F455019

General Info

Members Datasets Scaffolds Average Seq Length
497 248 994 92

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10717131|Ga0099794_107171311
Length 97
Sequence VNVAAEIKSRLAVLEPVEMELADESEQHRGHAGYQAGGSTHWRLSIVSPRFAGQPVVARHRMVYQALGSLMQNPIHALAITARAPEEKTAYETKGKQ

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
198 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
225 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.6
Rhizosphere 98.99
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10717131 3300007265 Bacteria 533
2 Ga0070690_100000048 3300005330 Bacteria 57196
3 Ga0070690_100088732 3300005330 Bacteria 2033
4 Ga0070690_100346515 3300005330 Bacteria 1077
5 Ga0070677_10208979 3300005333 Bacteria 946
6 Ga0068869_100001027 3300005334 Bacteria 16246
7 Ga0068869_100285668 3300005334 Bacteria 1328
8 Ga0068869_101387736 3300005334 Bacteria 621
9 Ga0070680_100002906 3300005336 Bacteria 12727
10 Ga0070680_100503128 3300005336 Bacteria 1037
11 Ga0070680_100571038 3300005336 Bacteria 970
12 Ga0070680_101534911 3300005336 Bacteria 577
13 Ga0070682_100023357 3300005337 Bacteria 3670
14 Ga0068868_100000169 3300005338 Bacteria 42949
15 Ga0068868_100859894 3300005338 Bacteria 822
16 Ga0068868_101023671 3300005338 Bacteria 756
17 Ga0068868_101787981 3300005338 Bacteria 580
18 Ga0070660_100756228 3300005339 Bacteria 816
19 Ga0070689_100017484 3300005340 Bacteria 5267
20 Ga0070689_100114623 3300005340 Bacteria 2147
21 Ga0070689_100327904 3300005340 Bacteria 1280
22 Ga0070691_10130126 3300005341 Bacteria 1275
23 Ga0070687_100000112 3300005343 Bacteria 27473
24 Ga0070687_100143529 3300005343 Bacteria 1393
25 Ga0070687_100190514 3300005343 Bacteria 1235
26 Ga0070687_100374067 3300005343 Bacteria 926
27 Ga0070687_100891121 3300005343 Bacteria 637
28 Ga0070687_101481236 3300005343 Bacteria 510
29 Ga0070692_10000771 3300005345 Bacteria 10540
30 Ga0070668_100023978 3300005347 Bacteria 4620
31 Ga0070669_100086453 3300005353 Bacteria 2343
32 Ga0070669_100436953 3300005353 Bacteria 1076
33 Ga0070675_100108184 3300005354 Bacteria 2348
34 Ga0070675_100390232 3300005354 Bacteria 1240
35 Ga0070675_101419036 3300005354 Bacteria 640
36 Ga0070671_100257041 3300005355 Bacteria 1484
37 Ga0070674_100132829 3300005356 Bacteria 1858
38 Ga0070674_101166890 3300005356 Bacteria 682
39 Ga0070673_100326443 3300005364 Bacteria 1357
40 Ga0070673_100961682 3300005364 Bacteria 794
41 Ga0070688_100114284 3300005365 Bacteria 1799
42 Ga0070688_100265161 3300005365 Unclassified 1228
43 Ga0070667_100492749 3300005367 Bacteria 1123
44 Ga0070703_10004412 3300005406 Bacteria 3959
45 Ga0070713_100761355 3300005436 Bacteria 927
46 Ga0070710_10757915 3300005437 Bacteria 690
47 Ga0070710_11111150 3300005437 Bacteria 581
48 Ga0070701_10001982 3300005438 Bacteria 7754
49 Ga0070701_10278475 3300005438 Bacteria 1020
50 Ga0070711_100266076 3300005439 Bacteria 1351
51 Ga0070711_101118799 3300005439 Bacteria 679
52 Ga0070705_100000991 3300005440 Bacteria 15853
53 Ga0070705_100080670 3300005440 Bacteria 1997
54 Ga0070705_100206234 3300005440 Bacteria 1351
55 Ga0070705_101670313 3300005440 Bacteria 537
56 Ga0070700_100000718 3300005441 Bacteria 16353
57 Ga0070694_100000608 3300005444 Bacteria 19748
58 Ga0070694_100080635 3300005444 Bacteria 2262
59 Ga0070694_100163404 3300005444 Bacteria 1636
60 Ga0070694_100889438 3300005444 Bacteria 735
61 Ga0070708_100320404 3300005445 Bacteria 1460
62 Ga0070678_100754943 3300005456 Unclassified 880
63 Ga0070662_101021258 3300005457 Unclassified 708
64 Ga0070681_10000198 3300005458 Bacteria 47037
65 Ga0070681_10050308 3300005458 Bacteria 4158
66 Ga0070681_11552438 3300005458 Bacteria 587
67 Ga0068867_100000568 3300005459 Bacteria 24458
68 Ga0068867_100005423 3300005459 Bacteria 9025
69 Ga0070685_10790072 3300005466 Bacteria 699
70 Ga0070706_100194838 3300005467 Bacteria 1893
71 Ga0070706_100549587 3300005467 Bacteria 1074
72 Ga0070698_100770959 3300005471 Bacteria 905
73 Ga0070699_100079266 3300005518 Bacteria 2861
74 Ga0070699_100513378 3300005518 Unclassified 1089
75 Ga0070679_100024440 3300005530 Bacteria 5920
76 Ga0070679_100070183 3300005530 Bacteria 3496
77 Ga0070679_102038435 3300005530 Bacteria 523
78 Ga0070684_102279497 3300005535 Bacteria 511
79 Ga0070697_100086669 3300005536 Bacteria 2584
80 Ga0070672_101118065 3300005543 Bacteria 700
81 Ga0070686_100002218 3300005544 Bacteria 10728
82 Ga0070686_100191479 3300005544 Bacteria 1460
83 Ga0070686_100406221 3300005544 Bacteria 1037
84 Ga0070686_100455870 3300005544 Unclassified 984
85 Ga0070686_100568833 3300005544 Unclassified 889
86 Ga0070686_100927331 3300005544 Bacteria 710
