F455058

General Info

Members Datasets Scaffolds Average Seq Length
497 295 994 202

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10000650|Ga0307517_1000065061
Length 238
Sequence MQMHLVIPPVNAKLSRKTEQETEKGKSPKKEENPMKLYYSPGACSLSPHIALLEAGLPYDLVKVDVRAKKLENGDDFLKVNPKGQVPALELDSGEIVTEGPVIVQMIADKAAAKNLAPSRDSAERYKLLEWLNFITTELHKNFSPLFQPVIPDEVKAFFKDRLMGKFRYADGKLAGQDYLMGKQFNVADGYLFVMLKWAERTGMDLSALTNLMAFKDRVAARPKVQEALTKEGLLKAA

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
76 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
77 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
78 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
119 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
153 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
154 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
246 2547132181 Kosakonia sacchari SP1 Isolate Stem
247 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
248 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
249 2561511199 Enterobacter sp. R4-368 Isolate Nodule
250 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
251 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
252 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
253 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
254 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
255 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
256 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
257 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
258 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
259 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
260 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
261 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
262 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
263 2751185917 Enterobacter sp. HK169 Isolate Unclassified
264 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
265 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
266 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
267 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
268 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
269 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
270 2821118458 Enterobacter asburiae 609 Isolate Unclassified
271 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
272 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
273 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
274 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
275 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
276 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
277 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
278 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
279 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
280 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
281 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
282 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
283 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
284 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
285 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
286 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
287 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
288 8018221730 Enterobacter sp. CM29 Isolate Unclassified
289 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
