F455050

General Info

Members Datasets Scaffolds Average Seq Length
497 260 994 277

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10442517|Ga0207652_104425171
Length 322
Sequence MCASLVRFVAPRRPSASLTDPHRLFPTPANSSSDSEGGVATAVLDGITTRYELIGSGEPLLMFSPGGFDATLDKWTTQGIYSRIQPLEHLPKQYQCIVFDRRETGQSGGRVERVTWAHYVKQGKELLEHLQVPRAHIMGACMGCCPAIAFAVAHPETTQSVILYWPVGGARYRINSHLRFAQHLAYVQQHGLDGVVALAATGGKAFGEDPRGGPWVSVIRRDSAFAEAYAHQDVERYKLLVTGMARALFDRDTAPGAEPEDMLRLDIPALIVPGCDHTHAISAARYLEECLPGSEYWDAAVADQTGQTAPPRLLKFLEAVGG

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
259 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
260 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0.6
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 1.21
Rhizosphere 95.98
Stem 0
Stem Tuber 0
Unclassified 12.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10442517 3300025921 Bacteria 1172
2 JGI25152J39213_1002244 3300002773 Bacteria 7478
3 JGI25151J46595_10002302 3300003187 Bacteria 11668
4 Ga0065712_10070473 3300005290 Bacteria 5979
5 Ga0065707_10093332 3300005295 Bacteria 3636
6 Ga0070658_10013314 3300005327 Bacteria 6600
7 Ga0070683_100194678 3300005329 Bacteria 1925
8 Ga0070690_100004338 3300005330 Bacteria 7865
9 Ga0070690_100020042 3300005330 Bacteria 4070
10 Ga0070690_100115820 3300005330 Unclassified 1794
11 Ga0070670_100025132 3300005331 Bacteria 5125
12 Ga0068869_100004126 3300005334 Bacteria 9008
13 Ga0068869_100596824 3300005334 Unclassified 932
14 Ga0070666_10191052 3300005335 Bacteria 1439
15 Ga0070680_100067419 3300005336 Bacteria 2935
16 Ga0070682_100021550 3300005337 Bacteria 3805
17 Ga0068868_100010348 3300005338 Bacteria 6747
18 Ga0068868_100185716 3300005338 Unclassified 1727
19 Ga0068868_100296327 3300005338 Bacteria 1373
20 Ga0070660_100047581 3300005339 Bacteria 3292
21 Ga0070660_100162020 3300005339 Bacteria 1803
22 Ga0070660_100272620 3300005339 Bacteria 1383
23 Ga0070689_100001630 3300005340 Bacteria 14341
24 Ga0070689_100002381 3300005340 Bacteria 12260
25 Ga0070689_100019741 3300005340 Bacteria 4987
26 Ga0070689_100038864 3300005340 Bacteria 3642
27 Ga0070691_10012519 3300005341 Bacteria 3884
28 Ga0070687_100000589 3300005343 Bacteria 12059
29 Ga0070687_100000944 3300005343 Bacteria 9857
30 Ga0070687_100003826 3300005343 Bacteria 5911
31 Ga0070661_100093894 3300005344 Unclassified 2223
32 Ga0070692_10001092 3300005345 Bacteria 9442
33 Ga0070692_10009858 3300005345 Bacteria 4327
34 Ga0070692_10010914 3300005345 Bacteria 4156
35 Ga0070692_10242526 3300005345 Unclassified 1075
36 Ga0070669_100000739 3300005353 Bacteria 23805
37 Ga0070669_100038653 3300005353 Bacteria 3465
38 Ga0070675_100004027 3300005354 Bacteria 11160
39 Ga0070671_100100748 3300005355 Bacteria 2423
40 Ga0070674_100259009 3300005356 Bacteria 1370
41 Ga0070674_100382010 3300005356 Unclassified 1146
42 Ga0070673_100085151 3300005364 Bacteria 2572
43 Ga0070673_100169228 3300005364 Bacteria 1864
44 Ga0070673_100496020 3300005364 Unclassified 1104
45 Ga0070688_100085610 3300005365 Unclassified 2049
46 Ga0070659_100214562 3300005366 Bacteria 1587
47 Ga0070667_100335539 3300005367 Unclassified 1366
48 Ga0070709_10035402 3300005434 Bacteria 3034
49 Ga0070713_100029477 3300005436 Bacteria 4348
50 Ga0070713_100541838 3300005436 Bacteria 1101
51 Ga0070701_10001335 3300005438 Bacteria 9088
52 Ga0070701_10025666 3300005438 Unclassified 2864
53 Ga0070705_100002633 3300005440 Bacteria 8982
54 Ga0070705_100120927 3300005440 Bacteria 1691
55 Ga0070700_100002196 3300005441 Bacteria 9926
56 Ga0070700_100002868 3300005441 Bacteria 8851
57 Ga0070700_100126128 3300005441 Bacteria 1721
58 Ga0070694_100003761 3300005444 Bacteria 9050
59 Ga0070694_100011985 3300005444 Bacteria 5381
60 Ga0070708_100086656 3300005445 Bacteria 2845
61 Ga0070663_100210653 3300005455 Bacteria 1521
62 Ga0070662_100254919 3300005457 Bacteria 1412
63 Ga0070681_10018488 3300005458 Bacteria 6966
64 Ga0068867_100001111 3300005459 Bacteria 18396
65 Ga0070707_100122404 3300005468 Bacteria 2526
66 Ga0070707_100163813 3300005468 Unclassified 2167
67 Ga0070698_100061476 3300005471 Bacteria 3790
68 Ga0070698_100147471 3300005471 Bacteria 2301
69 Ga0070699_100024712 3300005518 Bacteria 5179
70 Ga0070699_100080295 3300005518 Bacteria 2842
71 Ga0070699_100366391 3300005518 Bacteria 1299
72 Ga0070679_100009917 3300005530 Bacteria 9015
73 Ga0070679_100021634 3300005530 Bacteria 6280
74 Ga0070679_100044051 3300005530 Bacteria 4445
75 Ga0070679_100060983 3300005530 Bacteria 3760
76 Ga0070697_100066831 3300005536 Bacteria 2939
77 Ga0070672_100052304 3300005543 Bacteria 3188
78 Ga0070686_100001993 3300005544 Bacteria 11326
79 Ga0070686_100060847 3300005544 Bacteria 2438
80 Ga0070695_100000119 3300005545 Bacteria 35208