87 Ga0070695_100000176 3300005545 Bacteria 30422
88 Ga0070695_100015382 3300005545 Bacteria 4621
89 Ga0070695_100197123 3300005545 Bacteria 1437
90 Ga0070695_101288992 3300005545 Bacteria 603
91 Ga0070696_100000137 3300005546 Bacteria 39854
92 Ga0070696_100020823 3300005546 Bacteria 4444
93 Ga0070696_100553826 3300005546 Bacteria 922
94 Ga0070696_100561075 3300005546 Bacteria 916
95 Ga0070696_100815787 3300005546 Bacteria 769
96 Ga0070696_101655332 3300005546 Bacteria 551
97 Ga0070693_100001113 3300005547 Bacteria 12062
98 Ga0070693_101456281 3300005547 Bacteria 534
99 Ga0070704_100000057 3300005549 Bacteria 36313
100 Ga0070704_100194721 3300005549 Bacteria 1632
101 Ga0070704_100241369 3300005549 Bacteria 1479
102 Ga0070704_100555172 3300005549 Bacteria 1004
103 Ga0068855_100014696 3300005563 Bacteria 9431
104 Ga0068857_101162069 3300005577 Bacteria 747
105 Ga0068854_100025569 3300005578 Bacteria 4052
106 Ga0068856_100040246 3300005614 Bacteria 4590
107 Ga0070702_100000016 3300005615 Bacteria 48066
108 Ga0070702_101763626 3300005615 Bacteria 516
109 Ga0068852_100172613 3300005616 Bacteria 2028
110 Ga0068859_100011860 3300005617 Bacteria 8754
111 Ga0068859_102684091 3300005617 Bacteria 547
112 Ga0068864_100602830 3300005618 Bacteria 1066
113 Ga0068866_10000639 3300005718 Bacteria 15853
114 Ga0068866_10156297 3300005718 Bacteria 1325
115 Ga0068861_100000199 3300005719 Bacteria 32165
116 Ga0068861_100003289 3300005719 Bacteria 10698
117 Ga0068861_100352166 3300005719 Bacteria 1292
118 Ga0068858_100003393 3300005842 Bacteria 15847
119 Ga0068858_100398571 3300005842 Bacteria 1322
120 Ga0068860_100001230 3300005843 Bacteria 27942
121 Ga0068862_100010417 3300005844 Bacteria 7676
122 Ga0081539_10000842 3300005985 Bacteria 58746
123 Ga0070715_10186147 3300006163 Unclassified 1045
124 Ga0070715_10602877 3300006163 Unclassified 644
125 Ga0070716_100288946 3300006173 Bacteria 1135
126 Ga0097621_100001888 3300006237 Bacteria 14313
127 Ga0068871_100000120 3300006358 Bacteria 49031
128 Ga0075428_100224037 3300006844 Bacteria 2030
129 Ga0075430_100019424 3300006846 Bacteria 5778
130 Ga0075430_100043736 3300006846 Bacteria 3787
131 Ga0075430_100052922 3300006846 Bacteria 3419
132 Ga0075430_100346172 3300006846 Bacteria 1228
133 Ga0075431_100051327 3300006847 Bacteria 4254
134 Ga0075431_100192945 3300006847 Bacteria 2087
135 Ga0075431_100208669 3300006847 Bacteria 1996
136 Ga0075433_10222893 3300006852 Bacteria 1675
137 Ga0075433_10412386 3300006852 Bacteria 1191
138 Ga0075433_10606428 3300006852 Bacteria 961
139 Ga0075434_100001176 3300006871 Bacteria 21677
140 Ga0075434_100367120 3300006871 Bacteria 1460
141 Ga0075434_100928272 3300006871 Bacteria 885
142 Ga0075434_101253172 3300006871 Bacteria 753
143 Ga0075434_102225302 3300006871 Bacteria 552
144 Ga0075434_102230293 3300006871 Bacteria 551
145 Ga0075429_100101987 3300006880 Bacteria 2505
146 Ga0075429_100313271 3300006880 Bacteria 1374
147 Ga0075429_100737085 3300006880 Bacteria 863
148 Ga0068865_100001461 3300006881 Bacteria 13771
149 Ga0075436_100004890 3300006914 Bacteria 9208
150 Ga0075436_100112425 3300006914 Bacteria 1902
151 Ga0075436_100156081 3300006914 Bacteria 1607
152 Ga0075436_100703217 3300006914 Unclassified 749
153 Ga0097620_100011861 3300006931 Bacteria 8754
154 Ga0097620_102683949 3300006931 Bacteria 547
155 Ga0075435_100007630 3300007076 Bacteria 7725
156 Ga0075435_100031358 3300007076 Bacteria 4186
157 Ga0075435_100059766 3300007076 Bacteria 3089
158 Ga0075435_100061968 3300007076 Bacteria 3035
159 Ga0075435_100663223 3300007076 Unclassified 906
160 Ga0099794_10078706 3300007265 Bacteria 1624
161 Ga0105240_10472824 3300009093 Bacteria 1398
162 Ga0111539_10033666 3300009094 Bacteria 6220
163 Ga0111539_11823374 3300009094 Bacteria 705
164 Ga0105245_10000259 3300009098 Bacteria 50388
165 Ga0114129_10197912 3300009147 Bacteria 2724
166 Ga0114129_10363408 3300009147 Bacteria 1915
167 Ga0114129_12162947 3300009147 Bacteria 670
168 Ga0114129_12993148 3300009147 Bacteria 556
169 Ga0105243_10003095 3300009148 Bacteria 13686
170 Ga0105243_10016613 3300009148 Bacteria 5566
171 Ga0105241_10010209 3300009174 Bacteria 6897
172 Ga0105242_10001686 3300009176 Bacteria 17502
173 Ga0105249_10001070 3300009553 Bacteria 24290
174 Ga0105249_10023219 3300009553 Bacteria 5564
175 Ga0105239_11183685 3300010375 Unclassified 881
176 Ga0105246_10147965 3300011119 Bacteria 1774
177 Ga0157339_1002138 3300012505 Bacteria 1304
178 Ga0157371_10608074 3300013102 Unclassified 813
179 Ga0157378_10000576 3300013297 Bacteria 34686
180 Ga0157378_13317687 3300013297 Bacteria 500
181 Ga0163162_11115860 3300013306 Bacteria 894
182 Ga0157375_10166611 3300013308 Bacteria 2348
