Ga0495583_0000033
768 Ga0495583_0000060
769 Ga0495583_0000165
770 Ga0495583_0000265
771 Ga0495583_0053552
772 Ga0495606_0000068
773 Ga0495606_0000304
774 Ga0495606_0001448
775 Ga0495606_0001581
776 Ga0495606_0001638
777 Ga0495606_0001656
778 Ga0495606_0008588
779 Ga0495606_0011131
780 Ga0495606_0079839
781 Ga0495606_0117352
782 Ga0495606_0162843
783 Ga0495610_0000004
784 Ga0495610_0000669
785 Ga0495610_0027246
786 Ga0495616_0001483
787 Ga0495616_0008581
788 Ga0495616_0017476
789 Ga0495616_0089918
790 Ga0495616_0131214
791 Ga0495631_0000750
792 Ga0495631_0001299
793 Ga0495632_0003011
794 Ga0495632_0082001
795 Ga0495637_0000747
796 Ga0495643_0000106
797 Ga0495643_0000902
798 Ga0495643_0032393
799 Ga0495643_0066802
800 Ga0495644_0000624
801 Ga0495644_0000854
802 Ga0495648_0000087
803 Ga0495648_0000456
804 Ga0495648_0008685
805 Ga0495648_0022146
806 Ga0495648_0052523
807 Ga0495642_0000767
808 Ga0495642_0007637
809 Ga0495642_0065706
810 Ga0495654_0000035
811 Ga0495609_0000293
812 Ga0495609_0000996
813 Ga0495609_0002236
814 Ga0495609_0010890
815 Ga0495609_0014079
816 Ga0495609_0021580
817 Ga0495609_0042192
818 Ga0495597_0000119
819 Ga0495597_0000273
820 Ga0495622_0000004
821 Ga0495622_0000498
822 Ga0495622_0008114
823 Ga0495622_0034780
824 Ga0495633_0000617
825 Ga0495633_0001445
826 Ga0495633_0001486
827 Ga0495633_0005153
828 Ga0495633_0007281
829 Ga0495633_0007560
830 Ga0495633_0012880
831 Ga0495633_0016536
832 Ga0495656_0001555
833 Ga0495656_0008629
834 Ga0495656_0058264
835 Ga0495668_0000018
836 Ga0495668_0000104
837 Ga0495668_0001257
838 Ga0495668_0001909
839 Ga0495668_0043248
840 Ga0495611_0000992
841 Ga0495611_0001776
842 Ga0495625_0000038
843 Ga0495625_0000335
844 Ga0495625_0010738
845 Ga0495625_0043220
846 Ga0495625_0060507
847 Ga0495625_0097716
848 Ga0495625_0134330
849 Ga0495625_0151662
850 Ga0495659_0000397
851 Ga0495661_0000324
852 Ga0495661_0022896
853 Ga0495661_0046638
854 Ga0495661_0061247
855 Ga0495588_0000172
856 Ga0495588_0067834
857 Ga0495669_0001330
858 Ga0495669_0037689
859 Ga0495670_0000931
860 Ga0495670_0002420
861 Ga0495670_0015948
862 Ga0495671_0000001
863 Ga0495671_0006624
864 Ga0495671_0014070
865 Ga0495671_0035481
866 Ga0495589_0024804
867 Ga0495660_0000126
868 Ga0495660_0001205
869 Ga0495660_0008367
870 Ga0495660_0011189
871 Ga0495660_0066474
872 Ga0495636_0000323
873 Ga0495672_0000032
874 Ga0495672_0000141
875 Ga0495672_0006210
876 Ga0495672_0123895
877 Ga0495676_0043551
878 Ga0495676_0051098
879 Ga0495683_0004190
880 Ga0495683_0005815
881 Ga0495683_0036403
882 Ga0495687_000173
883 Ga0495687_001010
884 Ga0495687_002259
885 Ga0495687_009416
886 Ga0495687_017487
887 Ga0495677_0000185
888 Ga0495677_0001794
889 Ga0495677_0020491
890 Ga0495685_000027
891 Ga0495673_0000006
892 Ga0495673_0000024
893 Ga0495673_0000141
894 Ga0495673_0025814
895 Ga0495673_0039632
896 Ga0495681_0000323
897 Ga0495681_0000900
898 Ga0495681_0005585
899 Ga0495686_0000147
900 Ga0495686_0000225
901 Ga0495686_0000407
902 Ga0495686_0000844
903 Ga0495686_0001226
904 Ga0495686_0001900
905 Ga0495686_0009599
906 Ga0495686_0012927
907 Ga0495686_0038895
908 Ga0495686_0047544
909 Ga0495626_0063968
910 Ga0496102_0122660
911 Ga0496103_0001278
912 Ga0496103_0002431
913 Ga0496113_0022033
914 Ga0496116_0009789
915 Ga0496116_0046608
916 Ga0496116_0081891
917 Ga0496116_0099483
918 Ga0496117_0000001
919 Ga0496117_0007559
920 Ga0496117_0014903
921 Ga0496117_0037156
922 Ga0496117_0100800
923 Ga0496118_0000008
924 Ga0496118_0031397
925 Ga0496119_0061244
926 Ga0496120_0046529
927 Ga0496120_0071956
928 Ga0496121_0003499
929 Ga0496121_0005228
930 Ga0496121_0005483
931 Ga0496121_0009467
932 Ga0496121_0015509
933 Ga0496121_0053674
934 Ga0496121_0056640
935 Ga0496122_0006027
936 Ga0496122_0006290
937 Ga0496122_0009790
938 Ga0496122_0017615
939 Ga0496122_0090148
940 Ga0496122_0161094
941 Ga0496123_0002569
942 Ga0496123_0003542
943 Ga0496123_0018098
944 Ga0496124_0125439
945 Ga0496125_0012910
946 Ga0496125_0018792
947 Ga0496125_0039508
948 Ga0496125_0089219
949 Ga0496126_0003811
950 Ga0496126_0050681
951 Ga0495678_000016
952 Ga0495678_000101
953 Ga0495678_004137
954 Ga0495678_009262
955 Ga0495678_043885
956 Ga0495682_0000388
957 Ga0495682_0000800
958 Ga0495682_0010270
959 Ga0501036_0085766
960 Ga0501249_000185
961 Ga0501269_000195
962 Ga0501044_0010579
963 Ga0500643_001312
964 Ga0500566_0143230
965 Ga0500641_0013166
966 Ga0500555_000072
967 Ga0500594_0024621
968 Ga0500594_0039531
969 Ga0500607_001611
970 Ga0500608_093429
971 Ga0500618_000816
972 Ga0500586_000584
973 Ga0500586_001585
974 Ga0500616_0003309
975 Ga0500624_000053
976 Ga0500645_003142
977 2601670763
978 2644254049
979 2738824918
980 2739148715
981 2739190634
982 2739317111
983 2739335352
984 2821133531
985 2842716861
986 2857552658
987 2857553659
988 2857561262
989 2857565324
990 2885086445
991 2904426632
992 2919481131
993 2932414974
994 2932419660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03009