290 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
291 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
292 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
293 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
294 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
295 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.74
Metatranscriptomes 0
Isolates 10.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.43
Nodule 3.82
Rhizoplane 9.66
Rhizosphere 60.16
Stem 0.2
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10000650 3300028786 Bacteria 59699
2 SwRhRL2b_contig_3499652 2162886007 Bacteria 3916
3 SwRhRL2b_contig_417135 2162886007 Bacteria 1974
4 JGI25152J39213_1000258 3300002773 Bacteria 35248
5 JGI25406J46586_10000063 3300003203 Bacteria 49219
6 rootH2_10040041 3300003320 Bacteria 15643
7 Ga0058692_1000173 3300003856 Bacteria 39993
8 Ga0058692_1023707 3300003856 Bacteria 1243
9 Ga0065704_10000297 3300005289 Bacteria 43486
10 Ga0065704_10017960 3300005289 Bacteria 2180
11 Ga0065704_10075730 3300005289 Bacteria 5435
12 Ga0070676_10244209 3300005328 Bacteria 1195
13 Ga0070677_10061338 3300005333 Bacteria 1552
14 Ga0068869_100174437 3300005334 Bacteria 1681
15 Ga0070682_100179767 3300005337 Bacteria 1477
16 Ga0070682_100652816 3300005337 Bacteria 838
17 Ga0070689_100124092 3300005340 Bacteria 2065
18 Ga0070668_100327288 3300005347 Bacteria 1291
19 Ga0070675_100672914 3300005354 Bacteria 941
20 Ga0070671_100186667 3300005355 Bacteria 1757
21 Ga0070667_100316030 3300005367 Bacteria 1409
22 Ga0070709_10542428 3300005434 Bacteria 889
23 Ga0070714_101077436 3300005435 Bacteria 783
24 Ga0070713_100072059 3300005436 Bacteria 2922
25 Ga0070713_100251402 3300005436 Bacteria 1612
26 Ga0070710_10000445 3300005437 Bacteria 19452
27 Ga0070711_100022381 3300005439 Bacteria 4096
28 Ga0070711_100590635 3300005439 Bacteria 925
29 Ga0070678_100047169 3300005456 Bacteria 3094
30 Ga0070678_100334852 3300005456 Bacteria 1296
31 Ga0070678_101043000 3300005456 Bacteria 753
32 Ga0070685_10237486 3300005466 Bacteria 1202
33 Ga0070684_100479172 3300005535 Bacteria 1152
34 Ga0070672_100716481 3300005543 Bacteria 877
35 Ga0070686_100603832 3300005544 Bacteria 865
36 Ga0070665_100002066 3300005548 Bacteria 22531
37 Ga0070665_100611327 3300005548 Bacteria 1103
38 Ga0068855_100975595 3300005563 Bacteria 891
39 Ga0070664_100616243 3300005564 Bacteria 1007
40 Ga0068857_100531653 3300005577 Bacteria 1106
41 Ga0068854_100038513 3300005578 Bacteria 3363
42 Ga0068856_100000834 3300005614 Bacteria 33225
43 Ga0068852_100450967 3300005616 Bacteria 1273
44 Ga0068859_100287319 3300005617 Bacteria 1737
45 Ga0068866_10428686 3300005718 Bacteria 859
46 Ga0068860_100661383 3300005843 Bacteria 1053
47 Ga0068862_100171193 3300005844 Bacteria 1944
48 Ga0068862_100893390 3300005844 Bacteria 873
49 Ga0081538_10090683 3300005981 Bacteria 1581
50 Ga0081540_1057941 3300005983 Bacteria 1869
51 Ga0081539_10000229 3300005985 Bacteria 131455
52 Ga0070717_10016697 3300006028 Bacteria 5697
53 Ga0075364_10003017 3300006051 Bacteria 9511
54 Ga0075364_10004940 3300006051 Bacteria 7724
55 Ga0070716_100452074 3300006173 Bacteria 937
56 Ga0070712_100163562 3300006175 Bacteria 1720
57 Ga0070712_100529447 3300006175 Bacteria 991
58 Ga0075369_10251287 3300006186 Bacteria 821
59 Ga0075366_10004738 3300006195 Bacteria 7329
60 Ga0075366_10054749 3300006195 Bacteria 2369