183 Ga0157380_10262624 3300014326 Bacteria 1569
184 Ga0157380_11136427 3300014326 Bacteria 822
185 Ga0157380_11908363 3300014326 Bacteria 655
186 Ga0157377_10183752 3300014745 Bacteria 1317
187 Ga0157377_10368495 3300014745 Unclassified 969
188 Ga0157379_10077084 3300014968 Bacteria 2985
189 Ga0157376_10003705 3300014969 Bacteria 10559
190 Ga0163161_10543588 3300017792 Bacteria 951
191 Ga0207697_10208468 3300025315 Bacteria 861
192 Ga0207653_10007424 3300025885 Bacteria 3418
193 Ga0207682_10040911 3300025893 Bacteria 1890
194 Ga0207642_10004297 3300025899 Bacteria 4591
195 Ga0207642_10068148 3300025899 Bacteria 1682
196 Ga0207688_10058842 3300025901 Bacteria 2163
197 Ga0207688_10735598 3300025901 Bacteria 624
198 Ga0207680_10139155 3300025903 Bacteria 1608
199 Ga0207647_10674587 3300025904 Bacteria 565
200 Ga0207685_10034792 3300025905 Bacteria 1833
201 Ga0207685_10276347 3300025905 Unclassified 822
202 Ga0207699_10322627 3300025906 Unclassified 1084
203 Ga0207645_10033286 3300025907 Bacteria 3313
204 Ga0207643_10035629 3300025908 Bacteria 2791
205 Ga0207643_10050732 3300025908 Bacteria 2353
206 Ga0207684_10367208 3300025910 Bacteria 1238
207 Ga0207684_10696694 3300025910 Bacteria 863
208 Ga0207654_10004685 3300025911 Bacteria 6919
209 Ga0207707_10003333 3300025912 Bacteria 14259
210 Ga0207707_10032557 3300025912 Bacteria 4563
211 Ga0207695_10428953 3300025913 Bacteria 1206
212 Ga0207660_10001156 3300025917 Bacteria 17635
213 Ga0207660_10130173 3300025917 Bacteria 1915
214 Ga0207660_10222180 3300025917 Bacteria 1483
215 Ga0207660_10640507 3300025917 Bacteria 866
216 Ga0207660_11150219 3300025917 Bacteria 632
217 Ga0207662_10000106 3300025918 Bacteria 40137
218 Ga0207662_10190014 3300025918 Bacteria 1325
219 Ga0207662_10949094 3300025918 Bacteria 610
220 Ga0207662_11009307 3300025918 Bacteria 591
221 Ga0207652_10007736 3300025921 Bacteria 8632
222 Ga0207652_10030844 3300025921 Bacteria 4494
223 Ga0207646_11218749 3300025922 Unclassified 659
224 Ga0207681_10256061 3300025923 Bacteria 1368
225 Ga0207681_10292908 3300025923 Bacteria 1285
226 Ga0207659_10324928 3300025926 Bacteria 1270
227 Ga0207659_11400965 3300025926 Bacteria 599
228 Ga0207687_10004274 3300025927 Bacteria 9553
229 Ga0207700_11001201 3300025928 Unclassified 748
230 Ga0207700_11490987 3300025928 Bacteria 600
231 Ga0207664_10108142 3300025929 Bacteria 2308
232 Ga0207644_10237076 3300025931 Bacteria 1451
233 Ga0207706_10994628 3300025933 Unclassified 705
234 Ga0207686_10000883 3300025934 Bacteria 18123
235 Ga0207709_10010275 3300025935 Bacteria 5156
236 Ga0207709_10097377 3300025935 Bacteria 1937
237 Ga0207670_10013405 3300025936 Bacteria 4832
238 Ga0207670_10239794 3300025936 Bacteria 1396
239 Ga0207670_10327597 3300025936 Bacteria 1207
240 Ga0207669_10110118 3300025937 Bacteria 1843
241 Ga0207704_10004222 3300025938 Bacteria 6564
242 Ga0207704_10007930 3300025938 Bacteria 5047
243 Ga0207665_10137418 3300025939 Bacteria 1740
244 Ga0207665_11597701 3300025939 Bacteria 517
245 Ga0207691_10482194 3300025940 Bacteria 1054
246 Ga0207689_10000376 3300025942 Bacteria 41990
247 Ga0207689_10062733 3300025942 Bacteria 3057
248 Ga0207689_10307246 3300025942 Bacteria 1315
249 Ga0207661_10975105 3300025944 Bacteria 781
250 Ga0207667_10053262 3300025949 Bacteria 4258
251 Ga0207651_10103282 3300025960 Bacteria 2121
252 Ga0207651_10913301 3300025960 Bacteria 782
253 Ga0207712_10005157 3300025961 Bacteria 8264
254 Ga0207712_10022019 3300025961 Bacteria 4191
255 Ga0207668_10016315 3300025972 Bacteria 4633
256 Ga0207640_10003801 3300025981 Bacteria 8135
257 Ga0207658_10777592 3300025986 Unclassified 868
258 Ga0207677_10004790 3300026023 Bacteria 7300
259 Ga0207677_10692225 3300026023 Bacteria 904
260 Ga0207677_10998056 3300026023 Bacteria 759
261 Ga0207677_12259725 3300026023 Bacteria 506
262 Ga0207703_10030779 3300026035 Bacteria 4241
263 Ga0207703_10031708 3300026035 Bacteria 4180
264 Ga0207703_10325779 3300026035 Bacteria 1408
265 Ga0207708_10000239 3300026075 Bacteria 43452
266 Ga0207702_10132457 3300026078 Bacteria 2245
267 Ga0207648_10000369 3300026089 Bacteria 49386
268 Ga0207648_10271331 3300026089 Bacteria 1515
269 Ga0207648_11802944 3300026089 Bacteria 574
270 Ga0207676_10070731 3300026095 Bacteria 2799
271 Ga0207674_10190867 3300026116 Bacteria 1999
272 Ga0207675_100002170 3300026118 Bacteria 19503
273 Ga0207675_100031022 3300026118 Bacteria 4978
274 Ga0207675_100512870 3300026118 Bacteria 1195
275 Ga0207683_10266465 3300026121 Bacteria 1565
276 Ga0207683_10536879 3300026121 Bacteria 1081
277 Ga0207698_10127358 3300026142 Bacteria 2168
278 Ga0207698_10511881 3300026142 Bacteria 1170
