F455034

General Info

Members Datasets Scaffolds Average Seq Length
497 273 485 225

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10257023|Ga0157370_102570233
Length 261
Sequence MTADIDRTVMSGLGASPGEAPVSSSGSDVSFGVFLALAGLVLMTPAPARAGASVQVPRSELSKADVRVAERKAGPSAEASRVADWIATSGDNGTLPYMIVDKKGASLLLFGANGKLRGQAPVLVGIAAGDDATPGVGSKKLAEIGPAEKTTPAGRFLAKYGLAAGRQKVLWVDYAASVALHPIPKDASPKERRRQRMLSPTADDHRITFGCINVPMAFYSKRVRPLFQKKGGYVYVLPDTKPLEVVFPSLRAQTSAIASAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
10 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
11 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
12 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
13 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
14 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
251 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
252 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
257 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
258 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
261 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
267 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.4
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 9.26
Nodule 0.2
Rhizoplane 3.22
Rhizosphere 76.26
Stem 0
Stem Tuber 0
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1197694 2162886007 Bacteria 7213
2 ARcpr5oldR_c001533 3300000041 Bacteria 2304
3 ARcpr5yngRDRAFT_c000712 3300000043 Bacteria 4093
4 JGI24736J21556_1008434 3300001904 Bacteria 1714
5 JGI24741J21665_1002345 3300001915 Bacteria 4958
6 JGI24740J21852_10003148 3300001979 Bacteria 7282
7 JGI24737J22298_10003071 3300001990 Bacteria 5917
8 JGI24737J22298_10034196 3300001990 Bacteria 1576
9 JGI24735J21928_10013949 3300002067 Bacteria 2520
10 JGI24738J21930_10002675 3300002075 Bacteria 4591
11 JGI24751J29686_10003506 3300002459 Bacteria 3160
12 JGI25153J46596_10003189 3300003215 Bacteria 9234
13 rootH1_10030114 3300003316 Bacteria 2205
14 rootL2_10073650 3300003322 Bacteria 6722
15 rootH1_10234626 3300003323 Bacteria 1631
16 rootH1_10246499 3300003323 Bacteria 1841
17 Ga0055525_1000248 3300003759 Bacteria 54342
18 Ga0055542_1000040 3300003762 Bacteria 214035
19 Ga0055529_1000037 3300003763 Bacteria 237307
20 Ga0055537_1001264 3300003773 Bacteria 10566
21 Ga0055524_1000118 3300003775 Bacteria 93202
22 Ga0055530_10000167 3300003791 Bacteria 59916
23 Ga0055531_10000896 3300003794 Bacteria 24336
24 Ga0055543_1006980 3300004625 Bacteria 2662
25 Ga0065165_1002332 3300005262 Bacteria 16563
26 Ga0065165_1008392 3300005262 Bacteria 4846
27 Ga0065704_10074353 3300005289 Bacteria 6338
28 Ga0070658_10002746 3300005327 Bacteria 14654
29 Ga0070658_10015930 3300005327 Bacteria 6012
30 Ga0070658_10026308 3300005327 Bacteria 4667
31 Ga0070658_10267576 3300005327 Bacteria 1453
32 Ga0070676_10009608 3300005328 Bacteria 5226
33 Ga0070676_10032400 3300005328 Bacteria 2994
34 Ga0070670_100109663 3300005331 Bacteria 2378
35 Ga0070677_10001169 3300005333 Bacteria 8423
36 Ga0068869_100000110 3300005334 Bacteria 39194
37 Ga0068868_100001844 3300005338 Bacteria 14554
38 Ga0070660_100007691 3300005339 Bacteria 7509
39 Ga0070660_100038263 3300005339 Bacteria 3641
40 Ga0070660_100124866 3300005339 Bacteria 2056
41 Ga0070661_100026753 3300005344 Bacteria 4150
42 Ga0070668_100068760 3300005347 Bacteria 2754
43 Ga0070668_100086391 3300005347 Bacteria 2466
44 Ga0070668_100169664 3300005347 Bacteria 1776
45 Ga0070675_100011520 3300005354 Bacteria 6926
46 Ga0070671_100025281 3300005355 Bacteria 4871
47 Ga0070671_100033448 3300005355 Bacteria 4252
48 Ga0070671_100066599 3300005355 Bacteria 3002
49 Ga0070671_100453150 3300005355 Bacteria 1101
50 Ga0070674_100000945 3300005356 Bacteria 15148
51 Ga0070674_100017665 3300005356 Bacteria 4495
52 Ga0070674_100061710 3300005356 Bacteria 2617
53 Ga0070673_100000017 3300005364 Bacteria 112829
54 Ga0070673_100072432 3300005364 Bacteria 2771
55 Ga0070673_100099227 3300005364 Bacteria 2395
56 Ga0070673_100296259 3300005364 Bacteria 1423
57 Ga0070659_100014806 3300005366 Bacteria 5831
58 Ga0070659_100025668 3300005366 Bacteria 4528
59 Ga0070659_100359071 3300005366 Bacteria 1224
60 Ga0070667_100394149 3300005367 Bacteria 1259
61 Ga0070663_100001458 3300005455 Bacteria 12998
62 Ga0070663_100107404 3300005455 Bacteria 2092
63 Ga0070663_100150047 3300005455 Bacteria 1787
64 Ga0070663_100540594 3300005455 Bacteria 972
65 Ga0070678_100000861 3300005456 Bacteria 15487
66 Ga0070678_100002552 3300005456 Bacteria 9994
67 Ga0070678_100173827 3300005456 Bacteria 1757
68 Ga0070662_100159037 3300005457 Bacteria 1766
69 Ga0070662_100385009 3300005457 Bacteria 1155
70 Ga0068867_100000013 3300005459 Bacteria 112835
71 Ga0068867_100031655 3300005459 Bacteria 3821
72 Ga0068867_100422514 3300005459 Bacteria 1129
73 Ga0070684_100403731 3300005535 Bacteria 1260
74 Ga0068853_100006801 3300005539 Bacteria 9119
75 Ga0068853_100104218 3300005539 Bacteria 2511
76 Ga0068853_100115925 3300005539 Bacteria 2385
77 Ga0070672_100006338 3300005543 Bacteria 7941
78 Ga0070672_100076068 3300005543 Bacteria 2681
79 Ga0070665_100000023 3300005548 Bacteria 375278
80 Ga0070665_100043740 3300005548 Bacteria 4500
81 Ga0070665_100060709 3300005548 Bacteria 3790
82 Ga0070665_100099649 3300005548 Bacteria 2910
83 Ga0068855_100006889 3300005563 Bacteria 13787
84 Ga0068855_100060554 3300005563 Bacteria 4427
85 Ga0068855_100063217 3300005563 Bacteria 4320
86 Ga0068855_100085390 3300005563 Bacteria 3652
87 Ga0068855_100469063 3300005563 Bacteria 1372
88 Ga0070664_100007009 3300005564 Bacteria 9092
89 Ga0068857_100353321 3300005577 Bacteria 1361
90 Ga0068854_100000263 3300005578 Bacteria 35721
91 Ga0068854_100035323 3300005578 Bacteria 3497
92 Ga0068854_100097311 3300005578 Bacteria 2200
93 Ga0068854_100161786 3300005578 Bacteria 1734
94 Ga0068854_100175708 3300005578 Bacteria 1669
95 Ga0068854_100190697 3300005578 Bacteria 1606
96 Ga0068852_100001753 3300005616 Bacteria 14767
97 Ga0068852_100071343 3300005616 Bacteria 3050
98 Ga0068852_100089261 3300005616 Bacteria 2754
99 Ga0068852_100115335 3300005616 Bacteria 2449
100 Ga0068852_100350824 3300005616 Bacteria 1441
101 Ga0068852_100710703 3300005616 Bacteria 1015
102 Ga0068852_100778234 3300005616 Bacteria 970
103 Ga0068859_100001448 3300005617 Bacteria 24068
104 Ga0068859_100087499 3300005617 Bacteria 3164
105 Ga0068859_100089056 3300005617 Bacteria 3136
106 Ga0068864_100322004 3300005618 Bacteria 1452
107 Ga0068861_100003542 3300005719 Bacteria 10382
108 Ga0068861_100076910 3300005719 Bacteria 2602
109 Ga0068851_10027759 3300005834 Bacteria 2791
110 Ga0068851_10064832 3300005834 Bacteria 1878
111 Ga0068863_100025656 3300005841 Bacteria 5621
112 Ga0068858_100000585 3300005842 Bacteria 38250
113 Ga0068858_100002560 3300005842 Bacteria 18326
114 Ga0068858_100024796 3300005842 Bacteria 5584
115 Ga0068858_100118549 3300005842 Bacteria 2474
116 Ga0068860_100006786 3300005843 Bacteria 11476
117 Ga0075432_10001145 3300006058 Bacteria 8488
118 Ga0097621_100017199 3300006237 Bacteria 5488
119 Ga0068865_100000007 3300006881 Bacteria 185316