81 Ga0070695_100071885 3300005545 Unclassified 2267
82 Ga0070696_100001893 3300005546 Bacteria 13753
83 Ga0070696_100002330 3300005546 Bacteria 12526
84 Ga0070696_100016170 3300005546 Bacteria 5019
85 Ga0070696_100188597 3300005546 Bacteria 1533
86 Ga0070693_100000127 3300005547 Bacteria 33921
87 Ga0070693_100001974 3300005547 Bacteria 9381
88 Ga0070704_100001015 3300005549 Bacteria 14398
89 Ga0070704_100003160 3300005549 Bacteria 9404
90 Ga0070704_100325349 3300005549 Unclassified 1289
91 Ga0068855_100007527 3300005563 Bacteria 13179
92 Ga0068855_100025331 3300005563 Bacteria 7099
93 Ga0068855_100045031 3300005563 Bacteria 5219
94 Ga0068855_100129652 3300005563 Bacteria 2881
95 Ga0070664_100102131 3300005564 Bacteria 2495
96 Ga0070664_100213414 3300005564 Bacteria 1725
97 Ga0070664_100233221 3300005564 Unclassified 1650
98 Ga0068857_100011180 3300005577 Bacteria 7806
99 Ga0068854_100099101 3300005578 Bacteria 2182
100 Ga0068854_100206438 3300005578 Bacteria 1547
101 Ga0068856_100014358 3300005614 Bacteria 7656
102 Ga0068856_100312518 3300005614 Bacteria 1589
103 Ga0070702_100000108 3300005615 Bacteria 24750
104 Ga0068852_100006266 3300005616 Bacteria 8584
105 Ga0068852_100248778 3300005616 Unclassified 1702
106 Ga0068859_100003614 3300005617 Bacteria 15773
107 Ga0068859_100004426 3300005617 Bacteria 14335
108 Ga0068859_100008842 3300005617 Bacteria 10171
109 Ga0068859_100070553 3300005617 Bacteria 3529
110 Ga0068864_100011261 3300005618 Bacteria 7390
111 Ga0068864_100021156 3300005618 Bacteria 5447
112 Ga0068864_100439327 3300005618 Archaea 1246
113 Ga0068866_10000313 3300005718 Bacteria 23077
114 Ga0068866_10024185 3300005718 Bacteria 2836
115 Ga0068861_100000907 3300005719 Bacteria 17996
116 Ga0068861_100003818 3300005719 Bacteria 10057
117 Ga0068851_10001733 3300005834 Bacteria 9534
118 Ga0068851_10146763 3300005834 Unclassified 1287
119 Ga0068870_10008661 3300005840 Bacteria 4587
120 Ga0068870_10056386 3300005840 Unclassified 2097
121 Ga0068863_100122628 3300005841 Bacteria 2479
122 Ga0068858_100124664 3300005842 Bacteria 2411
123 Ga0068860_100004139 3300005843 Bacteria 14865
124 Ga0068860_100054538 3300005843 Unclassified 3800
125 Ga0068862_100000936 3300005844 Bacteria 28121
126 Ga0068862_100002917 3300005844 Bacteria 14948
127 Ga0068862_100203596 3300005844 Unclassified 1786
128 Ga0081540_1056739 3300005983 Bacteria 1898
129 Ga0081539_10001417 3300005985 Bacteria 41272
130 Ga0075364_10055243 3300006051 Bacteria 2598
131 Ga0097621_100009848 3300006237 Bacteria 6958
132 Ga0097621_100024328 3300006237 Bacteria 4728
133 Ga0068871_100004464 3300006358 Bacteria 9743
134 Ga0068871_100030712 3300006358 Unclassified 4234
135 Ga0075428_100002764 3300006844 Bacteria 19110
136 Ga0075428_100006150 3300006844 Bacteria 13360
137 Ga0075428_100202000 3300006844 Bacteria 2148
138 Ga0075428_100372906 3300006844 Bacteria 1530
139 Ga0075430_100000025 3300006846 Bacteria 80014
140 Ga0075430_100002628 3300006846 Bacteria 14996
141 Ga0075430_100074426 3300006846 Bacteria 2848
142 Ga0075431_100006010 3300006847 Bacteria 12028
143 Ga0075433_10000184 3300006852 Bacteria 35069
144 Ga0075433_10025481 3300006852 Bacteria 5000
145 Ga0075433_10033203 3300006852 Bacteria 4423
146 Ga0075433_10210112 3300006852 Bacteria 1729
147 Ga0075434_100001205 3300006871 Bacteria 21511
148 Ga0075434_100002746 3300006871 Bacteria 15560
149 Ga0075434_100006588 3300006871 Bacteria 10655
150 Ga0075434_100020008 3300006871 Bacteria 6483
151 Ga0075434_100282929 3300006871 Bacteria 1678
152 Ga0075429_100000791 3300006880 Bacteria 24921
153 Ga0075429_100000861 3300006880 Bacteria 23902
154 Ga0075429_100100489 3300006880 Unclassified 2525
155 Ga0068865_100001098 3300006881 Bacteria 15613
156 Ga0068865_100198019 3300006881 Bacteria 1558
157 Ga0075436_100003452 3300006914 Bacteria 10834
158 Ga0075436_100004153 3300006914 Bacteria 9938
159 Ga0097620_100003614 3300006931 Bacteria 15773
160 Ga0097620_100004426 3300006931 Bacteria 14335
161 Ga0097620_100008842 3300006931 Bacteria 10171
162 Ga0097620_100070554 3300006931 Bacteria 3529
163 Ga0075435_100001390 3300007076 Bacteria 15588
164 Ga0075435_100094827 3300007076 Bacteria 2467
165 Ga0075435_100125410 3300007076 Bacteria 2145
166 Ga0075435_100262459 3300007076 Bacteria 1472
167 Ga0099795_10027132 3300007788 Bacteria 1935
168 Ga0105240_10001549 3300009093 Bacteria 39012
169 Ga0105240_10013407 3300009093 Bacteria 11256
170 Ga0105240_10048130 3300009093 Bacteria 5391
171 Ga0111539_10010594 3300009094 Bacteria 11609
172 Ga0111539_10013492 3300009094 Bacteria 10212
173 Ga0111539_10167460 3300009094 Bacteria 2568
174 Ga0105245_10034361 3300009098 Bacteria 4497
175 Ga0105245_10482859 3300009098 Unclassified 1253
176 Ga0105247_10087431 3300009101 Bacteria 1973