279 Ga0207698_10994263 3300026142 Bacteria 849
280 Ga0210000_1017757 3300027462 Bacteria 1079
281 Ga0209588_1052764 3300027671 Bacteria 1315
282 Ga0209966_1087564 3300027695 Unclassified 695
283 Ga0207428_10018223 3300027907 Bacteria 6001
284 Ga0268265_10000781 3300028380 Bacteria 30469
285 Ga0268265_10001333 3300028380 Bacteria 21108
286 Ga0268265_11559187 3300028380 Bacteria 665
287 Ga0268265_11627297 3300028380 Bacteria 651
288 Ga0268264_10001450 3300028381 Bacteria 22200
289 Ga0268264_10153016 3300028381 Bacteria 2070
290 Ga0307509_10314359 3300031507 Bacteria 1307
291 Ga0307408_100492364 3300031548 Bacteria 1072
292 Ga0307408_100502893 3300031548 Bacteria 1061
293 Ga0307408_100820975 3300031548 Bacteria 845
294 Ga0307405_10662541 3300031731 Bacteria 860
295 Ga0307410_10321938 3300031852 Bacteria 1227
296 Ga0307406_10790716 3300031901 Bacteria 800
297 Ga0307412_10821954 3300031911 Bacteria 808
298 Ga0307412_11939329 3300031911 Bacteria 544
299 Ga0307409_100651653 3300031995 Bacteria 1047
300 Ga0307416_100592256 3300032002 Bacteria 1187
301 Ga0307416_101194282 3300032002 Bacteria 866
302 Ga0307416_102005174 3300032002 Bacteria 681
303 Ga0307416_103034579 3300032002 Unclassified 562
304 Ga0307416_103481031 3300032002 Bacteria 527
305 Ga0307411_11235776 3300032005 Bacteria 678
306 Ga0307411_11691240 3300032005 Bacteria 585
307 Ga0307415_100442030 3300032126 Bacteria 1122
308 Ga0373958_0111548 3300034819 Bacteria 652
309 Ga0373938_0123236 3300034957 Bacteria 670
310 Ga0373928_0260897 3300035084 Bacteria 519
311 Ga0373940_0052250 3300035088 Bacteria 1151
312 Ga0373952_0011359 3300035092 Bacteria 1736
313 Ga0373932_0012440 3300035112 Bacteria 2096
314 Ga0373932_0222961 3300035112 Bacteria 678
315 Ga0373936_0315927 3300035113 Bacteria 707
316 Ga0373939_0289534 3300035114 Bacteria 650
317 Ga0373941_0043828 3300035115 Bacteria 1394
318 Ga0373955_0872025 3300035172 Bacteria 554
319 Ga0373942_0024912 3300035207 Bacteria 1538
320 Ga0373942_0137632 3300035207 Bacteria 775
321 Ga0373962_0038464 3300035242 Bacteria 1339
322 Ga0373962_0046677 3300035242 Bacteria 1237
323 Ga0373931_0004456 3300035691 Bacteria 6400
324 Ga0373931_0523077 3300035691 Bacteria 768
325 Ga0373935_1260828 3300035692 Bacteria 551
326 Ga0373927_0816679 3300035695 Bacteria 616
327 Ga0439465_0366389 3300041413 Bacteria 546
328 Ga0451839_1560890 3300041496 Unclassified 594
329 Ga0439446_0069811 3300042156 Bacteria 1073
330 Ga0453683_1228178 3300044673 Viruses 502
331 Ga0466965_0262711 3300044683 Bacteria 928
332 Ga0466964_0012360 3300044706 Bacteria 3231
333 Ga0466957_0285643 3300044842 Bacteria 1105
334 Ga0466960_0059709 3300044901 Bacteria 1867
335 Ga0466960_0484992 3300044901 Bacteria 722
336 Ga0451576_0812109 3300045051 Bacteria 982
337 Ga0466967_0019332 3300045976 Bacteria 5474
338 Ga0466967_1724925 3300045976 Unclassified 624
339 Ga0495584_0126625 3300046491 Bacteria 1295
340 Ga0495642_0012093 3300046528 Bacteria 3325
341 Ga0495642_0267259 3300046528 Bacteria 748
342 Ga0495598_0010783 3300046537 Bacteria 2198
343 Ga0495609_0299594 3300046538 Bacteria 655
344 Ga0495621_0103199 3300046539 Bacteria 1087
345 Ga0495659_0062664 3300046664 Bacteria 1377
346 Ga0495659_0313649 3300046664 Bacteria 665
347 Ga0495659_0571074 3300046664 Bacteria 500
348 Ga0495669_0005202 3300046684 Bacteria 5413
349 Ga0495669_0166445 3300046684 Bacteria 1048
350 Ga0495669_0384679 3300046684 Bacteria 679
351 Ga0496102_1604462 3300048905 Bacteria 569
352 Ga0496107_0705182 3300048910 Bacteria 742
353 Ga0496115_1313285 3300048918 Bacteria 538
354 Ga0501293_037440 3300049516 Bacteria 541
355 Ga0501301_023962 3300049524 Bacteria 607
356 Ga0501031_0037299 3300049568 Bacteria 3171
357 Ga0501031_0193950 3300049568 Bacteria 1326
358 Ga0501032_0088411 3300049569 Bacteria 2057
359 Ga0501032_0436799 3300049569 Bacteria 839
360 Ga0501033_0011373 3300049570 Bacteria 6810
361 Ga0501033_0458581 3300049570 Bacteria 885
362 Ga0501034_0261248 3300049571 Bacteria 1674
363 Ga0501036_0001921 3300049572 Bacteria 16137
364 Ga0501036_0141922 3300049572 Bacteria 2027
365 Ga0501036_0253333 3300049572 Bacteria 1475
366 Ga0501036_1235539 3300049572 Bacteria 608
367 Ga0501037_0013201 3300049573 Bacteria 6089
368 Ga0501038_0004982 3300049574 Bacteria 12341
369 Ga0501038_0438245 3300049574 Bacteria 1006
370 Ga0501038_0885398 3300049574 Bacteria 660
371 Ga0501039_0000477 3300049575 Bacteria 28990
372 Ga0501039_0023811 3300049575 Bacteria 4701
373 Ga0501039_0032666 3300049575 Bacteria 4013
374 Ga0501039_0033926 3300049575 Bacteria 3938
375 Ga0501039_0149631 3300049575 Bacteria 1834
376 Ga0501040_0000052 3300049576 Bacteria 54195
377 Ga0501040_0044660 3300049576 Bacteria 3021