61 Ga0075434_101060988 3300006871 Bacteria 824
62 Ga0068865_100376736 3300006881 Bacteria 1156
63 Ga0097620_100287297 3300006931 Bacteria 1737
64 Ga0079104_1000218 3300006946 Bacteria 80243
65 Ga0079104_1000263 3300006946 Bacteria 69767
66 Ga0079104_1000716 3300006946 Bacteria 29970
67 Ga0079104_1004871 3300006946 Bacteria 5560
68 Ga0079104_1007607 3300006946 Bacteria 3893
69 Ga0079104_1009919 3300006946 Bacteria 3182
70 Ga0099794_10035208 3300007265 Bacteria 2362
71 Ga0105251_10005550 3300009011 Bacteria 8209
72 Ga0105251_10018129 3300009011 Bacteria 3752
73 Ga0105251_10022954 3300009011 Bacteria 3229
74 Ga0105251_10082355 3300009011 Bacteria 1486
75 Ga0105251_10173043 3300009011 Bacteria 973
76 Ga0105251_10281622 3300009011 Bacteria 752
77 Ga0105244_10000014 3300009036 Bacteria 257018
78 Ga0105244_10000015 3300009036 Bacteria 256814
79 Ga0105244_10003108 3300009036 Bacteria 12126
80 Ga0105244_10018724 3300009036 Bacteria 3878
81 Ga0105244_10022687 3300009036 Bacteria 3452
82 Ga0105244_10032784 3300009036 Bacteria 2746
83 Ga0105244_10109592 3300009036 Bacteria 1344
84 Ga0105250_10000113 3300009092 Bacteria 72385
85 Ga0105250_10001565 3300009092 Bacteria 12295
86 Ga0105250_10002837 3300009092 Bacteria 8494
87 Ga0105250_10024034 3300009092 Bacteria 2455
88 Ga0105250_10062449 3300009092 Bacteria 1499
89 Ga0105240_11229544 3300009093 Bacteria 792
90 Ga0105245_10436194 3300009098 Bacteria 1316
91 Ga0105245_10469329 3300009098 Bacteria 1270
92 Ga0105247_10055749 3300009101 Bacteria 2439
93 Ga0105247_10214365 3300009101 Bacteria 1300
94 Ga0105241_10209095 3300009174 Bacteria 1634
95 Ga0105242_10403812 3300009176 Bacteria 1276
96 Ga0105242_10588541 3300009176 Bacteria 1073
97 Ga0105237_10354741 3300009545 Bacteria 1471
98 Ga0105238_10264160 3300009551 Bacteria 1701
99 Ga0105249_11865103 3300009553 Bacteria 674
100 Ga0105239_10578749 3300010375 Bacteria 1280
101 Ga0105239_10641643 3300010375 Bacteria 1212
102 Ga0105239_10992950 3300010375 Bacteria 965
103 Ga0105246_10068897 3300011119 Bacteria 2483
104 Ga0157373_10088238 3300013100 Bacteria 2185
105 Ga0157373_10369881 3300013100 Bacteria 1024
106 Ga0157371_10005293 3300013102 Bacteria 10934
107 Ga0157371_10011201 3300013102 Bacteria 6932
108 Ga0157371_10031460 3300013102 Bacteria 3823
109 Ga0157371_10298184 3300013102 Bacteria 1167
110 Ga0157370_10031309 3300013104 Bacteria 5206
111 Ga0157370_10324928 3300013104 Bacteria 1419
112 Ga0157369_10014873 3300013105 Bacteria 8783
113 Ga0157374_10713189 3300013296 Bacteria 1016
114 Ga0157374_11299063 3300013296 Bacteria 749
115 Ga0157378_10066194 3300013297 Bacteria 3236
116 Ga0157378_10810204 3300013297 Bacteria 963
117 Ga0163162_10021244 3300013306 Bacteria 6388
118 Ga0157372_10250117 3300013307 Bacteria 2057
119 Ga0157372_11162326 3300013307 Bacteria 892
120 Ga0157375_10116688 3300013308 Bacteria 2774
121 Ga0157375_11202641 3300013308 Bacteria 889
122 Ga0163163_10078629 3300014325 Bacteria 3295
123 Ga0183366_1001 3300015679 Bacteria 2743932
124 Ga0183370_1001 3300015680 Bacteria 2743932
125 Ga0183369_1001 3300015685 Bacteria 2743932
126 Ga0183368_1001 3300015687 Bacteria 2743932
127 Ga0209129_1000004 3300025258 Bacteria 884499
128 Ga0209129_1001872 3300025258 Bacteria 11102
129 Ga0207666_1006533 3300025271 Bacteria 1516
130 Ga0209455_1010420 3300025272 Bacteria 2365
131 Ga0209758_1000979 3300025297 Bacteria 38423