177 Ga0114129_10001681 3300009147 Bacteria 30160
178 Ga0114129_10006237 3300009147 Bacteria 16900
179 Ga0114129_10006413 3300009147 Bacteria 16679
180 Ga0114129_10007507 3300009147 Bacteria 15529
181 Ga0114129_10047324 3300009147 Bacteria 6043
182 Ga0114129_10061432 3300009147 Bacteria 5250
183 Ga0114129_10063567 3300009147 Bacteria 5153
184 Ga0114129_10388605 3300009147 Bacteria 1841
185 Ga0105243_10001272 3300009148 Bacteria 22626
186 Ga0105243_10043330 3300009148 Bacteria 3527
187 Ga0105241_10007326 3300009174 Bacteria 8115
188 Ga0105242_10001382 3300009176 Bacteria 19140
189 Ga0105242_10234675 3300009176 Bacteria 1646
190 Ga0105242_10668424 3300009176 Unclassified 1012
191 Ga0105248_10003723 3300009177 Bacteria 16907
192 Ga0105248_10075069 3300009177 Bacteria 3800
193 Ga0105237_10003738 3300009545 Bacteria 17928
194 Ga0105238_10316315 3300009551 Unclassified 1547
195 Ga0105249_10057529 3300009553 Bacteria 3562
196 Ga0099796_10091068 3300010159 Bacteria 1134
197 Ga0105239_10005317 3300010375 Bacteria 15112
198 Ga0157370_10138276 3300013104 Bacteria 2269
199 Ga0157370_10150790 3300013104 Bacteria 2163
200 Ga0157369_10025313 3300013105 Bacteria 6588
201 Ga0157369_10071818 3300013105 Bacteria 3715
202 Ga0157369_10082101 3300013105 Bacteria 3449
203 Ga0157369_10455588 3300013105 Bacteria 1325
204 Ga0157378_10001037 3300013297 Bacteria 25377
205 Ga0157375_10001304 3300013308 Bacteria 21478
206 Ga0157375_10099281 3300013308 Bacteria 2990
207 Ga0157375_10876990 3300013308 Unclassified 1042
208 Ga0163163_10032514 3300014325 Bacteria 5038
209 Ga0157380_10043695 3300014326 Bacteria 3509
210 Ga0157377_10018411 3300014745 Bacteria 3629
211 Ga0157379_10108646 3300014968 Bacteria 2491
212 Ga0157379_10369286 3300014968 Unclassified 1315
213 Ga0157376_10005146 3300014969 Bacteria 9117
214 Ga0157376_10073457 3300014969 Bacteria 2912
215 Ga0157376_10565151 3300014969 Unclassified 1127
216 Ga0206354_10518364 3300020081 Bacteria 3094
217 Ga0206353_10821866 3300020082 Bacteria 3660
218 Ga0206353_12060367 3300020082 Bacteria 1757
219 Ga0213874_10006611 3300021377 Bacteria 2749
220 Ga0209129_1000209 3300025258 Bacteria 68109
221 Ga0209025_1001222 3300025294 Bacteria 35884
222 Ga0209051_1020707 3300025303 Bacteria 2821
223 Ga0207653_10047855 3300025885 Unclassified 1417
224 Ga0207682_10060777 3300025893 Bacteria 1581
225 Ga0207642_10000189 3300025899 Bacteria 17896
226 Ga0207710_10044993 3300025900 Bacteria 1967
227 Ga0207688_10016669 3300025901 Bacteria 3989
228 Ga0207688_10128978 3300025901 Bacteria 1481
229 Ga0207647_10167860 3300025904 Unclassified 1279
230 Ga0207645_10008807 3300025907 Bacteria 7015
231 Ga0207643_10036678 3300025908 Unclassified 2749
232 Ga0207705_10117703 3300025909 Bacteria 1968
233 Ga0207705_10232792 3300025909 Bacteria 1402
234 Ga0207654_10011756 3300025911 Bacteria 4468
235 Ga0207654_10284504 3300025911 Bacteria 1119
236 Ga0207707_10330841 3300025912 Unclassified 1314
237 Ga0207695_10031065 3300025913 Bacteria 5869
238 Ga0207695_10148241 3300025913 Bacteria 2288
239 Ga0207695_10313422 3300025913 Bacteria 1459
240 Ga0207671_10050843 3300025914 Bacteria 3069
241 Ga0207660_10007365 3300025917 Bacteria 7121
242 Ga0207662_10000129 3300025918 Bacteria 36284
243 Ga0207662_10003970 3300025918 Bacteria 7707
244 Ga0207662_10031949 3300025918 Bacteria 3061
245 Ga0207662_10037247 3300025918 Bacteria 2846
246 Ga0207657_10017444 3300025919 Bacteria 6881
247 Ga0207657_10034748 3300025919 Bacteria 4529
248 Ga0207657_10142045 3300025919 Bacteria 1961
249 Ga0207657_10268746 3300025919 Unclassified 1356
250 Ga0207652_10023768 3300025921 Bacteria 5081
251 Ga0207652_10035287 3300025921 Bacteria 4220
252 Ga0207652_10050298 3300025921 Bacteria 3570
253 Ga0207646_10045385 3300025922 Bacteria 3945
254 Ga0207681_10000767 3300025923 Bacteria 21112
255 Ga0207681_10069714 3300025923 Bacteria 2446
256 Ga0207659_10000497 3300025926 Bacteria 23633
257 Ga0207687_10004697 3300025927 Bacteria 9084
258 Ga0207700_10477935 3300025928 Bacteria 1101
259 Ga0207664_10026331 3300025929 Bacteria 4395
260 Ga0207664_10030964 3300025929 Bacteria 4090
261 Ga0207664_10248452 3300025929 Bacteria 1552
262 Ga0207706_10018637 3300025933 Bacteria 6245
263 Ga0207706_10095263 3300025933 Bacteria 2618
264 Ga0207709_10006326 3300025935 Bacteria 6647
265 Ga0207709_10021550 3300025935 Bacteria 3649
266 Ga0207670_10004745 3300025936 Bacteria 7372
267 Ga0207670_10008727 3300025936 Bacteria 5739
268 Ga0207670_10053800 3300025936 Bacteria 2714
269 Ga0207704_10001920 3300025938 Bacteria 9309
270 Ga0207704_10154555 3300025938 Bacteria 1624
271 Ga0207665_10017478 3300025939 Bacteria 4713
272 Ga0207691_10008336 3300025940 Bacteria 9955
273 Ga0207691_10065486 3300025940 Bacteria 3289
274 Ga0207711_10189238 3300025941 Unclassified 1875