378 Ga0501040_0394554 3300049576 Bacteria 993
379 Ga0501041_0000038 3300049577 Bacteria 44285
380 Ga0501041_0015993 3300049577 Bacteria 4459
381 Ga0501041_0091636 3300049577 Bacteria 1876
382 Ga0501041_0510027 3300049577 Bacteria 765
383 Ga0501042_0000048 3300049578 Bacteria 40877
384 Ga0501042_0019743 3300049578 Bacteria 4685
385 Ga0501042_0485866 3300049578 Bacteria 896
386 Ga0501043_0073970 3300049579 Bacteria 2676
387 Ga0501043_0097215 3300049579 Bacteria 2315
388 Ga0501046_0000271 3300049580 Bacteria 52841
389 Ga0501046_0102232 3300049580 Bacteria 2197
390 Ga0501046_0172344 3300049580 Bacteria 1623
391 Ga0501047_0091794 3300049581 Bacteria 2915
392 Ga0501048_0000378 3300049582 Bacteria 30854
393 Ga0501048_0062382 3300049582 Bacteria 2638
394 Ga0501048_0080562 3300049582 Bacteria 2297
395 Ga0501048_0160433 3300049582 Bacteria 1591
396 Ga0501067_0169966 3300049583 Bacteria 1214
397 Ga0501068_0277781 3300049584 Bacteria 1070
398 Ga0501068_0543227 3300049584 Bacteria 755
399 Ga0501069_0216710 3300049585 Bacteria 1112
400 Ga0501070_0031375 3300049586 Bacteria 4453
401 Ga0501071_0007914 3300049587 Bacteria 7009
402 Ga0501071_0027604 3300049587 Bacteria 3995
403 Ga0501071_0055468 3300049587 Bacteria 2861
404 Ga0501071_0278566 3300049587 Bacteria 1266
405 Ga0501072_0009822 3300049588 Bacteria 7274
406 Ga0501072_0028998 3300049588 Bacteria 4320
407 Ga0501072_0070038 3300049588 Bacteria 2770
408 Ga0501072_0098200 3300049588 Bacteria 2328
409 Ga0501072_0271499 3300049588 Bacteria 1349
410 Ga0501072_0306226 3300049588 Bacteria 1263
411 Ga0501072_0929067 3300049588 Bacteria 679
412 Ga0501074_0045830 3300049590 Bacteria 3162
413 Ga0501074_0093749 3300049590 Bacteria 2150
414 Ga0501074_0166044 3300049590 Bacteria 1576
415 Ga0501074_0620275 3300049590 Bacteria 764
416 Ga0501075_0000180 3300049591 Bacteria 32596
417 Ga0501075_0001243 3300049591 Bacteria 16533
418 Ga0501075_0072431 3300049591 Bacteria 2605
419 Ga0501075_0100349 3300049591 Bacteria 2198
420 Ga0501075_0228625 3300049591 Bacteria 1418
421 Ga0501076_0000290 3300049592 Bacteria 31327
422 Ga0501076_0000319 3300049592 Bacteria 29725
423 Ga0501076_0082862 3300049592 Bacteria 2575
424 Ga0501076_0136040 3300049592 Bacteria 1995
425 Ga0501076_0846385 3300049592 Bacteria 754
426 Ga0501077_0000222 3300049593 Bacteria 33397
427 Ga0501077_0027395 3300049593 Bacteria 3619
428 Ga0501077_0159900 3300049593 Bacteria 1430
429 Ga0501216_016209 3300049660 Bacteria 1263
430 Ga0501229_061600 3300049706 Bacteria 573
431 Ga0501079_0000061 3300049741 Bacteria 48925
432 Ga0501079_0174863 3300049741 Bacteria 1674
433 Ga0501079_0336404 3300049741 Bacteria 1182
434 Ga0501079_0406562 3300049741 Bacteria 1068
435 Ga0501079_1106605 3300049741 Unclassified 624
436 Ga0501079_1241305 3300049741 Bacteria 587
437 Ga0501080_0109325 3300049742 Bacteria 2562
438 Ga0501080_0111941 3300049742 Bacteria 2530
439 Ga0501080_1833097 3300049742 Bacteria 509
440 Ga0501081_0000110 3300049743 Bacteria 34989
441 Ga0501081_0001895 3300049743 Bacteria 12978
442 Ga0501081_0075471 3300049743 Bacteria 2354
443 Ga0501081_0156367 3300049743 Bacteria 1641
444 Ga0501083_0141938 3300049744 Bacteria 1573
445 Ga0501282_013241 3300049778 Bacteria 893
446 Ga0501035_0021364 3300049822 Bacteria 5950
447 Ga0501035_0892133 3300049822 Bacteria 705
448 Ga0501035_1248525 3300049822 Bacteria 575
449 Ga0501044_0078693 3300049823 Bacteria 3341
450 Ga0501045_0000038 3300049824 Bacteria 55579
451 Ga0501045_0010295 3300049824 Bacteria 6552
452 Ga0501045_0026558 3300049824 Bacteria 4166
453 Ga0501045_0085450 3300049824 Bacteria 2329
454 Ga0501045_0148296 3300049824 Bacteria 1745
455 Ga0501200_10430 3300049849 Bacteria 506
456 nmdc:mga05p37_301574_c1 3300050507 Bacteria 1903
457 nmdc:mga09592_302418_c1 3300050508 Bacteria 1387
458 nmdc:mga09592_71853_c1 3300050508 Bacteria 2938
459 nmdc:mga0qj67_14301_c1 3300050509 Bacteria 5998
460 nmdc:mga0qj67_199559_c1 3300050509 Bacteria 1626
461 nmdc:mga0qj67_39272_c1 3300050509 Bacteria 3716
462 nmdc:mga0qj67_4654_c1 3300050509 Bacteria 9956
463 nmdc:mga06r32_102759_c1 3300050510 Bacteria 2806
464 nmdc:mga06r32_406388_c1 3300050510 Bacteria 1344
465 nmdc:mga06r32_529634_c1 3300050510 Bacteria 1153
466 nmdc:mga08y16_79374_c1 3300050511 Bacteria 3421
467 nmdc:mga08y16_81130_c1 3300050511 Bacteria 3382
468 nmdc:mga0n895_10108_c1 3300050512 Bacteria 8308
469 nmdc:mga0n895_2141117_c1 3300050512 Bacteria 515
470 nmdc:mga0n895_807558_c1 3300050512 Bacteria 928
471 nmdc:mga0n895_834039_c1 3300050512 Bacteria 910
472 nmdc:mga0rr50_23790_c1 3300050513 Bacteria 4233
473 nmdc:mga0rr50_3830_c1 3300050513 Bacteria 8733
474 nmdc:mga0rr50_52825_c1 3300050513 Bacteria 3021