120 Ga0068865_100100419 3300006881 Bacteria 2117
121 Ga0097620_100001448 3300006931 Bacteria 24068
122 Ga0097620_100087503 3300006931 Bacteria 3164
123 Ga0097620_100089055 3300006931 Bacteria 3136
124 Ga0079104_1017921 3300006946 Bacteria 2021
125 Ga0105251_10007311 3300009011 Bacteria 6834
126 Ga0105240_10013485 3300009093 Bacteria 11226
127 Ga0105240_10529693 3300009093 Bacteria 1306
128 Ga0105245_10001680 3300009098 Bacteria 20105
129 Ga0105245_10002989 3300009098 Bacteria 15157
130 Ga0105247_10001053 3300009101 Bacteria 20679
131 Ga0105243_10000118 3300009148 Bacteria 91438
132 Ga0105243_10000223 3300009148 Bacteria 65335
133 Ga0105243_10288475 3300009148 Bacteria 1482
134 Ga0105241_10004598 3300009174 Bacteria 10212
135 Ga0105241_10046419 3300009174 Bacteria 3299
136 Ga0105242_10000221 3300009176 Bacteria 44918
137 Ga0105242_10153788 3300009176 Bacteria 2008
138 Ga0105248_10010411 3300009177 Bacteria 10241
139 Ga0105248_10076217 3300009177 Bacteria 3769
140 Ga0105239_10000113 3300010375 Bacteria 114562
141 Ga0105239_10032266 3300010375 Bacteria 5756
142 Ga0105246_10000135 3300011119 Bacteria 34300
143 Ga0157373_10087832 3300013100 Bacteria 2190
144 Ga0157373_10124552 3300013100 Bacteria 1812
145 Ga0157373_10181294 3300013100 Bacteria 1483
146 Ga0157371_10000029 3300013102 Bacteria 252131
147 Ga0157370_10257023 3300013104 Bacteria 1615
148 Ga0157369_10216349 3300013105 Bacteria 2007
149 Ga0157374_10000495 3300013296 Bacteria 35710
150 Ga0157374_10014640 3300013296 Bacteria 6865
151 Ga0157374_10045074 3300013296 Bacteria 4081
152 Ga0157378_10023883 3300013297 Bacteria 5377
153 Ga0157378_10160391 3300013297 Bacteria 2103
154 Ga0163162_10006991 3300013306 Bacteria 10946
155 Ga0163162_10013407 3300013306 Bacteria 8002
156 Ga0163162_10115278 3300013306 Bacteria 2787
157 Ga0157372_10077346 3300013307 Bacteria 3758
158 Ga0157372_10162863 3300013307 Bacteria 2578
159 Ga0157372_10446426 3300013307 Bacteria 1507
160 Ga0157375_10001334 3300013308 Bacteria 21270
161 Ga0163163_10036592 3300014325 Bacteria 4770
162 Ga0157380_10041044 3300014326 Bacteria 3609
163 Ga0157377_10012797 3300014745 Bacteria 4229
164 Ga0157379_10063918 3300014968 Bacteria 3290
165 Ga0157376_10000081 3300014969 Bacteria 72584
166 Ga0209147_101282 3300025229 Bacteria 9780
167 Ga0209563_100066 3300025230 Bacteria 257382
168 Ga0207425_1019819 3300025245 Bacteria 1444
169 Ga0209646_1003676 3300025246 Bacteria 2962
170 Ga0209148_1000011 3300025254 Bacteria 1196503
171 Ga0209233_1000104 3300025261 Bacteria 272675
172 Ga0209565_1000011 3300025263 Bacteria 637062
173 Ga0209455_1000006 3300025272 Bacteria 1196503
174 Ga0209673_1000827 3300025273 Bacteria 40748
175 Ga0209758_1003487 3300025297 Bacteria 14238
176 Ga0209050_1002806 3300025298 Bacteria 13916
177 Ga0209256_1000016 3300025299 Bacteria 599092
178 Ga0209257_1002579 3300025304 Bacteria 17622
179 Ga0209257_1012327 3300025304 Bacteria 3972
180 Ga0207697_10091203 3300025315 Bacteria 1291
181 Ga0207656_10003253 3300025321 Bacteria 5561
182 Ga0207713_1094055 3300025735 Bacteria 1047
183 Ga0207682_10000147 3300025893 Bacteria 31656
184 Ga0207680_10127544 3300025903 Bacteria 1672
185 Ga0207647_10000554 3300025904 Bacteria 29668
186 Ga0207647_10033352 3300025904 Bacteria 3298
187 Ga0207645_10014423 3300025907 Bacteria 5287
188 Ga0207645_10014914 3300025907 Bacteria 5183
189 Ga0207705_10000042 3300025909 Bacteria 182120
190 Ga0207705_10000255 3300025909 Bacteria 51846
191 Ga0207705_10030679 3300025909 Bacteria 3836
192 Ga0207705_10401723 3300025909 Bacteria 1060
193 Ga0207654_10003710 3300025911 Bacteria 7708
194 Ga0207695_10012529 3300025913 Bacteria 10169
195 Ga0207695_10036032 3300025913 Bacteria 5354
196 Ga0207695_10292371 3300025913 Bacteria 1521
197 Ga0207695_10673975 3300025913 Bacteria 915
198 Ga0207671_10013279 3300025914 Bacteria 6568
199 Ga0207671_10041087 3300025914 Bacteria 3423
200 Ga0207657_10000243 3300025919 Bacteria 57852
201 Ga0207657_10002164 3300025919 Bacteria 21291
202 Ga0207657_10020225 3300025919 Bacteria 6297
203 Ga0207657_10086005 3300025919 Bacteria 2633
204 Ga0207657_10204488 3300025919 Bacteria 1587
205 Ga0207649_10000807 3300025920 Bacteria 20134
206 Ga0207694_10011573 3300025924 Bacteria 6657
207 Ga0207694_10059110 3300025924 Bacteria 2982
208 Ga0207659_10015794 3300025926 Bacteria 4903
209 Ga0207659_10731227 3300025926 Bacteria 848
210 Ga0207687_10000724 3300025927 Bacteria 22410
211 Ga0207687_10013095 3300025927 Bacteria 5422
212 Ga0207644_10070768 3300025931 Bacteria 2550
213 Ga0207644_10123918 3300025931 Bacteria 1970
214 Ga0207690_10000659 3300025932 Bacteria 22104
215 Ga0207690_10238809 3300025932 Bacteria 1399
216 Ga0207690_10522021 3300025932 Bacteria 963
217 Ga0207706_10125658 3300025933 Bacteria 2256
218 Ga0207706_10141705 3300025933 Bacteria 2115
219 Ga0207686_10000461 3300025934 Bacteria 26960
220 Ga0207686_10243974 3300025934 Bacteria 1309
221 Ga0207709_10000078 3300025935 Bacteria 169141
222 Ga0207709_10000306 3300025935 Bacteria 53253
223 Ga0207709_10358548 3300025935 Bacteria 1103
224 Ga0207669_10000088 3300025937 Bacteria 46536
225 Ga0207669_10000501 3300025937 Bacteria 17123
226 Ga0207704_10000017 3300025938 Bacteria 154190
227 Ga0207704_10089521 3300025938 Bacteria 2017
228 Ga0207691_10093349 3300025940 Bacteria 2695
229 Ga0207711_10006441 3300025941 Bacteria 9886
230 Ga0207711_10565053 3300025941 Bacteria 1061
231 Ga0207689_10000958 3300025942 Bacteria 27777
232 Ga0207679_10147340 3300025945 Bacteria 1911
233 Ga0207667_10000002 3300025949 Bacteria 895662
234 Ga0207667_10000038 3300025949 Bacteria 280720
235 Ga0207667_10012985 3300025949 Bacteria 9560
236 Ga0207667_10143787 3300025949 Bacteria 2455
237 Ga0207667_10154206 3300025949 Bacteria 2364
238 Ga0207651_10000011 3300025960 Bacteria 191950
239 Ga0207651_10056730 3300025960 Bacteria 2697
240 Ga0207651_10449685 3300025960 Bacteria 1105
241 Ga0207651_10635359 3300025960 Bacteria 936
242 Ga0207712_10000095 3300025961 Bacteria 102251
243 Ga0207668_10000693 3300025972 Bacteria 20660
244 Ga0207668_10020018 3300025972 Bacteria 4244
245 Ga0207668_10074130 3300025972 Bacteria 2442
246 Ga0207668_10085817 3300025972 Bacteria 2298
247 Ga0207640_10001332 3300025981 Bacteria 13406
248 Ga0207640_10014113 3300025981 Bacteria 4593
249 Ga0207640_10026503 3300025981 Bacteria 3521
250 Ga0207640_10064813 3300025981 Bacteria 2435
251 Ga0207640_10081219 3300025981 Bacteria 2216
252 Ga0207640_10150623 3300025981 Bacteria 1709
253 Ga0207640_10233136 3300025981 Bacteria 1417
254 Ga0207658_10195385 3300025986 Unclassified 1685
255 Ga0207677_10000191 3300026023 Bacteria 49459
256 Ga0207703_10000426 3300026035 Bacteria 44589
257 Ga0207703_10002742 3300026035 Bacteria 15087
258 Ga0207703_10009340 3300026035 Bacteria 7708
259 Ga0207703_10133589 3300026035 Bacteria 2146
260 Ga0207639_10003636 3300026041 Bacteria 10359
261 Ga0207639_10004751 3300026041 Bacteria 9150
262 Ga0207639_10352950 3300026041 Bacteria 1314
263 Ga0207678_10000708 3300026067 Bacteria 30426
264 Ga0207678_10004209 3300026067 Bacteria 12911
265 Ga0207702_10042028 3300026078 Bacteria 3833