275 Ga0207711_10517536 3300025941 Bacteria 1112
276 Ga0207689_10001252 3300025942 Bacteria 24466
277 Ga0207661_10178541 3300025944 Bacteria 1853
278 Ga0207679_10202796 3300025945 Unclassified 1658
279 Ga0207667_10046370 3300025949 Bacteria 4602
280 Ga0207667_10098540 3300025949 Bacteria 3016
281 Ga0207667_10508205 3300025949 Unclassified 1222
282 Ga0207651_10027542 3300025960 Bacteria 3571
283 Ga0207651_10040336 3300025960 Bacteria 3088
284 Ga0207651_10059945 3300025960 Bacteria 2639
285 Ga0207651_10154866 3300025960 Bacteria 1789
286 Ga0207651_10268765 3300025960 Unclassified 1403
287 Ga0207712_10002359 3300025961 Bacteria 12238
288 Ga0207712_10300858 3300025961 Bacteria 1316
289 Ga0207668_10054058 3300025972 Bacteria 2786
290 Ga0207640_10079293 3300025981 Bacteria 2238
291 Ga0207640_10341549 3300025981 Bacteria 1199
292 Ga0207658_10411883 3300025986 Bacteria 1190
293 Ga0207677_10001416 3300026023 Bacteria 12780
294 Ga0207677_10141720 3300026023 Bacteria 1841
295 Ga0207703_10005111 3300026035 Bacteria 10615
296 Ga0207703_10149316 3300026035 Bacteria 2036
297 Ga0207703_10164753 3300026035 Bacteria 1944
298 Ga0207678_10156670 3300026067 Bacteria 1945
299 Ga0207708_10002615 3300026075 Bacteria 13244
300 Ga0207708_10006156 3300026075 Bacteria 8890
301 Ga0207708_10014709 3300026075 Bacteria 5857
302 Ga0207708_10224458 3300026075 Unclassified 1506
303 Ga0207702_10015546 3300026078 Bacteria 6299
304 Ga0207702_10119779 3300026078 Bacteria 2354
305 Ga0207702_10477455 3300026078 Unclassified 1213
306 Ga0207641_10291215 3300026088 Bacteria 1539
307 Ga0207648_10000694 3300026089 Bacteria 37737
308 Ga0207648_10004111 3300026089 Bacteria 15063
309 Ga0207648_10091909 3300026089 Bacteria 2653
310 Ga0207676_10004823 3300026095 Bacteria 9569
311 Ga0207676_10496345 3300026095 Archaea 1158
312 Ga0207674_10015241 3300026116 Bacteria 8456
313 Ga0207675_100001566 3300026118 Bacteria 22938
314 Ga0207675_100003494 3300026118 Bacteria 15335
315 Ga0207683_10068279 3300026121 Bacteria 3138
316 Ga0207698_10059126 3300026142 Bacteria 2974
317 Ga0207698_10340968 3300026142 Unclassified 1412
318 Ga0207428_10001021 3300027907 Bacteria 31005
319 Ga0207428_10002697 3300027907 Bacteria 17692
320 Ga0268265_10000250 3300028380 Bacteria 61194
321 Ga0268264_10003112 3300028381 Bacteria 14374
322 Ga0268264_10048815 3300028381 Bacteria 3520
323 Ga0307405_10006513 3300031731 Bacteria 5752
324 Ga0307413_10423216 3300031824 Bacteria 1049
325 Ga0307409_100356341 3300031995 Bacteria 1382
326 Ga0307416_100019136 3300032002 Unclassified 4847
327 Ga0307416_100063646 3300032002 Bacteria 3022
328 Ga0307414_10039941 3300032004 Unclassified 3166
329 Ga0373929_0010336 3300035085 Bacteria 1744
330 Ga0373940_0000337 3300035088 Bacteria 6950
331 Ga0373949_0008815 3300035090 Bacteria 2206
332 Ga0373951_0022989 3300035091 Unclassified 1438
333 Ga0373951_0041162 3300035091 Bacteria 1115
334 Ga0373932_0001737 3300035112 Bacteria 5916
335 Ga0373932_0052775 3300035112 Bacteria 1212
336 Ga0373939_0001577 3300035114 Bacteria 5510
337 Ga0373939_0119858 3300035114 Bacteria 927
338 Ga0373943_0035130 3300035170 Bacteria 2393
339 Ga0373946_0005434 3300035171 Bacteria 4593
340 Ga0373942_0014634 3300035207 Bacteria 1902
341 Ga0373924_0224914 3300035410 Unclassified 829
342 Ga0373931_0000241 3300035691 Bacteria 23316
343 Ga0373931_0008932 3300035691 Bacteria 4776
344 Ga0373931_0017095 3300035691 Bacteria 3580
345 Ga0373927_0028091 3300035695 Bacteria 3671
346 Ga0373927_0030803 3300035695 Bacteria 3499
347 Ga0373927_0272747 3300035695 Bacteria 1112
348 Ga0373947_0006419 3300035725 Bacteria 6832
349 Ga0373947_0020977 3300035725 Bacteria 3779
350 Ga0373937_0025238 3300036401 Bacteria 5366
351 Ga0373925_0011326 3300037068 Bacteria 6473
352 Ga0373925_0014719 3300037068 Bacteria 5651
353 Ga0395899_0013855 3300037312 Bacteria 6160
354 Ga0395899_0090266 3300037312 Bacteria 2222
355 Ga0395899_0280303 3300037312 Bacteria 1134
356 Ga0395900_0038519 3300037418 Bacteria 4928
357 Ga0395900_0061432 3300037418 Bacteria 3863
358 Ga0395900_0092102 3300037418 Unclassified 3114
359 Ga0395898_0020470 3300037466 Bacteria 6719
360 Ga0395898_0049273 3300037466 Bacteria 4127
361 Ga0395898_0092505 3300037466 Bacteria 2908
362 Ga0395898_0149099 3300037466 Unclassified 2238
363 Ga0395898_0846728 3300037466 Bacteria 854
364 Ga0395905_0001763 3300037471 Bacteria 25156
365 Ga0395905_0008282 3300037471 Bacteria 10263
366 Ga0395905_0164077 3300037471 Unclassified 2088
367 Ga0436364_1387586 3300037853 Unclassified 1505
368 Ga0395901_0036400 3300038443 Bacteria 5087
369 Ga0395901_0069595 3300038443 Bacteria 3665
370 Ga0395901_0125439 3300038443 Unclassified 2698
371 Ga0395901_0146838 3300038443 Unclassified 2478
372 Ga0395901_0179988 3300038443 Bacteria 2217