475 nmdc:mga0rr50_5530_c2 3300050513 Bacteria 6785
476 nmdc:mga0rr50_633685_c1 3300050513 Unclassified 912
477 nmdc:mga08x19_19481_c1 3300050514 Bacteria 4164
478 nmdc:mga08x19_41899_c2 3300050514 Bacteria 2029
479 nmdc:mga08x19_526190_c1 3300050514 Unclassified 836
480 nmdc:mga08x19_9530_c1 3300050514 Bacteria 5814
481 nmdc:mga0a205_16297_c1 3300050515 Bacteria 6959
482 nmdc:mga0a205_18247_c1 3300050515 Bacteria 6592
483 nmdc:mga0a205_449527_c1 3300050515 Bacteria 1148
484 nmdc:mga0a205_65539_c1 3300050515 Bacteria 3509
485 Ga0501084_0005924 3300054114 Bacteria 10067
486 Ga0501084_0018306 3300054114 Bacteria 5833
487 Ga0501084_0031213 3300054114 Bacteria 4456
488 Ga0501084_0500630 3300054114 Bacteria 1027
489 Ga0501084_1428923 3300054114 Bacteria 579
490 Ga0590071_057939 3300059421 Bacteria 944
491 Ga0590077_042421 3300059426 Bacteria 1013
492 Ga0590077_131414 3300059426 Bacteria 595
493 Ga0501082_0000430 3300060353 Bacteria 37227
494 Ga0501082_0012186 3300060353 Bacteria 7388
495 Ga0501082_1870299 3300060353 Bacteria 523
496 Ga0530510_0000048 3300061734 Bacteria 56268
497 Ga0530510_0000186 3300061734 Bacteria 37940
498 Ga0099794_10717131
499 Ga0070690_100000048
500 Ga0070690_100088732
501 Ga0070690_100346515
502 Ga0070677_10208979
503 Ga0068869_100001027
504 Ga0068869_100285668
505 Ga0068869_101387736
506 Ga0070680_100002906
507 Ga0070680_100503128
508 Ga0070680_100571038
509 Ga0070680_101534911
510 Ga0070682_100023357
511 Ga0068868_100000169
512 Ga0068868_100859894
513 Ga0068868_101023671
514 Ga0068868_101787981
515 Ga0070660_100756228
516 Ga0070689_100017484
517 Ga0070689_100114623
518 Ga0070689_100327904
519 Ga0070691_10130126
520 Ga0070687_100000112
521 Ga0070687_100143529
522 Ga0070687_100190514
523 Ga0070687_100374067
524 Ga0070687_100891121
525 Ga0070687_101481236
526 Ga0070692_10000771
527 Ga0070668_100023978
528 Ga0070669_100086453
529 Ga0070669_100436953
530 Ga0070675_100108184
531 Ga0070675_100390232
532 Ga0070675_101419036
533 Ga0070671_100257041
534 Ga0070674_100132829
535 Ga0070674_101166890
536 Ga0070673_100326443
537 Ga0070673_100961682
538 Ga0070688_100114284
539 Ga0070688_100265161
540 Ga0070667_100492749
541 Ga0070703_10004412
542 Ga0070713_100761355
543 Ga0070710_10757915
544 Ga0070710_11111150
545 Ga0070701_10001982
546 Ga0070701_10278475
547 Ga0070711_100266076
548 Ga0070711_101118799
549 Ga0070705_100000991
550 Ga0070705_100080670
551 Ga0070705_100206234
552 Ga0070705_101670313
553 Ga0070700_100000718
554 Ga0070694_100000608
555 Ga0070694_100080635
556 Ga0070694_100163404
557 Ga0070694_100889438
558 Ga0070708_100320404
559 Ga0070678_100754943
560 Ga0070662_101021258
561 Ga0070681_10000198
562 Ga0070681_10050308
563 Ga0070681_11552438
564 Ga0068867_100000568
565 Ga0068867_100005423
566 Ga0070685_10790072
567 Ga0070706_100194838
568 Ga0070706_100549587
569 Ga0070698_100770959
570 Ga0070699_100079266
571 Ga0070699_100513378
572 Ga0070679_100024440
573 Ga0070679_100070183
574 Ga0070679_102038435
575 Ga0070684_102279497
576 Ga0070697_100086669
577 Ga0070672_101118065
578 Ga0070686_100002218
579 Ga0070686_100191479
580 Ga0070686_100406221
581 Ga0070686_100455870
582 Ga0070686_100568833
583 Ga0070686_100927331
584 Ga0070695_100000176
585 Ga0070695_100015382
586 Ga0070695_100197123
587 Ga0070695_101288992
588 Ga0070696_100000137
589 Ga0070696_100020823
590 Ga0070696_100553826
591 Ga0070696_100561075
592 Ga0070696_100815787
593 Ga0070696_101655332
594 Ga0070693_100001113
595 Ga0070693_101456281
596 Ga0070704_100000057
597 Ga0070704_100194721
598 Ga0070704_100241369
599 Ga0070704_100555172
600 Ga0068855_100014696
601 Ga0068857_101162069
602 Ga0068854_100025569
603 Ga0068856_100040246
604 Ga0070702_100000016
605 Ga0070702_101763626
606 Ga0068852_100172613
607 Ga0068859_100011860
608 Ga0068859_102684091
609 Ga0068864_100602830
610 Ga0068866_10000639
611 Ga0068866_10156297
612 Ga0068861_100000199
613 Ga0068861_100003289
614 Ga0068861_100352166
615 Ga0068858_100003393
616 Ga0068858_100398571
617 Ga0068860_100001230
618 Ga0068862_100010417
619 Ga0081539_10000842
620 Ga0070715_10186147
621 Ga0070715_10602877
622 Ga0070716_100288946
623 Ga0097621_100001888
624 Ga0068871_100000120
625 Ga0075428_100224037
626 Ga0075430_100019424
627 Ga0075430_100043736
628 Ga0075430_100052922
629 Ga0075430_100346172
630 Ga0075431_100051327
631 Ga0075431_100192945
632 Ga0075431_100208669
633 Ga0075433_10222893
634 Ga0075433_10412386
635 Ga0075433_10606428
636 Ga0075434_100001176
637 Ga0075434_100367120
638 Ga0075434_100928272
639 Ga0075434_101253172
640 Ga0075434_102225302
641 Ga0075434_102230293
642 Ga0075429_100101987
643 Ga0075429_100313271