266 Ga0207641_10001516 3300026088 Bacteria 22766
267 Ga0207641_10340208 3300026088 Bacteria 1428
268 Ga0207648_10000045 3300026089 Bacteria 111963
269 Ga0207648_10151938 3300026089 Bacteria 2043
270 Ga0207648_10431013 3300026089 Bacteria 1198
271 Ga0207676_10000706 3300026095 Bacteria 26300
272 Ga0207676_10105408 3300026095 Bacteria 2347
273 Ga0207674_10011623 3300026116 Bacteria 9888
274 Ga0207674_10092635 3300026116 Bacteria 3011
275 Ga0207675_100000016 3300026118 Bacteria 126353
276 Ga0207683_10000638 3300026121 Bacteria 32038
277 Ga0207683_10044075 3300026121 Bacteria 3899
278 Ga0207683_10146474 3300026121 Bacteria 2130
279 Ga0207698_10000136 3300026142 Bacteria 46199
280 Ga0207698_10256384 3300026142 Bacteria 1604
281 Ga0268266_10000002 3300028379 Bacteria 3059047
282 Ga0268266_10075785 3300028379 Bacteria 2922
283 Ga0268265_10171714 3300028380 Bacteria 1854
284 Ga0268264_10002420 3300028381 Bacteria 16421
285 Ga0307517_10080715 3300028786 Bacteria 2782
286 Ga0307513_10002089 3300031456 Bacteria 28063
287 Ga0307412_10124482 3300031911 Bacteria 1862
288 Ga0307412_10661065 3300031911 Unclassified 892
289 Ga0307414_10235151 3300032004 Bacteria 1513
290 Ga0307510_10089058 3300033180 Bacteria 2941
291 Ga0307510_10179045 3300033180 Bacteria 1686
292 Ga0395905_0003103 3300037471 Bacteria 17941
293 Ga0395905_0103088 3300037471 Bacteria 2679
294 Ga0395901_0336565 3300038443 Bacteria 1560
295 Ga0439436_0047972 3300041404 Bacteria 1212
296 Ga0439461_0000039 3300041410 Bacteria 16229
297 Ga0439466_0025063 3300041411 Bacteria 2085
298 Ga0439465_0000942 3300041413 Bacteria 9220
299 Ga0439465_0023087 3300041413 Bacteria 1957
300 Ga0451853_3126076 3300041512 Bacteria 1414
301 Ga0439431_0000534 3300041997 Bacteria 8052
302 Ga0439431_0051247 3300041997 Bacteria 1070
303 Ga0439442_009102 3300042002 Bacteria 2008
304 Ga0439445_0000291 3300042004 Bacteria 9728
305 Ga0439445_0005702 3300042004 Bacteria 2845
306 Ga0439448_0000836 3300042005 Bacteria 7492
307 Ga0439448_0009943 3300042005 Bacteria 2811
308 Ga0439432_000049 3300042006 Bacteria 36738
309 Ga0439452_022956 3300042010 Bacteria 1610
310 Ga0439455_0000081 3300042012 Bacteria 8905
311 Ga0439455_0000088 3300042012 Bacteria 8793
312 Ga0439462_0001770 3300042015 Bacteria 4890
313 Ga0439446_0092078 3300042156 Bacteria 950
314 Ga0439458_0000101 3300042157 Bacteria 16889
315 Ga0439458_0000570 3300042157 Bacteria 9497
316 Ga0439434_0005976 3300042435 Bacteria 3551
317 Ga0466971_0030666 3300044719 Bacteria 2407
318 Ga0466957_0275404 3300044842 Bacteria 1125
319 Ga0466957_0468460 3300044842 Bacteria 870
320 Ga0466958_0071095 3300045836 Bacteria 2130
321 Ga0466967_0013474 3300045976 Bacteria 6321
322 Ga0495617_017432 3300046452 Bacteria 2426
323 Ga0495627_009674 3300046453 Bacteria 3538
324 Ga0495627_015116 3300046453 Bacteria 2672
325 Ga0495629_0524402 3300046459 Bacteria 797
326 Ga0495638_0000033 3300046460 Bacteria 288195
327 Ga0495638_0000149 3300046460 Bacteria 110150
328 Ga0495638_0120541 3300046460 Bacteria 1551
329 Ga0495650_0000116 3300046471 Bacteria 189814
330 Ga0495584_0016628 3300046491 Bacteria 3751
331 Ga0495584_0050079 3300046491 Bacteria 2104
332 Ga0495585_0001044 3300046492 Bacteria 22944
333 Ga0495596_0000343 3300046500 Bacteria 30182
334 Ga0495583_0000010 3300046506 Bacteria 353523
335 Ga0495583_0000216 3300046506 Bacteria 96776
336 Ga0495583_0001297 3300046506 Bacteria 26035
337 Ga0495583_0012576 3300046506 Bacteria 4779
338 Ga0495583_0032195 3300046506 Bacteria 2532
339 Ga0495583_0109674 3300046506 Bacteria 1170
340 Ga0495606_0000092 3300046507 Bacteria 152369
341 Ga0495606_0011230 3300046507 Bacteria 7329
342 Ga0495606_0075463 3300046507 Bacteria 2110
343 Ga0495606_0138656 3300046507 Bacteria 1438
344 Ga0495610_0000053 3300046512 Bacteria 142545
345 Ga0495610_0062635 3300046512 Bacteria 1764
346 Ga0495616_0013890 3300046513 Bacteria 4526
347 Ga0495631_0016157 3300046518 Bacteria 3565
348 Ga0495632_0000095 3300046519 Bacteria 89499
349 Ga0495632_0000187 3300046519 Bacteria 63185
350 Ga0495637_0001883 3300046520 Bacteria 11976
351 Ga0495637_0001983 3300046520 Bacteria 11577
352 Ga0495637_0169823 3300046520 Bacteria 814
353 Ga0495643_0000038 3300046522 Bacteria 236010
354 Ga0495643_0001364 3300046522 Bacteria 22851
355 Ga0495643_0175528 3300046522 Bacteria 1044
356 Ga0495648_0000014 3300046524 Bacteria 288365
357 Ga0495648_0000097 3300046524 Bacteria 109887
358 Ga0495648_0008135 3300046524 Bacteria 8281
359 Ga0495648_0020289 3300046524 Bacteria 4638
360 Ga0495648_0065210 3300046524 Bacteria 2142
361 Ga0495648_0102172 3300046524 Bacteria 1580
362 Ga0495663_0000028 3300046525 Bacteria 89526
363 Ga0495663_0000346 3300046525 Bacteria 17227
364 Ga0495663_0028730 3300046525 Bacteria 1638
365 Ga0495652_0171571 3300046529 Bacteria 1674
366 Ga0495597_0123821 3300046542 Bacteria 1076
367 Ga0495622_0006381 3300046557 Bacteria 5475
368 Ga0495622_0033500 3300046557 Bacteria 2397
369 Ga0495633_0000340 3300046558 Bacteria 52440
370 Ga0495633_0000607 3300046558 Bacteria 34283
371 Ga0495633_0001118 3300046558 Bacteria 21556
372 Ga0495633_0004787 3300046558 Bacteria 8485
373 Ga0495633_0050054 3300046558 Bacteria 1971
374 Ga0495668_0000056 3300046616 Bacteria 197862
375 Ga0495668_0045688 3300046616 Bacteria 2435
376 Ga0495668_0154629 3300046616 Bacteria 1256
377 Ga0495611_0010286 3300046648 Bacteria 3957
378 Ga0495611_0137383 3300046648 Bacteria 1141
379 Ga0495625_0000064 3300046660 Bacteria 174730
380 Ga0495625_0000496 3300046660 Bacteria 58853
381 Ga0495669_0000011 3300046684 Bacteria 158720
382 Ga0495671_0000019 3300046692 Bacteria 288186
383 Ga0495671_0000027 3300046692 Bacteria 236011
384 Ga0495671_0019677 3300046692 Bacteria 3564
385 Ga0495649_0049435 3300046694 Bacteria 2284
386 Ga0495649_0082167 3300046694 Bacteria 1722
387 Ga0495600_0204430 3300046809 Bacteria 1267
388 Ga0495660_0069842 3300046810 Bacteria 1866
389 Ga0495683_0016249 3300047323 Bacteria 3866
390 Ga0495687_000077 3300047443 Bacteria 148889
391 Ga0495687_000225 3300047443 Bacteria 79469
392 Ga0495677_0020228 3300047445 Bacteria 2413
393 Ga0495673_0000042 3300047469 Bacteria 288018
394 Ga0495681_0000015 3300047470 Bacteria 183538
395 Ga0495681_0002270 3300047470 Bacteria 13830
396 Ga0495681_0006649 3300047470 Bacteria 7550
397 Ga0495686_0035299 3300047472 Bacteria 3215
398 Ga0495686_0162464 3300047472 Bacteria 1304
399 Ga0495686_0321300 3300047472 Bacteria 848
400 Ga0495615_0000044 3300048090 Bacteria 41787
401 Ga0495626_0000403 3300048091 Bacteria 44195
402 Ga0496102_0002060 3300048905 Bacteria 17313
403 Ga0496102_0102002 3300048905 Bacteria 2667
404 Ga0496103_0000416 3300048906 Bacteria 37523
405 Ga0496104_0115533 3300048907 Bacteria 2575
406 Ga0496105_0004425 3300048908 Bacteria 10579
407 Ga0496108_0052231 3300048911 Bacteria 3424
408 Ga0496108_0526143 3300048911 Bacteria 1032
409 Ga0496109_0515152 3300048912 Bacteria 1129
410 Ga0496110_0013453 3300048913 Bacteria 6766
411 Ga0496110_0101459 3300048913 Bacteria 2580
412 Ga0496110_0371305 3300048913 Bacteria 1303
413 Ga0496111_0001022 3300048914 Bacteria 15355