373 Ga0395901_0208924 3300038443 Bacteria 2044
374 Ga0395901_0254520 3300038443 Unclassified 1829
375 Ga0395901_0746506 3300038443 Bacteria 972
376 Ga0436360_0914783 3300039438 Bacteria 2421
377 Ga0436363_0863487 3300039450 Bacteria 9192
378 Ga0439433_0028318 3300041999 Bacteria 1274
379 Ga0466971_0074705 3300044719 Bacteria 1541
380 Ga0451576_0000943 3300045051 Bacteria 54571
381 Ga0451576_0013931 3300045051 Bacteria 8978
382 Ga0451576_0030765 3300045051 Bacteria 5731
383 Ga0451576_0085241 3300045051 Bacteria 3286
384 Ga0451576_0684810 3300045051 Bacteria 1077
385 Ga0466958_0067331 3300045836 Bacteria 2188
386 Ga0466967_0012019 3300045976 Bacteria 6599
387 Ga0466967_0086887 3300045976 Bacteria 2834
388 Ga0466967_0161123 3300045976 Bacteria 2106
389 Ga0466967_0515654 3300045976 Bacteria 1174
390 Ga0495603_0022845 3300046455 Bacteria 3785
391 Ga0495603_0049724 3300046455 Bacteria 2495
392 Ga0495580_0025522 3300046472 Bacteria 4319
393 Ga0495582_0034892 3300046473 Bacteria 2765
394 Ga0495639_0000729 3300046475 Bacteria 15058
395 Ga0495585_0015337 3300046492 Bacteria 4453
396 Ga0495594_0007156 3300046499 Bacteria 5740
397 Ga0495616_0090274 3300046513 Bacteria 1452
398 Ga0495648_0019512 3300046524 Bacteria 4765
399 Ga0495666_0002339 3300046526 Bacteria 9454
400 Ga0495642_0038883 3300046528 Bacteria 1929
401 Ga0495642_0049708 3300046528 Bacteria 1723
402 Ga0495586_0074502 3300046535 Bacteria 1858
403 Ga0495598_0008203 3300046537 Bacteria 2423
404 Ga0495609_0019622 3300046538 Bacteria 3126
405 Ga0495659_0006640 3300046664 Bacteria 3654
406 Ga0495659_0046313 3300046664 Bacteria 1570
407 Ga0495659_0084731 3300046664 Bacteria 1208
408 Ga0495588_0019464 3300046674 Bacteria 3324
409 Ga0495588_0033178 3300046674 Bacteria 2606
410 Ga0495647_0000346 3300046681 Bacteria 13066
411 Ga0495658_0000928 3300046683 Bacteria 15631
412 Ga0495658_0085237 3300046683 Bacteria 1862
413 Ga0495581_0208706 3300047315 Bacteria 1142
414 Ga0495674_0055230 3300047319 Bacteria 3484
415 Ga0495676_0021141 3300047321 Bacteria 5695
416 Ga0495676_0065396 3300047321 Bacteria 2823
417 Ga0495626_0045637 3300048091 Bacteria 2044
418 Ga0496102_0069688 3300048905 Unclassified 3228
419 Ga0496105_0157086 3300048908 Bacteria 1867
420 Ga0496106_0000002 3300048909 Bacteria 377020
421 Ga0496107_0003143 3300048910 Bacteria 10982
422 Ga0496107_0132210 3300048910 Bacteria 1842
423 Ga0496109_0611497 3300048912 Bacteria 1026
424 Ga0496121_0271624 3300048924 Bacteria 1165
425 Ga0496125_0017578 3300048928 Bacteria 6812
426 Ga0501038_0332230 3300049574 Unclassified 1187
427 Ga0501039_0031631 3300049575 Bacteria 4080
428 Ga0501040_0043266 3300049576 Bacteria 3069
429 Ga0501041_0058300 3300049577 Bacteria 2362
430 Ga0501043_0020143 3300049579 Bacteria 5236
431 Ga0501046_0058189 3300049580 Bacteria 3030
432 Ga0501067_0009808 3300049583 Bacteria 5300
433 Ga0501068_0416822 3300049584 Bacteria 867
434 Ga0501069_0009197 3300049585 Bacteria 5214
435 Ga0501070_0042712 3300049586 Bacteria 3775
436 Ga0501071_0003591 3300049587 Bacteria 9717
437 Ga0501071_0009285 3300049587 Bacteria 6545
438 Ga0501072_0225218 3300049588 Bacteria 1494
439 Ga0501072_0408392 3300049588 Unclassified 1077
440 Ga0501074_0008292 3300049590 Bacteria 7535
441 Ga0501075_0014476 3300049591 Bacteria 5652
442 Ga0501075_0052702 3300049591 Bacteria 3059
443 Ga0501075_0083070 3300049591 Unclassified 2426
444 Ga0501076_0009296 3300049592 Bacteria 7253
445 Ga0501076_0027926 3300049592 Bacteria 4378
446 Ga0501080_0040093 3300049742 Bacteria 4370
447 Ga0501081_0063078 3300049743 Bacteria 2571
448 Ga0501044_0382724 3300049823 Unclassified 1322
449 nmdc:mga05p37_114_c1 3300050507 Bacteria 73016
450 nmdc:mga05p37_1418_c1 3300050507 Bacteria 27846
451 nmdc:mga05p37_157844_c1 3300050507 Bacteria 2310
452 nmdc:mga05p37_3406_c1 3300050507 Bacteria 18556
453 nmdc:mga05p37_4640_c1 3300050507 Bacteria 16071
454 nmdc:mga05p37_582533_c1 3300050507 Unclassified 1267
455 nmdc:mga05p37_740768_c1 3300050507 Bacteria 1085
456 nmdc:mga09592_2028_c1 3300050508 Bacteria 16332
457 nmdc:mga09592_2696_c1 3300050508 Bacteria 14364
458 nmdc:mga09592_72000_c1 3300050508 Bacteria 2934
459 nmdc:mga09592_80831_c1 3300050508 Unclassified 2768
460 nmdc:mga0qj67_11_c1 3300050509 Bacteria 141088
461 nmdc:mga0qj67_20_c1 3300050509 Bacteria 109238
462 nmdc:mga0qj67_2801_c1 3300050509 Bacteria 12509
463 nmdc:mga06r32_17409_c1 3300050510 Bacteria 6559
464 nmdc:mga06r32_177998_c1 3300050510 Bacteria 2112
465 nmdc:mga08y16_18281_c1 3300050511 Bacteria 7385
466 nmdc:mga08y16_186598_c1 3300050511 Bacteria 2152
467 nmdc:mga08y16_20772_c1 3300050511 Bacteria 6932
468 nmdc:mga08y16_26799_c1 3300050511 Bacteria 6073
469 nmdc:mga08y16_644402_c1 3300050511 Unclassified 1064
470 nmdc:mga08y16_948_c1 3300050511 Bacteria 28184