132 Ga0209758_1035904 3300025297 Bacteria 1944
133 Ga0209256_1003652 3300025299 Bacteria 10524
134 Ga0207696_1000005 3300025711 Bacteria 642078
135 Ga0207696_1000218 3300025711 Bacteria 83242
136 Ga0207696_1005166 3300025711 Bacteria 5470
137 Ga0207696_1006697 3300025711 Bacteria 4604
138 Ga0207655_1000001 3300025728 Bacteria 1866413
139 Ga0207655_1000009 3300025728 Bacteria 664676
140 Ga0207655_1000061 3300025728 Bacteria 258893
141 Ga0207655_1000063 3300025728 Bacteria 257028
142 Ga0207655_1000587 3300025728 Bacteria 44910
143 Ga0207713_1000002 3300025735 Bacteria 1061749
144 Ga0207713_1000003 3300025735 Bacteria 860698
145 Ga0207713_1000029 3300025735 Bacteria 285054
146 Ga0207713_1001124 3300025735 Bacteria 22760
147 Ga0207713_1004844 3300025735 Bacteria 8629
148 Ga0207713_1008737 3300025735 Bacteria 5780
149 Ga0207713_1019774 3300025735 Bacteria 3283
150 Ga0207713_1037152 3300025735 Bacteria 2080
151 Ga0207692_10000771 3300025898 Bacteria 11382
152 Ga0207710_10104993 3300025900 Bacteria 1336
153 Ga0207645_10296088 3300025907 Bacteria 1077
154 Ga0207643_10049455 3300025908 Bacteria 2382
155 Ga0207654_10198642 3300025911 Bacteria 1319
156 Ga0207671_10459935 3300025914 Bacteria 1014
157 Ga0207693_10004909 3300025915 Bacteria 11237
158 Ga0207663_10000271 3300025916 Bacteria 22490
159 Ga0207652_10359478 3300025921 Bacteria 1314
160 Ga0207650_10520768 3300025925 Bacteria 995
161 Ga0207700_10012754 3300025928 Bacteria 5434
162 Ga0207700_10073328 3300025928 Bacteria 2643
163 Ga0207664_10012360 3300025929 Bacteria 6101
164 Ga0207664_10166096 3300025929 Bacteria 1886
165 Ga0207664_10901248 3300025929 Bacteria 794
166 Ga0207644_10178393 3300025931 Bacteria 1663
167 Ga0207686_10621269 3300025934 Bacteria 852
168 Ga0207709_10460775 3300025935 Bacteria 984
169 Ga0207670_10459339 3300025936 Bacteria 1028
170 Ga0207665_10000806 3300025939 Bacteria 21196
171 Ga0207691_10199503 3300025940 Bacteria 1742
172 Ga0207689_10190449 3300025942 Bacteria 1692
173 Ga0207679_10536776 3300025945 Bacteria 1048
174 Ga0207712_10373687 3300025961 Bacteria 1191
175 Ga0207668_10297571 3300025972 Bacteria 1330
176 Ga0207640_10016193 3300025981 Bacteria 4332
177 Ga0207703_10078878 3300026035 Bacteria 2737
178 Ga0207678_10111199 3300026067 Bacteria 2337
179 Ga0207708_10737434 3300026075 Bacteria 845
180 Ga0207702_10000802 3300026078 Bacteria 33336
181 Ga0207674_10003836 3300026116 Bacteria 18318
182 Ga0207675_100569920 3300026118 Bacteria 1133
183 Ga0207683_10080882 3300026121 Bacteria 2883
184 Ga0207698_10110450 3300026142 Bacteria 2303
185 Ga0209281_1000001 3300027111 Bacteria 1933496
186 Ga0209281_1000006 3300027111 Bacteria 1170244
187 Ga0209281_1000287 3300027111 Bacteria 93918
188 Ga0209281_1000414 3300027111 Bacteria 64365
189 Ga0209281_1000494 3300027111 Bacteria 53600
190 Ga0209281_1000638 3300027111 Bacteria 38391
191 Ga0209281_1001677 3300027111 Bacteria 11634
192 Ga0209281_1001997 3300027111 Bacteria 9353
193 Ga0209371_1000001 3300027312 Bacteria 2771503
194 Ga0209371_1000002 3300027312 Bacteria 1551985
195 Ga0209371_1000041 3300027312 Bacteria 340377
196 Ga0209371_1000109 3300027312 Bacteria 141217
197 Ga0209371_1001290 3300027312 Bacteria 17602
198 Ga0209371_1004220 3300027312 Bacteria 6393
199 Ga0209371_1020119 3300027312 Bacteria 1650
200 Ga0209371_1026683 3300027312 Bacteria 1311
201 Ga0209371_1027418 3300027312 Bacteria 1283