644 Ga0075429_100737085
645 Ga0068865_100001461
646 Ga0075436_100004890
647 Ga0075436_100112425
648 Ga0075436_100156081
649 Ga0075436_100703217
650 Ga0097620_100011861
651 Ga0097620_102683949
652 Ga0075435_100007630
653 Ga0075435_100031358
654 Ga0075435_100059766
655 Ga0075435_100061968
656 Ga0075435_100663223
657 Ga0099794_10078706
658 Ga0105240_10472824
659 Ga0111539_10033666
660 Ga0111539_11823374
661 Ga0105245_10000259
662 Ga0114129_10197912
663 Ga0114129_10363408
664 Ga0114129_12162947
665 Ga0114129_12993148
666 Ga0105243_10003095
667 Ga0105243_10016613
668 Ga0105241_10010209
669 Ga0105242_10001686
670 Ga0105249_10001070
671 Ga0105249_10023219
672 Ga0105239_11183685
673 Ga0105246_10147965
674 Ga0157339_1002138
675 Ga0157371_10608074
676 Ga0157378_10000576
677 Ga0157378_13317687
678 Ga0163162_11115860
679 Ga0157375_10166611
680 Ga0157380_10262624
681 Ga0157380_11136427
682 Ga0157380_11908363
683 Ga0157377_10183752
684 Ga0157377_10368495
685 Ga0157379_10077084
686 Ga0157376_10003705
687 Ga0163161_10543588
688 Ga0207697_10208468
689 Ga0207653_10007424
690 Ga0207682_10040911
691 Ga0207642_10004297
692 Ga0207642_10068148
693 Ga0207688_10058842
694 Ga0207688_10735598
695 Ga0207680_10139155
696 Ga0207647_10674587
697 Ga0207685_10034792
698 Ga0207685_10276347
699 Ga0207699_10322627
700 Ga0207645_10033286
701 Ga0207643_10035629
702 Ga0207643_10050732
703 Ga0207684_10367208
704 Ga0207684_10696694
705 Ga0207654_10004685
706 Ga0207707_10003333
707 Ga0207707_10032557
708 Ga0207695_10428953
709 Ga0207660_10001156
710 Ga0207660_10130173
711 Ga0207660_10222180
712 Ga0207660_10640507
713 Ga0207660_11150219
714 Ga0207662_10000106
715 Ga0207662_10190014
716 Ga0207662_10949094
717 Ga0207662_11009307
718 Ga0207652_10007736
719 Ga0207652_10030844
720 Ga0207646_11218749
721 Ga0207681_10256061
722 Ga0207681_10292908
723 Ga0207659_10324928
724 Ga0207659_11400965
725 Ga0207687_10004274
726 Ga0207700_11001201
727 Ga0207700_11490987
728 Ga0207664_10108142
729 Ga0207644_10237076
730 Ga0207706_10994628
731 Ga0207686_10000883
732 Ga0207709_10010275
733 Ga0207709_10097377
734 Ga0207670_10013405
735 Ga0207670_10239794
736 Ga0207670_10327597
737 Ga0207669_10110118
738 Ga0207704_10004222
739 Ga0207704_10007930
740 Ga0207665_10137418
741 Ga0207665_11597701
742 Ga0207691_10482194
743 Ga0207689_10000376
744 Ga0207689_10062733
745 Ga0207689_10307246
746 Ga0207661_10975105
747 Ga0207667_10053262
748 Ga0207651_10103282
749 Ga0207651_10913301
750 Ga0207712_10005157
751 Ga0207712_10022019
752 Ga0207668_10016315
753 Ga0207640_10003801
754 Ga0207658_10777592
755 Ga0207677_10004790
756 Ga0207677_10692225
757 Ga0207677_10998056
758 Ga0207677_12259725
759 Ga0207703_10030779
760 Ga0207703_10031708
761 Ga0207703_10325779
762 Ga0207708_10000239
763 Ga0207702_10132457
764 Ga0207648_10000369
765 Ga0207648_10271331
766 Ga0207648_11802944
767 Ga0207676_10070731
768 Ga0207674_10190867
769 Ga0207675_100002170
770 Ga0207675_100031022
771 Ga0207675_100512870
772 Ga0207683_10266465
773 Ga0207683_10536879
774 Ga0207698_10127358
775 Ga0207698_10511881
776 Ga0207698_10994263
777 Ga0210000_1017757
778 Ga0209588_1052764
779 Ga0209966_1087564
780 Ga0207428_10018223
781 Ga0268265_10000781
782 Ga0268265_10001333
783 Ga0268265_11559187
784 Ga0268265_11627297
785 Ga0268264_10001450
786 Ga0268264_10153016
787 Ga0307509_10314359
788 Ga0307408_100492364
789 Ga0307408_100502893
790 Ga0307408_100820975
791 Ga0307405_10662541
792 Ga0307410_10321938
793 Ga0307406_10790716
794 Ga0307412_10821954
795 Ga0307412_11939329
796 Ga0307409_100651653
797 Ga0307416_100592256
798 Ga0307416_101194282
799 Ga0307416_102005174
800 Ga0307416_103034579
801 Ga0307416_103481031
802 Ga0307411_11235776
803 Ga0307411_11691240
804 Ga0307415_100442030
805 Ga0373958_0111548
806 Ga0373938_0123236
807 Ga0373928_0260897
808 Ga0373940_0052250
809 Ga0373952_0011359
810 Ga0373932_0012440
811 Ga0373932_0222961
812 Ga0373936_0315927
813 Ga0373939_0289534
814 Ga0373941_0043828
815 Ga0373955_0872025
816 Ga0373942_0024912
817 Ga0373942_0137632
818 Ga0373962_0038464
819 Ga0373962_0046677
820 Ga0373931_0004456
821 Ga0373931_0523077
822 Ga0373935_1260828
823 Ga0373927_0816679
824 Ga0439465_0366389
825 Ga0451839_1560890
826 Ga0439446_0069811
827 Ga0453683_1228178
828 Ga0466965_0262711
829 Ga0466964_0012360
830 Ga0466957_0285643
831 Ga0466960_0059709
832 Ga0466960_0484992
833 Ga0451576_0812109
834 Ga0466967_0019332
835 Ga0466967_1724925
836 Ga0495584_0126625
837 Ga0495642_0012093
838 Ga0495642_0267259
839 Ga0495598_0010783
840 Ga0495609_0299594
841 Ga0495621_0103199
842 Ga0495659_0062664
843 Ga0495659_0313649
844 Ga0495659_0571074
845 Ga0495669_0005202
846 Ga0495669_0166445