471 nmdc:mga0n895_16816_c1 3300050512 Bacteria 6723
472 nmdc:mga0n895_290847_c1 3300050512 Bacteria 1657
473 nmdc:mga0n895_300195_c1 3300050512 Bacteria 1628
474 nmdc:mga0n895_60514_c1 3300050512 Bacteria 3737
475 nmdc:mga0n895_69295_c1 3300050512 Bacteria 3494
476 nmdc:mga0n895_84055_c1 3300050512 Bacteria 3176
477 nmdc:mga0rr50_230628_c1 3300050513 Bacteria 1532
478 nmdc:mga0rr50_29297_c1 3300050513 Bacteria 3881
479 nmdc:mga0rr50_334960_c1 3300050513 Bacteria 1271
480 nmdc:mga0rr50_51812_c1 3300050513 Bacteria 3047
481 nmdc:mga08x19_117608_c1 3300050514 Unclassified 1778
482 nmdc:mga08x19_54352_c1 3300050514 Bacteria 2578
483 nmdc:mga08x19_6294_c1 3300050514 Bacteria 7026
484 nmdc:mga08x19_7690_c1 3300050514 Bacteria 6399
485 nmdc:mga0a205_17445_c1 3300050515 Bacteria 4217
486 nmdc:mga0a205_175606_c1 3300050515 Unclassified 2038
487 nmdc:mga0a205_17623_c1 3300050515 Bacteria 6702
488 nmdc:mga0a205_41308_c1 3300050515 Bacteria 4441
489 Ga0500590_047739 3300053148 Bacteria 2184
490 Ga0501084_0055313 3300054114 Bacteria 3320
491 Ga0501084_0092820 3300054114 Bacteria 2534
492 Ga0501082_0043799 3300060353 Bacteria 3860
493 Ga0530510_0030841 3300061734 Bacteria 3852
494 Ga0530510_0342595 3300061734 Unclassified 1122
495 2585391087 2582581865 Bacteria 6644329
496 2885277847 2885270888 Bacteria 9831543
497 2929214637 2929212328 Bacteria 7708288
498 Ga0207652_10442517
499 JGI25152J39213_1002244
500 JGI25151J46595_10002302
501 Ga0065712_10070473
502 Ga0065707_10093332
503 Ga0070658_10013314
504 Ga0070683_100194678
505 Ga0070690_100004338
506 Ga0070690_100020042
507 Ga0070690_100115820
508 Ga0070670_100025132
509 Ga0068869_100004126
510 Ga0068869_100596824
511 Ga0070666_10191052
512 Ga0070680_100067419
513 Ga0070682_100021550
514 Ga0068868_100010348
515 Ga0068868_100185716
516 Ga0068868_100296327
517 Ga0070660_100047581
518 Ga0070660_100162020
519 Ga0070660_100272620
520 Ga0070689_100001630
521 Ga0070689_100002381
522 Ga0070689_100019741
523 Ga0070689_100038864
524 Ga0070691_10012519
525 Ga0070687_100000589
526 Ga0070687_100000944
527 Ga0070687_100003826
528 Ga0070661_100093894
529 Ga0070692_10001092
530 Ga0070692_10009858
531 Ga0070692_10010914
532 Ga0070692_10242526
533 Ga0070669_100000739
534 Ga0070669_100038653
535 Ga0070675_100004027
536 Ga0070671_100100748
537 Ga0070674_100259009
538 Ga0070674_100382010
539 Ga0070673_100085151
540 Ga0070673_100169228
541 Ga0070673_100496020
542 Ga0070688_100085610
543 Ga0070659_100214562
544 Ga0070667_100335539
545 Ga0070709_10035402
546 Ga0070713_100029477
547 Ga0070713_100541838
548 Ga0070701_10001335
549 Ga0070701_10025666
550 Ga0070705_100002633
551 Ga0070705_100120927
552 Ga0070700_100002196
553 Ga0070700_100002868
554 Ga0070700_100126128
555 Ga0070694_100003761
556 Ga0070694_100011985
557 Ga0070708_100086656
558 Ga0070663_100210653
559 Ga0070662_100254919
560 Ga0070681_10018488
561 Ga0068867_100001111
562 Ga0070707_100122404
563 Ga0070707_100163813
564 Ga0070698_100061476
565 Ga0070698_100147471
566 Ga0070699_100024712
567 Ga0070699_100080295
568 Ga0070699_100366391
569 Ga0070679_100009917
570 Ga0070679_100021634
571 Ga0070679_100044051
572 Ga0070679_100060983
573 Ga0070697_100066831
574 Ga0070672_100052304
575 Ga0070686_100001993
576 Ga0070686_100060847
577 Ga0070695_100000119
578 Ga0070695_100071885
579 Ga0070696_100001893
580 Ga0070696_100002330
581 Ga0070696_100016170
582 Ga0070696_100188597
583 Ga0070693_100000127
584 Ga0070693_100001974
585 Ga0070704_100001015
586 Ga0070704_100003160
587 Ga0070704_100325349
588 Ga0068855_100007527
589 Ga0068855_100025331
590 Ga0068855_100045031
591 Ga0068855_100129652
592 Ga0070664_100102131
593 Ga0070664_100213414
594 Ga0070664_100233221
595 Ga0068857_100011180
596 Ga0068854_100099101
597 Ga0068854_100206438
598 Ga0068856_100014358
599 Ga0068856_100312518
600 Ga0070702_100000108
601 Ga0068852_100006266
602 Ga0068852_100248778
603 Ga0068859_100003614
604 Ga0068859_100004426
605 Ga0068859_100008842
606 Ga0068859_100070553
607 Ga0068864_100011261
608 Ga0068864_100021156
609 Ga0068864_100439327
610 Ga0068866_10000313
611 Ga0068866_10024185
612 Ga0068861_100000907
613 Ga0068861_100003818
614 Ga0068851_10001733
615 Ga0068851_10146763
616 Ga0068870_10008661
617 Ga0068870_10056386
618 Ga0068863_100122628
619 Ga0068858_100124664
620 Ga0068860_100004139
621 Ga0068860_100054538
622 Ga0068862_100000936
623 Ga0068862_100002917
624 Ga0068862_100203596
625 Ga0081540_1056739
626 Ga0081539_10001417
627 Ga0075364_10055243
628 Ga0097621_100009848
629 Ga0097621_100024328
630 Ga0068871_100004464
631 Ga0068871_100030712
632 Ga0075428_100002764
633 Ga0075428_100006150
634 Ga0075428_100202000
635 Ga0075428_100372906
636 Ga0075430_100000025
637 Ga0075430_100002628