414 Ga0496111_0032406 3300048914 Bacteria 3726
415 Ga0496114_0024369 3300048917 Bacteria 4938
416 Ga0496115_0000229 3300048918 Bacteria 51160
417 Ga0496116_0003565 3300048919 Bacteria 15302
418 Ga0496117_0000142 3300048920 Bacteria 157953
419 Ga0496117_0006941 3300048920 Bacteria 11224
420 Ga0496117_0010668 3300048920 Bacteria 8324
421 Ga0496118_0000115 3300048921 Bacteria 146533
422 Ga0496118_0002483 3300048921 Bacteria 24754
423 Ga0496118_0120092 3300048921 Bacteria 1716
424 Ga0496119_0013468 3300048922 Bacteria 6509
425 Ga0496120_0012231 3300048923 Bacteria 5850
426 Ga0496121_0000079 3300048924 Bacteria 232653
427 Ga0496121_0000193 3300048924 Bacteria 136526
428 Ga0496121_0001506 3300048924 Bacteria 39141
429 Ga0496121_0002248 3300048924 Bacteria 30091
430 Ga0496121_0016557 3300048924 Bacteria 7605
431 Ga0496121_0040418 3300048924 Bacteria 4092
432 Ga0496121_0076123 3300048924 Bacteria 2677
433 Ga0496122_0008790 3300048925 Bacteria 10791
434 Ga0496122_0015133 3300048925 Bacteria 7394
435 Ga0496123_0001384 3300048926 Bacteria 34000
436 Ga0496123_0005947 3300048926 Bacteria 12016
437 Ga0496123_0006153 3300048926 Bacteria 11759
438 Ga0496123_0091248 3300048926 Bacteria 1808
439 Ga0496123_0106577 3300048926 Bacteria 1614
440 Ga0496124_0000146 3300048927 Bacteria 146468
441 Ga0496124_0005919 3300048927 Bacteria 13531
442 Ga0496124_0009514 3300048927 Bacteria 9997
443 Ga0496124_0016101 3300048927 Bacteria 7133
444 Ga0496124_0074778 3300048927 Bacteria 2799
445 Ga0496124_0088397 3300048927 Bacteria 2533
446 Ga0496124_0202590 3300048927 Bacteria 1508
447 Ga0496125_0001117 3300048928 Bacteria 41020
448 Ga0496125_0003313 3300048928 Bacteria 19717
449 Ga0496125_0026299 3300048928 Bacteria 5307
450 Ga0496125_0095326 3300048928 Bacteria 2214
451 Ga0496126_0000174 3300048929 Bacteria 146468
452 Ga0496126_0003775 3300048929 Bacteria 18810
453 Ga0496126_0009110 3300048929 Bacteria 10598
454 Ga0495678_072139 3300049459 Bacteria 1262
455 Ga0501034_0080817 3300049571 Unclassified 3254
456 Ga0501043_0104653 3300049579 Bacteria 2224
457 Ga0501223_000002 3300049663 Bacteria 154573
458 Ga0501256_001756 3300049685 Bacteria 1647
459 Ga0501225_0000006 3300049705 Bacteria 119739
460 Ga0501044_0048624 3300049823 Bacteria 4380
461 Ga0500610_0000166 3300053079 Bacteria 19624
462 Ga0500643_006920 3300053087 Bacteria 4662
463 Ga0500566_0002974 3300053094 Bacteria 10118
464 Ga0500555_000461 3300053103 Bacteria 16895
465 Ga0500594_0003159 3300053118 Bacteria 3605
466 Ga0500595_003713 3300053119 Bacteria 7042
467 Ga0500595_020416 3300053119 Bacteria 2385
468 Ga0500597_003468 3300053120 Bacteria 4667
469 Ga0500642_0000323 3300053130 Bacteria 16715
470 Ga0500658_0000593 3300053134 Bacteria 15083
471 Ga0500658_0001252 3300053134 Bacteria 10297
472 Ga0500559_0010718 3300053136 Bacteria 3929
473 Ga0500568_0001370 3300053139 Bacteria 15837
474 Ga0500568_0017799 3300053139 Bacteria 3127
475 Ga0500622_0001744 3300053156 Bacteria 16764
476 Ga0500624_000006 3300053157 Bacteria 184937
477 Ga0500624_000034 3300053157 Bacteria 101151
478 Ga0500624_000729 3300053157 Bacteria 8149
479 Ga0500636_0000360 3300053177 Bacteria 24978
480 Ga0500636_0000992 3300053177 Bacteria 15229
481 Ga0500637_0000030 3300053178 Bacteria 52395
482 Ga0500645_000001 3300053730 Bacteria 455558
483 Ga0587106_024520 3300059605 Bacteria 923
484 Ga0587128_011225 3300059630 Bacteria 1220
485 Ga0466962_0005369 3300061719 Bacteria 6166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100033448 Ga0070671_1000334483 175
2 3300025931 Ga0207644_10070768 Ga0207644_100707684 175
3 3300005563 Ga0068855_100006889 Ga0068855_10000688914 178
4 3300009093 Ga0105240_10529693 Ga0105240_105296932 178
5 3300025913 Ga0207695_10292371 Ga0207695_102923712 178
6 3300025949 Ga0207667_10143787 Ga0207667_101437873 178
7 3300026116 Ga0207674_10092635 Ga0207674_100926354 178
8 3300005563 Ga0068855_100063217 Ga0068855_1000632172 181
9 3300005616 Ga0068852_100089261 Ga0068852_1000892614 181
10 3300025949 Ga0207667_10012985 Ga0207667_100129854 181
11 3300048912 Ga0496109_0515152 Ga0496109_0515152_277_1080 182
12 3300005842 Ga0068858_100024796 Ga0068858_1000247963 183
13 3300009177 Ga0105248_10076217 Ga0105248_100762175 183
14 3300025941 Ga0207711_10565053 Ga0207711_105650531 183
15 3300026035 Ga0207703_10009340 Ga0207703_100093405 183
16 3300042156 Ga0439446_0092078 Ga0439446_0092078_338_916 184
17 3300005327 Ga0070658_10267576 Ga0070658_102675763 185
18 3300025909 Ga0207705_10401723 Ga0207705_104017232 185
19 3300005347 Ga0070668_100086391 Ga0070668_1000863913 188
20 3300025972 Ga0207668_10074130 Ga0207668_100741303 188
21 3300048911 Ga0496108_0526143 Ga0496108_0526143_43_846 188
22 3300048913 Ga0496110_0371305 Ga0496110_0371305_355_1158 188
23 3300048914 Ga0496111_0032406 Ga0496111_0032406_2899_3702 188
24 3300025913 Ga0207695_10673975 Ga0207695_106739752 191
25 3300026095 Ga0207676_10105408 Ga0207676_101054082 191
26 3300046500 Ga0495596_0000343 Ga0495596_0000343_8327_9037 191
27 3300046507 Ga0495606_0075463 Ga0495606_0075463_966_1676 191
28 3300046616 Ga0495668_0154629 Ga0495668_0154629_238_948 191
29 3300048091 Ga0495626_0000403 Ga0495626_0000403_24427_25137 191
30 3300046520 Ga0495637_0169823 Ga0495637_0169823_168_761 192
31 3300046520 Ga0495637_0001883 Ga0495637_0001883_5089_5841 194
32 3300049459 Ga0495678_072139 Ga0495678_072139_347_1099 194
33 3300049571 Ga0501034_0080817 Ga0501034_0080817_25_705 194
34 3300009177 Ga0105248_10010411 Ga0105248_1001041110 195
35 3300025941 Ga0207711_10006441 Ga0207711_100064414 195
36 3300046452 Ga0495617_017432 Ga0495617_017432_822_1574 197
37 3300046453 Ga0495627_009674 Ga0495627_009674_1855_2607 197
38 3300046512 Ga0495610_0000053 Ga0495610_0000053_12994_13746 197
39 3300005578 Ga0068854_100097311 Ga0068854_1000973113 199
40 3300005617 Ga0068859_100087499 Ga0068859_1000874995 199
41 3300005841 Ga0068863_100025656 Ga0068863_1000256563 199
42 3300005843 Ga0068860_100006786 Ga0068860_10000678614 199
43 3300006931 Ga0097620_100087503 Ga0097620_1000875032 199
44 3300014326 Ga0157380_10041044 Ga0157380_100410443 199
45 3300025914 Ga0207671_10013279 Ga0207671_100132795 199
46 3300025961 Ga0207712_10000095 Ga0207712_1000009521 199
47 3300025981 Ga0207640_10081219 Ga0207640_100812193 199
48 3300026088 Ga0207641_10001516 Ga0207641_1000151611 199
49 3300026088 Ga0207641_10340208 Ga0207641_103402082 199
50 3300028381 Ga0268264_10002420 Ga0268264_1000242014 199
51 3300048926 Ga0496123_0005947 Ga0496123_0005947_4623_5363 199
52 3300048927 Ga0496124_0005919 Ga0496124_0005919_114_854 199
53 3300048927 Ga0496124_0009514 Ga0496124_0009514_5396_6136 199
54 3300048928 Ga0496125_0095326 Ga0496125_0095326_156_896 199
55 3300005616 Ga0068852_100778234 Ga0068852_1007782342 200
56 3300025932 Ga0207690_10522021 Ga0207690_105220211 200
57 3300046507 Ga0495606_0138656 Ga0495606_0138656_780_1418 200
58 3300046519 Ga0495632_0000095 Ga0495632_0000095_27731_28453 200
59 3300046525 Ga0495663_0000028 Ga0495663_0000028_27731_28453 200
60 3300046558 Ga0495633_0001118 Ga0495633_0001118_12961_13683 200