GDPD

Glycerophosphoryl diester phosphodiesterase family

81

405

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pz0-assembly1.cif.gz_A crystal structure of glycerophosphodiester phosphodiesterase (gdpd) from t. tengcongensis 0.8569 20 350
5t91-assembly1.cif.gz_A crystal structure of b. subtilis 168 glpq in complex with bicine 0.8511 19 353
2pz0-assembly1.cif.gz_A crystal structure of glycerophosphodiester phosphodiesterase (gdpd) from t. tengcongensis 0.8502 20 350
3qvq-assembly1.cif.gz_D the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate 0.8466 20 351
5t9c-assembly1.cif.gz_E crystal structure of b. subtilis 168 glpq in complex with glycerol-3-phosphate (1 hour soak) 0.8374 15 353
ID Description Score Start End Superfamily
af_Q9FJ62_365_668_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8898 22 349 3.20.20.190
af_Q9SD81_43_361_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.887 24 345 3.20.20.190
af_Q9FJ62_365_668_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8814 22 349 3.20.20.190
af_Q9FGT9_39_339_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8771 19 349 3.20.20.190
af_I1KYF2_42_344_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8741 20 348 3.20.20.190
ID Description Score Start End GO Terms
AF-A0A2N7RM14-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.9943 53 350 GO:0006071
GO:0006629
GO:0008889
GO:0042597
AF-A0A4Q4CT74-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.991 21 167 GO:0006071
GO:0006629
GO:0008889
GO:0042597
AF-A0A534A915-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.9884 16 350 GO:0006071
GO:0006629
GO:0008889
GO:0042597
AF-A0A7Z0JEC4-F1-model_v4 deleted 0.9884 24 352
AF-U2GZQ8-F1-model_v4 glycerophosphodiester phosphodiesterase (EC 3.1.4.46) 0.9883 24 352 GO:0006071
GO:0006629
GO:0008889
GO:0042597

Map