638 Ga0075430_100074426
639 Ga0075431_100006010
640 Ga0075433_10000184
641 Ga0075433_10025481
642 Ga0075433_10033203
643 Ga0075433_10210112
644 Ga0075434_100001205
645 Ga0075434_100002746
646 Ga0075434_100006588
647 Ga0075434_100020008
648 Ga0075434_100282929
649 Ga0075429_100000791
650 Ga0075429_100000861
651 Ga0075429_100100489
652 Ga0068865_100001098
653 Ga0068865_100198019
654 Ga0075436_100003452
655 Ga0075436_100004153
656 Ga0097620_100003614
657 Ga0097620_100004426
658 Ga0097620_100008842
659 Ga0097620_100070554
660 Ga0075435_100001390
661 Ga0075435_100094827
662 Ga0075435_100125410
663 Ga0075435_100262459
664 Ga0099795_10027132
665 Ga0105240_10001549
666 Ga0105240_10013407
667 Ga0105240_10048130
668 Ga0111539_10010594
669 Ga0111539_10013492
670 Ga0111539_10167460
671 Ga0105245_10034361
672 Ga0105245_10482859
673 Ga0105247_10087431
674 Ga0114129_10001681
675 Ga0114129_10006237
676 Ga0114129_10006413
677 Ga0114129_10007507
678 Ga0114129_10047324
679 Ga0114129_10061432
680 Ga0114129_10063567
681 Ga0114129_10388605
682 Ga0105243_10001272
683 Ga0105243_10043330
684 Ga0105241_10007326
685 Ga0105242_10001382
686 Ga0105242_10234675
687 Ga0105242_10668424
688 Ga0105248_10003723
689 Ga0105248_10075069
690 Ga0105237_10003738
691 Ga0105238_10316315
692 Ga0105249_10057529
693 Ga0099796_10091068
694 Ga0105239_10005317
695 Ga0157370_10138276
696 Ga0157370_10150790
697 Ga0157369_10025313
698 Ga0157369_10071818
699 Ga0157369_10082101
700 Ga0157369_10455588
701 Ga0157378_10001037
702 Ga0157375_10001304
703 Ga0157375_10099281
704 Ga0157375_10876990
705 Ga0163163_10032514
706 Ga0157380_10043695
707 Ga0157377_10018411
708 Ga0157379_10108646
709 Ga0157379_10369286
710 Ga0157376_10005146
711 Ga0157376_10073457
712 Ga0157376_10565151
713 Ga0206354_10518364
714 Ga0206353_10821866
715 Ga0206353_12060367
716 Ga0213874_10006611
717 Ga0209129_1000209
718 Ga0209025_1001222
719 Ga0209051_1020707
720 Ga0207653_10047855
721 Ga0207682_10060777
722 Ga0207642_10000189
723 Ga0207710_10044993
724 Ga0207688_10016669
725 Ga0207688_10128978
726 Ga0207647_10167860
727 Ga0207645_10008807
728 Ga0207643_10036678
729 Ga0207705_10117703
730 Ga0207705_10232792
731 Ga0207654_10011756
732 Ga0207654_10284504
733 Ga0207707_10330841
734 Ga0207695_10031065
735 Ga0207695_10148241
736 Ga0207695_10313422
737 Ga0207671_10050843
738 Ga0207660_10007365
739 Ga0207662_10000129
740 Ga0207662_10003970
741 Ga0207662_10031949
742 Ga0207662_10037247
743 Ga0207657_10017444
744 Ga0207657_10034748
745 Ga0207657_10142045
746 Ga0207657_10268746
747 Ga0207652_10023768
748 Ga0207652_10035287
749 Ga0207652_10050298
750 Ga0207646_10045385
751 Ga0207681_10000767
752 Ga0207681_10069714
753 Ga0207659_10000497
754 Ga0207687_10004697
755 Ga0207700_10477935
756 Ga0207664_10026331
757 Ga0207664_10030964
758 Ga0207664_10248452
759 Ga0207706_10018637
760 Ga0207706_10095263
761 Ga0207709_10006326
762 Ga0207709_10021550
763 Ga0207670_10004745
764 Ga0207670_10008727
765 Ga0207670_10053800
766 Ga0207704_10001920
767 Ga0207704_10154555
768 Ga0207665_10017478
769 Ga0207691_10008336
770 Ga0207691_10065486
771 Ga0207711_10189238
772 Ga0207711_10517536
773 Ga0207689_10001252
774 Ga0207661_10178541
775 Ga0207679_10202796
776 Ga0207667_10046370
777 Ga0207667_10098540
778 Ga0207667_10508205
779 Ga0207651_10027542
780 Ga0207651_10040336
781 Ga0207651_10059945
782 Ga0207651_10154866
783 Ga0207651_10268765
784 Ga0207712_10002359
785 Ga0207712_10300858
786 Ga0207668_10054058
787 Ga0207640_10079293
788 Ga0207640_10341549
789 Ga0207658_10411883
790 Ga0207677_10001416
791 Ga0207677_10141720
792 Ga0207703_10005111
793 Ga0207703_10149316
794 Ga0207703_10164753
795 Ga0207678_10156670
796 Ga0207708_10002615
797 Ga0207708_10006156
798 Ga0207708_10014709
799 Ga0207708_10224458
800 Ga0207702_10015546
801 Ga0207702_10119779
802 Ga0207702_10477455
803 Ga0207641_10291215
804 Ga0207648_10000694
805 Ga0207648_10004111
806 Ga0207648_10091909
807 Ga0207676_10004823
808 Ga0207676_10496345
809 Ga0207674_10015241
810 Ga0207675_100001566
811 Ga0207675_100003494
812 Ga0207683_10068279
813 Ga0207698_10059126
814 Ga0207698_10340968
815 Ga0207428_10001021
816 Ga0207428_10002697
817 Ga0268265_10000250
818 Ga0268264_10003112
819 Ga0268264_10048815
820 Ga0307405_10006513
821 Ga0307413_10423216
822 Ga0307409_100356341
823 Ga0307416_100019136
824 Ga0307416_100063646
825 Ga0307414_10039941
826 Ga0373929_0010336
827 Ga0373940_0000337
828 Ga0373949_0008815
829 Ga0373951_0022989
830 Ga0373951_0041162
831 Ga0373932_0001737
832 Ga0373932_0052775
833 Ga0373939_0001577
834 Ga0373939_0119858
835 Ga0373943_0035130
836 Ga0373946_0005434
837 Ga0373942_0014634
838 Ga0373924_0224914
839 Ga0373931_0000241
840 Ga0373931_0008932
841 Ga0373931_0017095
842 Ga0373927_0028091
843 Ga0373927_0030803