61 3300047472 Ga0495686_0035299 Ga0495686_0035299_1791_2513 200
62 3300005327 Ga0070658_10015930 Ga0070658_100159304 201
63 3300013307 Ga0157372_10446426 Ga0157372_104464263 201
64 3300025909 Ga0207705_10000042 Ga0207705_10000042178 201
65 3300002459 JGI24751J29686_10003506 JGI24751J29686_100035062 202
66 3300005578 Ga0068854_100035323 Ga0068854_1000353233 202
67 3300025919 Ga0207657_10000243 Ga0207657_1000024325 202
68 3300025949 Ga0207667_10000038 Ga0207667_1000003879 202
69 3300025981 Ga0207640_10026503 Ga0207640_100265033 202
70 3300046524 Ga0495648_0008135 Ga0495648_0008135_2795_3550 203
71 3300048905 Ga0496102_0102002 Ga0496102_0102002_121_924 203
72 3300005339 Ga0070660_100007691 Ga0070660_1000076913 204
73 3300005354 Ga0070675_100011520 Ga0070675_1000115203 204
74 3300005355 Ga0070671_100025281 Ga0070671_1000252816 204
75 3300005355 Ga0070671_100066599 Ga0070671_1000665992 204
76 3300005356 Ga0070674_100017665 Ga0070674_1000176655 204
77 3300005364 Ga0070673_100099227 Ga0070673_1000992273 204
78 3300005366 Ga0070659_100014806 Ga0070659_1000148061 204
79 3300005456 Ga0070678_100000861 Ga0070678_10000086113 204
80 3300005457 Ga0070662_100385009 Ga0070662_1003850092 204
81 3300005535 Ga0070684_100403731 Ga0070684_1004037312 204
82 3300005539 Ga0068853_100115925 Ga0068853_1001159254 204
83 3300005543 Ga0070672_100006338 Ga0070672_1000063385 204
84 3300005548 Ga0070665_100000023 Ga0070665_100000023237 204
85 3300005617 Ga0068859_100089056 Ga0068859_1000890563 204
86 3300006058 Ga0075432_10001145 Ga0075432_100011452 204
87 3300006931 Ga0097620_100089055 Ga0097620_1000890553 204
88 3300014968 Ga0157379_10063918 Ga0157379_100639182 204
89 3300025261 Ga0209233_1000104 Ga0209233_100010414 204
90 3300025919 Ga0207657_10020225 Ga0207657_100202252 204
91 3300025926 Ga0207659_10015794 Ga0207659_100157945 204
92 3300025931 Ga0207644_10123918 Ga0207644_101239183 204
93 3300025933 Ga0207706_10141705 Ga0207706_101417052 204
94 3300025960 Ga0207651_10635359 Ga0207651_106353591 204
95 3300026121 Ga0207683_10044075 Ga0207683_100440753 204
96 3300028379 Ga0268266_10000002 Ga0268266_100000021243 204
97 3300042005 Ga0439448_0009943 Ga0439448_0009943_689_1399 204
98 3300046492 Ga0495585_0001044 Ga0495585_0001044_3412_4146 204
99 3300046660 Ga0495625_0000496 Ga0495625_0000496_38283_38999 204
100 3300046809 Ga0495600_0204430 Ga0495600_0204430_287_1009 204
101 3300053139 Ga0500568_0001370 Ga0500568_0001370_12596_13288 204
102 iso_pu_bacteria 2643221622 2644126757 204
103 3300005262 Ga0065165_1002332 Ga0065165_100233214 205
104 3300005616 Ga0068852_100001753 Ga0068852_10000175312 205
105 3300005616 Ga0068852_100350824 Ga0068852_1003508243 205
106 3300026142 Ga0207698_10000136 Ga0207698_1000013615 205
107 3300046460 Ga0495638_0000149 Ga0495638_0000149_73555_74256 205
108 3300046616 Ga0495668_0000056 Ga0495668_0000056_50340_51047 205
109 iso_pu_bacteria 2885429604 2885429752 205
110 3300005459 Ga0068867_100422514 Ga0068867_1004225142 206
111 3300006881 Ga0068865_100100419 Ga0068865_1001004192 206
112 3300006946 Ga0079104_1017921 Ga0079104_10179212 206
113 3300009011 Ga0105251_10007311 Ga0105251_100073117 206
114 3300025938 Ga0207704_10089521 Ga0207704_100895212 206
115 3300026089 Ga0207648_10431013 Ga0207648_104310132 206
116 3300028380 Ga0268265_10171714 Ga0268265_101717143 206
117 3300033180 Ga0307510_10089058 Ga0307510_100890586 206
118 3300033180 Ga0307510_10179045 Ga0307510_101790452 206
119 3300041512 Ga0451853_3126076 Ga0451853_3126076_585_1271 206
120 3300046459 Ga0495629_0524402 Ga0495629_0524402_10_717 206
121 3300046471 Ga0495650_0000116 Ga0495650_0000116_69411_70142 206
122 3300046506 Ga0495583_0001297 Ga0495583_0001297_12987_13718 206
123 3300046507 Ga0495606_0011230 Ga0495606_0011230_5779_6486 206
124 3300046525 Ga0495663_0028730 Ga0495663_0028730_332_1033 206
125 3300046542 Ga0495597_0123821 Ga0495597_0123821_80_787 206
126 3300046557 Ga0495622_0006381 Ga0495622_0006381_3122_3844 206
127 3300048913 Ga0496110_0101459 Ga0496110_0101459_726_1382 206
128 3300048924 Ga0496121_0002248 Ga0496121_0002248_8081_8770 206
129 3300048924 Ga0496121_0076123 Ga0496121_0076123_1106_1762 206
130 3300048925 Ga0496122_0008790 Ga0496122_0008790_1659_2315 206
131 3300048926 Ga0496123_0006153 Ga0496123_0006153_1190_1846 206
132 3300048927 Ga0496124_0016101 Ga0496124_0016101_979_1635 206
133 3300048928 Ga0496125_0001117 Ga0496125_0001117_19649_20305 206
134 3300003323 rootH1_10234626 rootH1_102346263 207
135 3300025913 Ga0207695_10012529 Ga0207695_100125295 207
136 3300025935 Ga0207709_10358548 Ga0207709_103585482 207
137 3300025972 Ga0207668_10000693 Ga0207668_1000069319 207
138 3300042012 Ga0439455_0000081 Ga0439455_0000081_7106_7825 207
139 3300047470 Ga0495681_0000015 Ga0495681_0000015_77191_77943 207
140 3300047472 Ga0495686_0321300 Ga0495686_0321300_23_775 207
141 3300048920 Ga0496117_0006941 Ga0496117_0006941_4842_5540 207
142 3300048921 Ga0496118_0002483 Ga0496118_0002483_12592_13290 207
143 3300048927 Ga0496124_0088397 Ga0496124_0088397_1165_1863 207
144 3300005364 Ga0070673_100072432 Ga0070673_1000724322 208
145 3300009093 Ga0105240_10013485 Ga0105240_100134854 208
146 3300010375 Ga0105239_10000113 Ga0105239_10000113114 208
147 3300025960 Ga0207651_10056730 Ga0207651_100567302 208
148 3300046491 Ga0495584_0016628 Ga0495584_0016628_1284_2006 208
149 3300046520 Ga0495637_0001983 Ga0495637_0001983_9303_10025 208
150 3300046522 Ga0495643_0000038 Ga0495643_0000038_174145_174867 208
151 3300046558 Ga0495633_0050054 Ga0495633_0050054_614_1366 208
152 3300046660 Ga0495625_0000064 Ga0495625_0000064_115652_116377 208
153 3300046692 Ga0495671_0000027 Ga0495671_0000027_61145_61867 208
154 3300047470 Ga0495681_0002270 Ga0495681_0002270_4179_4901 208
155 3300053134 Ga0500658_0001252 Ga0500658_0001252_7755_8456 208
156 3300005719 Ga0068861_100003542 Ga0068861_1000035423 209
157 3300025229 Ga0209147_101282 Ga0209147_1012825 209
158 3300026118 Ga0207675_100000016 Ga0207675_10000001639 209
159 3300046460 Ga0495638_0120541 Ga0495638_0120541_510_1232 209
160 3300046558 Ga0495633_0000340 Ga0495633_0000340_7869_8591 209
161 3300046694 Ga0495649_0082167 Ga0495649_0082167_18_716 209
162 3300053079 Ga0500610_0000166 Ga0500610_0000166_15879_16586 209
163 3300000041 ARcpr5oldR_c001533 ARcpr5oldR_0015332 210
164 3300000043 ARcpr5yngRDRAFT_c000712 ARcpr5yngRDRAFT_0007122 210
165 3300003215 JGI25153J46596_10003189 JGI25153J46596_100031899 210
166 3300003773 Ga0055537_1001264 Ga0055537_100126413 210
167 3300003775 Ga0055524_1000118 Ga0055524_100011874 210
168 3300004625 Ga0055543_1006980 Ga0055543_10069802 210
169 3300005262 Ga0065165_1008392 Ga0065165_10083924 210
170 3300009148 Ga0105243_10288475 Ga0105243_102884752 210
171 3300025245 Ga0207425_1019819 Ga0207425_10198192 210
172 3300025263 Ga0209565_1000011 Ga0209565_1000011503 210
173 3300025273 Ga0209673_1000827 Ga0209673_100082733 210
174 3300025297 Ga0209758_1003487 Ga0209758_10034876 210
175 3300025298 Ga0209050_1002806 Ga0209050_10028067 210
176 3300025299 Ga0209256_1000016 Ga0209256_100001697 210