847 Ga0495669_0384679
848 Ga0496102_1604462
849 Ga0496107_0705182
850 Ga0496115_1313285
851 Ga0501293_037440
852 Ga0501301_023962
853 Ga0501031_0037299
854 Ga0501031_0193950
855 Ga0501032_0088411
856 Ga0501032_0436799
857 Ga0501033_0011373
858 Ga0501033_0458581
859 Ga0501034_0261248
860 Ga0501036_0001921
861 Ga0501036_0141922
862 Ga0501036_0253333
863 Ga0501036_1235539
864 Ga0501037_0013201
865 Ga0501038_0004982
866 Ga0501038_0438245
867 Ga0501038_0885398
868 Ga0501039_0000477
869 Ga0501039_0023811
870 Ga0501039_0032666
871 Ga0501039_0033926
872 Ga0501039_0149631
873 Ga0501040_0000052
874 Ga0501040_0044660
875 Ga0501040_0394554
876 Ga0501041_0000038
877 Ga0501041_0015993
878 Ga0501041_0091636
879 Ga0501041_0510027
880 Ga0501042_0000048
881 Ga0501042_0019743
882 Ga0501042_0485866
883 Ga0501043_0073970
884 Ga0501043_0097215
885 Ga0501046_0000271
886 Ga0501046_0102232
887 Ga0501046_0172344
888 Ga0501047_0091794
889 Ga0501048_0000378
890 Ga0501048_0062382
891 Ga0501048_0080562
892 Ga0501048_0160433
893 Ga0501067_0169966
894 Ga0501068_0277781
895 Ga0501068_0543227
896 Ga0501069_0216710
897 Ga0501070_0031375
898 Ga0501071_0007914
899 Ga0501071_0027604
900 Ga0501071_0055468
901 Ga0501071_0278566
902 Ga0501072_0009822
903 Ga0501072_0028998
904 Ga0501072_0070038
905 Ga0501072_0098200
906 Ga0501072_0271499
907 Ga0501072_0306226
908 Ga0501072_0929067
909 Ga0501074_0045830
910 Ga0501074_0093749
911 Ga0501074_0166044
912 Ga0501074_0620275
913 Ga0501075_0000180
914 Ga0501075_0001243
915 Ga0501075_0072431
916 Ga0501075_0100349
917 Ga0501075_0228625
918 Ga0501076_0000290
919 Ga0501076_0000319
920 Ga0501076_0082862
921 Ga0501076_0136040
922 Ga0501076_0846385
923 Ga0501077_0000222
924 Ga0501077_0027395
925 Ga0501077_0159900
926 Ga0501216_016209
927 Ga0501229_061600
928 Ga0501079_0000061
929 Ga0501079_0174863
930 Ga0501079_0336404
931 Ga0501079_0406562
932 Ga0501079_1106605
933 Ga0501079_1241305
934 Ga0501080_0109325
935 Ga0501080_0111941
936 Ga0501080_1833097
937 Ga0501081_0000110
938 Ga0501081_0001895
939 Ga0501081_0075471
940 Ga0501081_0156367
941 Ga0501083_0141938
942 Ga0501282_013241
943 Ga0501035_0021364
944 Ga0501035_0892133
945 Ga0501035_1248525
946 Ga0501044_0078693
947 Ga0501045_0000038
948 Ga0501045_0010295
949 Ga0501045_0026558
950 Ga0501045_0085450
951 Ga0501045_0148296
952 Ga0501200_10430
953 nmdc:mga05p37_301574_c1
954 nmdc:mga09592_302418_c1
955 nmdc:mga09592_71853_c1
956 nmdc:mga0qj67_14301_c1
957 nmdc:mga0qj67_199559_c1
958 nmdc:mga0qj67_39272_c1
959 nmdc:mga0qj67_4654_c1
960 nmdc:mga06r32_102759_c1
961 nmdc:mga06r32_406388_c1
962 nmdc:mga06r32_529634_c1
963 nmdc:mga08y16_79374_c1
964 nmdc:mga08y16_81130_c1
965 nmdc:mga0n895_10108_c1
966 nmdc:mga0n895_2141117_c1
967 nmdc:mga0n895_807558_c1
968 nmdc:mga0n895_834039_c1
969 nmdc:mga0rr50_23790_c1
970 nmdc:mga0rr50_3830_c1
971 nmdc:mga0rr50_52825_c1
972 nmdc:mga0rr50_5530_c2
973 nmdc:mga0rr50_633685_c1
974 nmdc:mga08x19_19481_c1
975 nmdc:mga08x19_41899_c2
976 nmdc:mga08x19_526190_c1
977 nmdc:mga08x19_9530_c1
978 nmdc:mga0a205_16297_c1
979 nmdc:mga0a205_18247_c1
980 nmdc:mga0a205_449527_c1
981 nmdc:mga0a205_65539_c1
982 Ga0501084_0005924
983 Ga0501084_0018306
984 Ga0501084_0031213
985 Ga0501084_0500630
986 Ga0501084_1428923
987 Ga0590071_057939
988 Ga0590077_042421
989 Ga0590077_131414
990 Ga0501082_0000430
991 Ga0501082_0012186
992 Ga0501082_1870299
993 Ga0530510_0000048
994 Ga0530510_0000186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

11

87

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9277 1 87
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9105 1 87
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9029 1 87
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.886 1 87
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8795 1 89
ID Description Score Start End Superfamily
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9428 1 89 3.10.20.90
af_Q54G84_40_127_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9318 2 86 3.30.300.90
af_Q5AKW1_24_116_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9208 3 87 3.30.300.90
af_P39724_22_112_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9207 1 84 3.10.20.90
af_P91375_6_86_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9124 1 82 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A1P8FPZ8-F1-model_v4 BolA family transcriptional regulator 0.9957 1 87 GO:0016226
AF-A1B376-F1-model_v4 BolA family protein 0.9876 2 83 GO:0016226
AF-A0A2K9MD57-F1-model_v4 BolA family transcriptional regulator 0.9855 2 82 GO:0016226
AF-E2CDZ0-F1-model_v4 Protein BolA 0.9776 1 86 GO:0016226
AF-A0A1X7PPS2-F1-model_v4 deleted 0.9742 1 88

Map