844 Ga0373927_0272747
845 Ga0373947_0006419
846 Ga0373947_0020977
847 Ga0373937_0025238
848 Ga0373925_0011326
849 Ga0373925_0014719
850 Ga0395899_0013855
851 Ga0395899_0090266
852 Ga0395899_0280303
853 Ga0395900_0038519
854 Ga0395900_0061432
855 Ga0395900_0092102
856 Ga0395898_0020470
857 Ga0395898_0049273
858 Ga0395898_0092505
859 Ga0395898_0149099
860 Ga0395898_0846728
861 Ga0395905_0001763
862 Ga0395905_0008282
863 Ga0395905_0164077
864 Ga0436364_1387586
865 Ga0395901_0036400
866 Ga0395901_0069595
867 Ga0395901_0125439
868 Ga0395901_0146838
869 Ga0395901_0179988
870 Ga0395901_0208924
871 Ga0395901_0254520
872 Ga0395901_0746506
873 Ga0436360_0914783
874 Ga0436363_0863487
875 Ga0439433_0028318
876 Ga0466971_0074705
877 Ga0451576_0000943
878 Ga0451576_0013931
879 Ga0451576_0030765
880 Ga0451576_0085241
881 Ga0451576_0684810
882 Ga0466958_0067331
883 Ga0466967_0012019
884 Ga0466967_0086887
885 Ga0466967_0161123
886 Ga0466967_0515654
887 Ga0495603_0022845
888 Ga0495603_0049724
889 Ga0495580_0025522
890 Ga0495582_0034892
891 Ga0495639_0000729
892 Ga0495585_0015337
893 Ga0495594_0007156
894 Ga0495616_0090274
895 Ga0495648_0019512
896 Ga0495666_0002339
897 Ga0495642_0038883
898 Ga0495642_0049708
899 Ga0495586_0074502
900 Ga0495598_0008203
901 Ga0495609_0019622
902 Ga0495659_0006640
903 Ga0495659_0046313
904 Ga0495659_0084731
905 Ga0495588_0019464
906 Ga0495588_0033178
907 Ga0495647_0000346
908 Ga0495658_0000928
909 Ga0495658_0085237
910 Ga0495581_0208706
911 Ga0495674_0055230
912 Ga0495676_0021141
913 Ga0495676_0065396
914 Ga0495626_0045637
915 Ga0496102_0069688
916 Ga0496105_0157086
917 Ga0496106_0000002
918 Ga0496107_0003143
919 Ga0496107_0132210
920 Ga0496109_0611497
921 Ga0496121_0271624
922 Ga0496125_0017578
923 Ga0501038_0332230
924 Ga0501039_0031631
925 Ga0501040_0043266
926 Ga0501041_0058300
927 Ga0501043_0020143
928 Ga0501046_0058189
929 Ga0501067_0009808
930 Ga0501068_0416822
931 Ga0501069_0009197
932 Ga0501070_0042712
933 Ga0501071_0003591
934 Ga0501071_0009285
935 Ga0501072_0225218
936 Ga0501072_0408392
937 Ga0501074_0008292
938 Ga0501075_0014476
939 Ga0501075_0052702
940 Ga0501075_0083070
941 Ga0501076_0009296
942 Ga0501076_0027926
943 Ga0501080_0040093
944 Ga0501081_0063078
945 Ga0501044_0382724
946 nmdc:mga05p37_114_c1
947 nmdc:mga05p37_1418_c1
948 nmdc:mga05p37_157844_c1
949 nmdc:mga05p37_3406_c1
950 nmdc:mga05p37_4640_c1
951 nmdc:mga05p37_582533_c1
952 nmdc:mga05p37_740768_c1
953 nmdc:mga09592_2028_c1
954 nmdc:mga09592_2696_c1
955 nmdc:mga09592_72000_c1
956 nmdc:mga09592_80831_c1
957 nmdc:mga0qj67_11_c1
958 nmdc:mga0qj67_20_c1
959 nmdc:mga0qj67_2801_c1
960 nmdc:mga06r32_17409_c1
961 nmdc:mga06r32_177998_c1
962 nmdc:mga08y16_18281_c1
963 nmdc:mga08y16_186598_c1
964 nmdc:mga08y16_20772_c1
965 nmdc:mga08y16_26799_c1
966 nmdc:mga08y16_644402_c1
967 nmdc:mga08y16_948_c1
968 nmdc:mga0n895_16816_c1
969 nmdc:mga0n895_290847_c1
970 nmdc:mga0n895_300195_c1
971 nmdc:mga0n895_60514_c1
972 nmdc:mga0n895_69295_c1
973 nmdc:mga0n895_84055_c1
974 nmdc:mga0rr50_230628_c1
975 nmdc:mga0rr50_29297_c1
976 nmdc:mga0rr50_334960_c1
977 nmdc:mga0rr50_51812_c1
978 nmdc:mga08x19_117608_c1
979 nmdc:mga08x19_54352_c1
980 nmdc:mga08x19_6294_c1
981 nmdc:mga08x19_7690_c1
982 nmdc:mga0a205_17445_c1
983 nmdc:mga0a205_175606_c1
984 nmdc:mga0a205_17623_c1
985 nmdc:mga0a205_41308_c1
986 Ga0500590_047739
987 Ga0501084_0055313
988 Ga0501084_0092820
989 Ga0501082_0043799
990 Ga0530510_0030841
991 Ga0530510_0342595
992 2585391087
993 2885277847
994 2929214637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

59

201

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dst-assembly1.cif.gz_B crystal structure analysis of tt1977 0.8571 2 116
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.848 2 125
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.841 2 125
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8025 2 125
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.7787 2 125
ID Description Score Start End Superfamily
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8776 2 126 3.40.50.1820
2dstB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8571 2 116 3.40.50.12270
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8557 2 117 3.40.50.12270
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8409 9 125 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8377 9 125 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A7J9VNL0-F1-model_v4 Alpha/beta fold hydrolase 0.9932 1 280 GO:0016787
AF-A0A0R2TUF9-F1-model_v4 Hydrolase 0.9919 1 280 GO:0016787
AF-A0A536TUR0-F1-model_v4 Alpha/beta hydrolase 0.9895 1 94 GO:0016787
AF-A0A7J9VNL0-F1-model_v4 Alpha/beta fold hydrolase 0.9862 1 280 GO:0016787
AF-A0A0R2TUF9-F1-model_v4 Hydrolase 0.9849 1 280 GO:0016787

Map