177 3300025304 Ga0209257_1002579 Ga0209257_100257911 210
178 3300025735 Ga0207713_1094055 Ga0207713_10940552 210
179 3300028786 Ga0307517_10080715 Ga0307517_100807152 210
180 3300031456 Ga0307513_10002089 Ga0307513_1000208921 210
181 3300041413 Ga0439465_0023087 Ga0439465_0023087_35_697 210
182 3300041997 Ga0439431_0051247 Ga0439431_0051247_263_925 210
183 3300042004 Ga0439445_0005702 Ga0439445_0005702_1836_2498 210
184 3300042005 Ga0439448_0000836 Ga0439448_0000836_5323_6075 210
185 3300042157 Ga0439458_0000101 Ga0439458_0000101_10646_11398 210
186 3300046491 Ga0495584_0050079 Ga0495584_0050079_1116_1823 210
187 3300046506 Ga0495583_0109674 Ga0495583_0109674_248_955 210
188 3300046522 Ga0495643_0001364 Ga0495643_0001364_11391_12089 210
189 3300046557 Ga0495622_0033500 Ga0495622_0033500_600_1298 210
190 3300046692 Ga0495671_0019677 Ga0495671_0019677_2348_3046 210
191 3300047445 Ga0495677_0020228 Ga0495677_0020228_209_907 210
192 3300053087 Ga0500643_006920 Ga0500643_006920_91_753 210
193 3300053094 Ga0500566_0002974 Ga0500566_0002974_5726_6388 210
194 3300053119 Ga0500595_003713 Ga0500595_003713_2146_2877 210
195 3300053134 Ga0500658_0000593 Ga0500658_0000593_9974_10636 210
196 3300053139 Ga0500568_0017799 Ga0500568_0017799_1032_1694 210
197 3300053730 Ga0500645_000001 Ga0500645_000001_207708_208415 210
198 3300005563 Ga0068855_100469063 Ga0068855_1004690631 211
199 3300005578 Ga0068854_100190697 Ga0068854_1001906972 211
200 3300005617 Ga0068859_100001448 Ga0068859_10000144816 211
201 3300005618 Ga0068864_100322004 Ga0068864_1003220042 211
202 3300005842 Ga0068858_100002560 Ga0068858_10000256010 211
203 3300006931 Ga0097620_100001448 Ga0097620_10000144816 211
204 3300009098 Ga0105245_10002989 Ga0105245_100029897 211
205 3300009176 Ga0105242_10153788 Ga0105242_101537883 211
206 3300013296 Ga0157374_10045074 Ga0157374_100450745 211
207 3300013297 Ga0157378_10160391 Ga0157378_101603912 211
208 3300025927 Ga0207687_10000724 Ga0207687_100007242 211
209 3300025934 Ga0207686_10243974 Ga0207686_102439741 211
210 3300025981 Ga0207640_10233136 Ga0207640_102331362 211
211 3300026035 Ga0207703_10002742 Ga0207703_1000274210 211
212 3300046512 Ga0495610_0062635 Ga0495610_0062635_455_1144 211
213 3300047472 Ga0495686_0162464 Ga0495686_0162464_294_986 211
214 3300048920 Ga0496117_0010668 Ga0496117_0010668_226_912 211
215 3300048921 Ga0496118_0120092 Ga0496118_0120092_660_1346 211
216 3300048924 Ga0496121_0040418 Ga0496121_0040418_1016_1702 211
217 3300048926 Ga0496123_0106577 Ga0496123_0106577_911_1597 211
218 3300049663 Ga0501223_000002 Ga0501223_000002_43679_44371 211
219 3300049685 Ga0501256_001756 Ga0501256_001756_513_1205 211
220 3300049705 Ga0501225_0000006 Ga0501225_0000006_43497_44189 211
221 iso_pu_bacteria 2928027323 2928028899 211
222 3300003316 rootH1_10030114 rootH1_100301143 212
223 3300005367 Ga0070667_100394149 Ga0070667_1003941492 212
224 3300005548 Ga0070665_100099649 Ga0070665_1000996493 212
225 3300005842 Ga0068858_100118549 Ga0068858_1001185492 212
226 3300013306 Ga0163162_10013407 Ga0163162_100134075 212
227 3300013307 Ga0157372_10077346 Ga0157372_100773463 212
228 3300025986 Ga0207658_10195385 Ga0207658_101953852 212
229 3300026035 Ga0207703_10133589 Ga0207703_101335892 212
230 3300028379 Ga0268266_10075785 Ga0268266_100757853 212
231 3300037471 Ga0395905_0103088 Ga0395905_0103088_1833_2540 213
232 3300048924 Ga0496121_0000079 Ga0496121_0000079_58578_59309 213
233 3300048929 Ga0496126_0003775 Ga0496126_0003775_16358_17089 213
234 3300005356 Ga0070674_100061710 Ga0070674_1000617104 214
235 3300005456 Ga0070678_100002552 Ga0070678_1000025529 214
236 3300005459 Ga0068867_100031655 Ga0068867_1000316554 214
237 3300025919 Ga0207657_10086005 Ga0207657_100860052 214
238 3300025937 Ga0207669_10000088 Ga0207669_100000884 214
239 3300026089 Ga0207648_10151938 Ga0207648_101519382 214
240 3300026121 Ga0207683_10000638 Ga0207683_1000063831 214
241 3300046518 Ga0495631_0016157 Ga0495631_0016157_209_907 214
242 3300046558 Ga0495633_0000607 Ga0495633_0000607_22097_22795 214
243 3300046810 Ga0495660_0069842 Ga0495660_0069842_34_732 214
244 3300053177 Ga0500636_0000360 Ga0500636_0000360_7457_8179 214
245 3300005719 Ga0068861_100076910 Ga0068861_1000769103 215
246 3300005842 Ga0068858_100000585 Ga0068858_10000058517 215
247 3300014325 Ga0163163_10036592 Ga0163163_100365925 215
248 3300026035 Ga0207703_10000426 Ga0207703_1000042615 215
249 3300046507 Ga0495606_0000092 Ga0495606_0000092_45256_45960 215
250 3300046522 Ga0495643_0175528 Ga0495643_0175528_97_801 215
251 3300046529 Ga0495652_0171571 Ga0495652_0171571_26_712 215
252 3300048927 Ga0496124_0202590 Ga0496124_0202590_268_963 215
253 iso_pu_bacteria 2984564862 2984565059 215
254 3300025981 Ga0207640_10064813 Ga0207640_100648133 216
255 3300041404 Ga0439436_0047972 Ga0439436_0047972_385_1077 216
256 3300041410 Ga0439461_0000039 Ga0439461_0000039_1084_1776 216
257 3300041411 Ga0439466_0025063 Ga0439466_0025063_1372_2064 216
258 3300041413 Ga0439465_0000942 Ga0439465_0000942_1051_1743 216
259 3300041997 Ga0439431_0000534 Ga0439431_0000534_6304_6996 216
260 3300042002 Ga0439442_009102 Ga0439442_009102_934_1626 216
261 3300042004 Ga0439445_0000291 Ga0439445_0000291_1706_2398 216
262 3300042006 Ga0439432_000049 Ga0439432_000049_34341_35033 216
263 3300042010 Ga0439452_022956 Ga0439452_022956_745_1437 216
264 3300042015 Ga0439462_0001770 Ga0439462_0001770_1476_2168 216
265 3300042435 Ga0439434_0005976 Ga0439434_0005976_717_1409 216
266 3300044842 Ga0466957_0275404 Ga0466957_0275404_362_1060 216
267 3300046506 Ga0495583_0000010 Ga0495583_0000010_244356_245099 216
268 3300046506 Ga0495583_0032195 Ga0495583_0032195_106_804 216
269 3300046513 Ga0495616_0013890 Ga0495616_0013890_2966_3658 216
270 3300046648 Ga0495611_0137383 Ga0495611_0137383_143_841 216
271 3300046684 Ga0495669_0000011 Ga0495669_0000011_14902_15600 216
272 3300047443 Ga0495687_000077 Ga0495687_000077_51339_52037 216
273 3300047443 Ga0495687_000225 Ga0495687_000225_12713_13411 216
274 3300048905 Ga0496102_0002060 Ga0496102_0002060_9046_9744 216
275 3300048906 Ga0496103_0000416 Ga0496103_0000416_19930_20628 216
276 3300048907 Ga0496104_0115533 Ga0496104_0115533_1642_2340 216
277 3300048908 Ga0496105_0004425 Ga0496105_0004425_33_731 216
278 3300048913 Ga0496110_0013453 Ga0496110_0013453_2135_2833 216
279 3300048914 Ga0496111_0001022 Ga0496111_0001022_246_944 216
280 3300048917 Ga0496114_0024369 Ga0496114_0024369_740_1438 216
281 3300048918 Ga0496115_0000229 Ga0496115_0000229_19998_20696 216
282 3300048919 Ga0496116_0003565 Ga0496116_0003565_5344_6042 216
283 3300048920 Ga0496117_0000142 Ga0496117_0000142_19930_20628 216
284 3300048921 Ga0496118_0000115 Ga0496118_0000115_20498_21196 216
285 3300048922 Ga0496119_0013468 Ga0496119_0013468_5438_6136 216
286 3300048923 Ga0496120_0012231 Ga0496120_0012231_3506_4204 216
287 3300048924 Ga0496121_0000193 Ga0496121_0000193_21171_21869 216
288 3300048926 Ga0496123_0091248 Ga0496123_0091248_470_1168 216
289 3300048927 Ga0496124_0000146 Ga0496124_0000146_125273_125971 216
290 3300048928 Ga0496125_0003313 Ga0496125_0003313_7082_7780 216
291 3300048929 Ga0496126_0000174 Ga0496126_0000174_20498_21196 216
292 3300053103 Ga0500555_000461 Ga0500555_000461_15280_16023 216
293 iso_pu_bacteria 2993356040 2993356132 216
294 3300005455 Ga0070663_100540594 Ga0070663_1005405942 217
295 3300005539 Ga0068853_100104218 Ga0068853_1001042183 217
296 3300005563 Ga0068855_100085390 Ga0068855_1000853904 217
297 3300009148 Ga0105243_10000223 Ga0105243_1000022312 217
298 3300013306 Ga0163162_10115278 Ga0163162_101152783 217
299 3300025304 Ga0209257_1012327 Ga0209257_10123273 217
300 3300025924 Ga0207694_10059110 Ga0207694_100591102 217
301 3300025935 Ga0207709_10000078 Ga0207709_1000007812 217
302 3300044719 Ga0466971_0030666 Ga0466971_0030666_1631_2371 217
303 3300045836 Ga0466958_0071095 Ga0466958_0071095_1235_1975 217
304 3300045976 Ga0466967_0013474 Ga0466967_0013474_1832_2572 217
305 3300046506 Ga0495583_0000216 Ga0495583_0000216_230_934 217
306 3300046525 Ga0495663_0000346 Ga0495663_0000346_14801_15499 217
307 3300046648 Ga0495611_0010286 Ga0495611_0010286_421_1119 217
308 3300046692 Ga0495671_0000019 Ga0495671_0000019_107202_107906 217
309 3300046694 Ga0495649_0049435 Ga0495649_0049435_432_1139 217
310 3300047323 Ga0495683_0016249 Ga0495683_0016249_993_1691 217
311 3300047469 Ga0495673_0000042 Ga0495673_0000042_106975_107679 217
312 3300061719 Ga0466962_0005369 Ga0466962_0005369_1125_1865 217
313 iso_pu_bacteria 2643221563 2643832515 217
314 iso_pu_bacteria 2643221608 2644053690 217
315 3300005328 Ga0070676_10009608 Ga0070676_100096083 218
316 3300005333 Ga0070677_10001169 Ga0070677_1000116911 218
317 3300005334 Ga0068869_100000110 Ga0068869_10000011012 218
318 3300005338 Ga0068868_100001844 Ga0068868_10000184412 218
319 3300005364 Ga0070673_100000017 Ga0070673_10000001738 218
320 3300005459 Ga0068867_100000013 Ga0068867_10000001338 218
321 3300005543 Ga0070672_100076068 Ga0070672_1000760683 218
322 3300006881 Ga0068865_100000007 Ga0068865_100000007183 218
323 3300009098 Ga0105245_10001680 Ga0105245_1000168020 218
324 3300009148 Ga0105243_10000118 Ga0105243_1000011867 218
325 3300009176 Ga0105242_10000221 Ga0105242_1000022127 218
326 3300011119 Ga0105246_10000135 Ga0105246_100001352 218
327 3300013100 Ga0157373_10181294 Ga0157373_101812942 218
328 3300013104 Ga0157370_10257023 Ga0157370_102570233 218
329 3300013296 Ga0157374_10000495 Ga0157374_1000049530 218
330 3300013297 Ga0157378_10023883 Ga0157378_100238833 218
331 3300013308 Ga0157375_10001334 Ga0157375_1000133415 218
332 3300014745 Ga0157377_10012797 Ga0157377_100127972 218
333 3300014969 Ga0157376_10000081 Ga0157376_1000008185 218
334 3300025893 Ga0207682_10000147 Ga0207682_1000014716 218
335 3300025907 Ga0207645_10014914 Ga0207645_100149143 218
336 3300025927 Ga0207687_10013095 Ga0207687_100130952 218
337 3300025934 Ga0207686_10000461 Ga0207686_100004618 218
338 3300025935 Ga0207709_10000306 Ga0207709_1000030624 218
339 3300025938 Ga0207704_10000017 Ga0207704_100000177 218
340 3300025940 Ga0207691_10093349 Ga0207691_100933493 218
341 3300025942 Ga0207689_10000958 Ga0207689_100009585 218
342 3300025960 Ga0207651_10000011 Ga0207651_100000119 218
343 3300026023 Ga0207677_10000191 Ga0207677_1000019126 218
344 3300026041 Ga0207639_10352950 Ga0207639_103529502 218
345 3300026089 Ga0207648_10000045 Ga0207648_1000004585 218
346 3300037471 Ga0395905_0003103 Ga0395905_0003103_12990_13691 218
347 3300046524 Ga0495648_0000097 Ga0495648_0000097_46114_46821 218
348 3300047470 Ga0495681_0006649 Ga0495681_0006649_6526_7224 218
349 3300049579 Ga0501043_0104653 Ga0501043_0104653_632_1318 218
350 3300049823 Ga0501044_0048624 Ga0501044_0048624_1034_1720 218
351 3300053136 Ga0500559_0010718 Ga0500559_0010718_2712_3401 218
352 iso_pu_bacteria 8057101203 8057102965 218
353 3300001915 JGI24741J21665_1002345 JGI24741J21665_10023455 219
354 3300001979 JGI24740J21852_10003148 JGI24740J21852_100031489 219
355 3300001990 JGI24737J22298_10003071 JGI24737J22298_100030714 219
356 3300003323 rootH1_10246499 rootH1_102464992 219
357 3300003791 Ga0055530_10000167 Ga0055530_100001674 219
358 3300003794 Ga0055531_10000896 Ga0055531_100008964 219
359 3300005327 Ga0070658_10002746 Ga0070658_1000274612 219
360 3300005339 Ga0070660_100038263 Ga0070660_1000382634 219
361 3300005344 Ga0070661_100026753 Ga0070661_1000267534 219
362 3300005455 Ga0070663_100107404 Ga0070663_1001074042 219
363 3300005563 Ga0068855_100060554 Ga0068855_1000605545 219
364 3300005564 Ga0070664_100007009 Ga0070664_1000070094 219
365 3300005577 Ga0068857_100353321 Ga0068857_1003533212 219
366 3300005578 Ga0068854_100161786 Ga0068854_1001617862 219
367 3300005578 Ga0068854_100175708 Ga0068854_1001757082 219
368 3300005616 Ga0068852_100071343 Ga0068852_1000713434 219
369 3300005616 Ga0068852_100115335 Ga0068852_1001153352 219
370 3300005616 Ga0068852_100710703 Ga0068852_1007107031 219
371 3300005834 Ga0068851_10027759 Ga0068851_100277593 219
372 3300009174 Ga0105241_10004598 Ga0105241_100045983 219
373 3300013100 Ga0157373_10087832 Ga0157373_100878323 219
374 3300013102 Ga0157371_10000029 Ga0157371_10000029189 219
375 3300013307 Ga0157372_10162863 Ga0157372_101628633 219
376 3300025321 Ga0207656_10003253 Ga0207656_100032532 219
377 3300025903 Ga0207680_10127544 Ga0207680_101275442 219
378 3300025904 Ga0207647_10033352 Ga0207647_100333524 219
379 3300025909 Ga0207705_10000255 Ga0207705_1000025524 219
380 3300025911 Ga0207654_10003710 Ga0207654_100037103 219
381 3300025913 Ga0207695_10036032 Ga0207695_100360323 219
382 3300025914 Ga0207671_10041087 Ga0207671_100410873 219
383 3300025919 Ga0207657_10002164 Ga0207657_1000216423 219
384 3300025920 Ga0207649_10000807 Ga0207649_1000080721 219
385 3300025924 Ga0207694_10011573 Ga0207694_100115733 219
386 3300025932 Ga0207690_10000659 Ga0207690_1000065914 219
387 3300025945 Ga0207679_10147340 Ga0207679_101473401 219
388 3300025949 Ga0207667_10000002 Ga0207667_10000002702 219
389 3300025949 Ga0207667_10154206 Ga0207667_101542063 219
390 3300025981 Ga0207640_10014113 Ga0207640_100141134 219
391 3300025981 Ga0207640_10150623 Ga0207640_101506232 219
392 3300026041 Ga0207639_10004751 Ga0207639_100047514 219
393 3300026067 Ga0207678_10000708 Ga0207678_100007086 219
394 3300026078 Ga0207702_10042028 Ga0207702_100420284 219
395 3300026116 Ga0207674_10011623 Ga0207674_100116234 219
396 3300026142 Ga0207698_10256384 Ga0207698_102563842 219
397 3300038443 Ga0395901_0336565 Ga0395901_0336565_792_1493 219
398 3300044842 Ga0466957_0468460 Ga0466957_0468460_23_721 219
399 3300059605 Ga0587106_024520 Ga0587106_024520_159_860 219
400 3300059630 Ga0587128_011225 Ga0587128_011225_419_1120 219
401 3300001904 JGI24736J21556_1008434 JGI24736J21556_10084341 220
402 3300001990 JGI24737J22298_10034196 JGI24737J22298_100341962 220
403 3300002067 JGI24735J21928_10013949 JGI24735J21928_100139492 220
404 3300002075 JGI24738J21930_10002675 JGI24738J21930_100026755 220
405 3300003322 rootL2_10073650 rootL2_100736504 220
406 3300003759 Ga0055525_1000248 Ga0055525_100024853 220
407 3300003762 Ga0055542_1000040 Ga0055542_100004084 220
408 3300003763 Ga0055529_1000037 Ga0055529_1000037137 220
409 3300005327 Ga0070658_10026308 Ga0070658_100263086 220
410 3300005328 Ga0070676_10032400 Ga0070676_100324003 220
411 3300005331 Ga0070670_100109663 Ga0070670_1001096633 220
412 3300005339 Ga0070660_100124866 Ga0070660_1001248663 220
413 3300005347 Ga0070668_100169664 Ga0070668_1001696642 220
414 3300005355 Ga0070671_100453150 Ga0070671_1004531501 220
415 3300005356 Ga0070674_100000945 Ga0070674_10000094514 220
416 3300005364 Ga0070673_100296259 Ga0070673_1002962592 220
417 3300005366 Ga0070659_100025668 Ga0070659_1000256682 220
418 3300005366 Ga0070659_100359071 Ga0070659_1003590711 220
419 3300005455 Ga0070663_100001458 Ga0070663_1000014589 220
420 3300005455 Ga0070663_100150047 Ga0070663_1001500472 220
421 3300005456 Ga0070678_100173827 Ga0070678_1001738272 220
422 3300005457 Ga0070662_100159037 Ga0070662_1001590372 220
423 3300005539 Ga0068853_100006801 Ga0068853_1000068013 220
424 3300005548 Ga0070665_100060709 Ga0070665_1000607095 220
425 3300005578 Ga0068854_100000263 Ga0068854_1000002636 220
426 3300005834 Ga0068851_10064832 Ga0068851_100648322 220
427 3300006237 Ga0097621_100017199 Ga0097621_1000171995 220
428 3300009174 Ga0105241_10046419 Ga0105241_100464193 220
429 3300010375 Ga0105239_10032266 Ga0105239_100322664 220
430 3300013100 Ga0157373_10124552 Ga0157373_101245521 220
431 3300013105 Ga0157369_10216349 Ga0157369_102163493 220
432 3300013296 Ga0157374_10014640 Ga0157374_100146403 220
433 3300013306 Ga0163162_10006991 Ga0163162_100069919 220
434 3300025230 Ga0209563_100066 Ga0209563_10006614 220
435 3300025246 Ga0209646_1003676 Ga0209646_10036764 220
436 3300025254 Ga0209148_1000011 Ga0209148_1000011981 220
437 3300025272 Ga0209455_1000006 Ga0209455_1000006211 220
438 3300025315 Ga0207697_10091203 Ga0207697_100912031 220
439 3300025904 Ga0207647_10000554 Ga0207647_1000055413 220
440 3300025907 Ga0207645_10014423 Ga0207645_100144234 220
441 3300025909 Ga0207705_10030679 Ga0207705_100306793 220
442 3300025919 Ga0207657_10204488 Ga0207657_102044882 220
443 3300025926 Ga0207659_10731227 Ga0207659_107312271 220
444 3300025932 Ga0207690_10238809 Ga0207690_102388092 220
445 3300025933 Ga0207706_10125658 Ga0207706_101256582 220
446 3300025937 Ga0207669_10000501 Ga0207669_100005013 220
447 3300025960 Ga0207651_10449685 Ga0207651_104496851 220
448 3300025972 Ga0207668_10085817 Ga0207668_100858174 220
449 3300025981 Ga0207640_10001332 Ga0207640_100013329 220
450 3300026041 Ga0207639_10003636 Ga0207639_100036365 220
451 3300026067 Ga0207678_10004209 Ga0207678_100042096 220
452 3300026095 Ga0207676_10000706 Ga0207676_1000070614 220
453 3300026121 Ga0207683_10146474 Ga0207683_101464742 220
454 3300042012 Ga0439455_0000088 Ga0439455_0000088_7199_7963 220
455 3300042157 Ga0439458_0000570 Ga0439458_0000570_734_1438 220
456 3300046453 Ga0495627_015116 Ga0495627_015116_1937_2632 220
457 3300046506 Ga0495583_0012576 Ga0495583_0012576_2051_2749 220
458 3300046524 Ga0495648_0065210 Ga0495648_0065210_1243_1941 220
459 3300046558 Ga0495633_0004787 Ga0495633_0004787_6078_6773 220
460 3300046616 Ga0495668_0045688 Ga0495668_0045688_100_798 220
461 3300048090 Ga0495615_0000044 Ga0495615_0000044_36739_37449 220
462 3300048924 Ga0496121_0016557 Ga0496121_0016557_989_1690 220
463 3300048925 Ga0496122_0015133 Ga0496122_0015133_2924_3634 220
464 3300048926 Ga0496123_0001384 Ga0496123_0001384_4323_5033 220
465 3300053119 Ga0500595_020416 Ga0500595_020416_1481_2221 220
466 3300053120 Ga0500597_003468 Ga0500597_003468_340_1035 220
467 3300053130 Ga0500642_0000323 Ga0500642_0000323_12511_13209 220
468 3300053156 Ga0500622_0001744 Ga0500622_0001744_5470_6210 220
469 3300053157 Ga0500624_000006 Ga0500624_000006_24657_25352 220
470 3300053157 Ga0500624_000034 Ga0500624_000034_50670_51365 220
471 3300053157 Ga0500624_000729 Ga0500624_000729_3882_4577 220
472 3300053177 Ga0500636_0000992 Ga0500636_0000992_5393_6088 220
473 3300053178 Ga0500637_0000030 Ga0500637_0000030_20980_21675 220
474 3300031911 Ga0307412_10124482 Ga0307412_101244823 221
475 3300031911 Ga0307412_10661065 Ga0307412_106610652 221
476 3300032004 Ga0307414_10235151 Ga0307414_102351511 221
477 iso_pu_bacteria 2599185359 2600227944 221
478 iso_pu_bacteria 2818991466 2819714396 221
479 iso_pu_bacteria 2928526807 2928530611 221
480 iso_pu_bacteria 2928968154 2928968416 221
481 3300046460 Ga0495638_0000033 Ga0495638_0000033_106904_107608 222
482 3300046519 Ga0495632_0000187 Ga0495632_0000187_23292_23996 222
483 3300046524 Ga0495648_0000014 Ga0495648_0000014_180758_181462 222
484 3300046524 Ga0495648_0020289 Ga0495648_0020289_160_870 222
485 3300009101 Ga0105247_10001053 Ga0105247_1000105312 224
486 3300046524 Ga0495648_0102172 Ga0495648_0102172_472_1227 224
487 3300053118 Ga0500594_0003159 Ga0500594_0003159_690_1445 224
488 2162886007 SwRhRL2b_contig_1197694 SwRhRL2b_0867.00005340 225
489 3300005289 Ga0065704_10074353 Ga0065704_100743536 225
490 3300005347 Ga0070668_100068760 Ga0070668_1000687602 225
491 3300005548 Ga0070665_100043740 Ga0070665_1000437402 225
492 3300025972 Ga0207668_10020018 Ga0207668_100200182 225
493 3300048911 Ga0496108_0052231 Ga0496108_0052231_1856_2533 225
494 3300048924 Ga0496121_0001506 Ga0496121_0001506_22817_23494 225
495 3300048927 Ga0496124_0074778 Ga0496124_0074778_1767_2444 225
496 3300048928 Ga0496125_0026299 Ga0496125_0026299_26_703 225
497 3300048929 Ga0496126_0009110 Ga0496126_0009110_1615_2292 225

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mhd-assembly1.cif.gz_A nmr structure of the protein bacuni_03114 from bacteroides uniformis atcc 8492 0.8204 67 92
8fmw-assembly1.cif.gz_K the structure of a hibernating ribosome in the lyme disease pathogen 0.7981 65 89
6u7g-assembly1.cif.gz_A hcov-229e rbd class v in complex with human apn 0.7776 64 80
7vpq-assembly3.cif.gz_E structures of a deltacoronavirus spike protein bound to porcine and human receptors indicate the risk of virus adaptation to humans 0.7603 64 78
7u0l-assembly1.cif.gz_A crystal structure of the ccov-hupn-2018 rbd (domain b) in complex with canine apn 0.7581 64 80
ID Description Score Start End Superfamily
af_O01320_75_408_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9607 75 88 3.60.21.10
4k61B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9343 75 88 3.10.450.360
af_Q5A644_499_658_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9067 72 88 3.20.19.10
af_E9PYP2_2370_2578_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8976 75 88 2.130.10.10
af_X1WEM8_277_471_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.8884 74 90 2.110.10.10
ID Description Score Start End GO Terms
AF-A0A6J4BXL2-F1-model_v4 YkuD domain-containing protein 0.95 52 224
AF-A0A4Q6EU86-F1-model_v4 deleted 0.9442 44 214
AF-A0A085V545-F1-model_v4 L,D-transpeptidase 0.9425 44 216
AF-A0A2N2QKU9-F1-model_v4 L,D-transpeptidase 0.9423 43 216
AF-A0A6B9L272-F1-model_v4 L,D-transpeptidase 0.9408 43 224

Feature Viewer

pLDDT pTM Quality
81.26 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map