202 Ga0268266_10000693 3300028379 Bacteria 45369
203 Ga0268266_10432391 3300028379 Bacteria 1249
204 Ga0268265_10276049 3300028380 Bacteria 1501
205 Ga0268264_10092679 3300028381 Bacteria 2608
206 Ga0268264_10984556 3300028381 Bacteria 849
207 Ga0268256_1000001 3300030500 Bacteria 2771065
208 Ga0268256_1000002 3300030500 Bacteria 1535763
209 Ga0268256_1000003 3300030500 Bacteria 1289401
210 Ga0268256_1001101 3300030500 Bacteria 17602
211 Ga0268256_1019354 3300030500 Bacteria 1866
212 Ga0268256_1024769 3300030500 Bacteria 1534
213 Ga0268256_1031161 3300030500 Bacteria 1283
214 Ga0268256_1056072 3300030500 Bacteria 809
215 Ga0265332_10101745 3300031238 Bacteria 1212
216 Ga0265339_10113664 3300031249 Bacteria 1398
217 Ga0307513_10488474 3300031456 Bacteria 950
218 Ga0307508_10425855 3300031616 Bacteria 919
219 Ga0265342_10003627 3300031712 Bacteria 12570
220 Ga0307416_101006985 3300032002 Bacteria 936
221 Ga0307416_101488036 3300032002 Bacteria 783
222 Ga0307415_100322803 3300032126 Bacteria 1288
223 Ga0307510_10100445 3300033180 Bacteria 2687
224 Ga0373929_0021466 3300035085 Bacteria 1310
225 Ga0373944_0174733 3300035089 Bacteria 768
226 Ga0373949_0023972 3300035090 Bacteria 1417
227 Ga0373952_0027661 3300035092 Bacteria 1239
228 Ga0373932_0158301 3300035112 Bacteria 782
229 Ga0373939_0102281 3300035114 Bacteria 985
230 Ga0373954_0275839 3300035118 Bacteria 829
231 Ga0373954_0373962 3300035118 Bacteria 704
232 Ga0373956_0116468 3300035119 Bacteria 1246
233 Ga0373955_0336202 3300035172 Bacteria 913
234 Ga0373962_0055069 3300035242 Bacteria 1155
235 Ga0373924_0014733 3300035410 Bacteria 2958
236 Ga0373931_0020357 3300035691 Bacteria 3319
237 Ga0373927_0164113 3300035695 Bacteria 1456
238 Ga0373937_0138191 3300036401 Bacteria 2279
239 Ga0373937_0216953 3300036401 Bacteria 1801
240 Ga0436364_0131993 3300037853 Bacteria 1928
241 Ga0436364_0347935 3300037853 Bacteria 1793
242 Ga0436365_0852872 3300039437 Bacteria 1947
243 Ga0436365_0971002 3300039437 Bacteria 167792
244 Ga0436365_1825975 3300039437 Bacteria 862
245 Ga0436363_0447320 3300039450 Bacteria 872
246 Ga0436363_1006654 3300039450 Bacteria 851
247 Ga0439438_014932 3300041405 Bacteria 2299
248 Ga0451802_1008840 3300041460 Bacteria 720
249 Ga0451853_0203668 3300041512 Bacteria 2497
250 Ga0439452_000028 3300042010 Bacteria 204513
251 Ga0439452_000246 3300042010 Bacteria 37436
252 Ga0439452_000493 3300042010 Bacteria 21705
253 Ga0439452_013766 3300042010 Bacteria 2263
254 Ga0466981_0000002 3300044669 Bacteria 313036
255 Ga0466982_0377016 3300044672 Bacteria 777
256 Ga0466966_0429452 3300044684 Bacteria 794
257 Ga0466963_0356724 3300044694 Bacteria 1030
258 Ga0495591_000100 3300046458 Bacteria 99473
259 Ga0495591_047577 3300046458 Bacteria 1186
260 Ga0495638_0138241 3300046460 Bacteria 1424
261 Ga0495638_0173427 3300046460 Bacteria 1236
262 Ga0495651_0008485 3300046462 Bacteria 7874
263 Ga0495651_0100300 3300046462 Bacteria 2157
264 Ga0495650_0000005 3300046471 Bacteria 766553
265 Ga0495639_0175015 3300046475 Bacteria 1043
266 Ga0495664_0264878 3300046477 Bacteria 1039
267 Ga0495607_0179735 3300046501 Bacteria 1061
268 Ga0495606_0000244 3300046507 Bacteria 95942
269 Ga0495620_0017021 3300046515 Bacteria 3633
270 Ga0495628_0002476 3300046516 Bacteria 16640
271 Ga0495643_0095644 3300046522 Bacteria 1528
272 Ga0495648_0021306 3300046524 Bacteria 4492
273 Ga0495640_0522380 3300046533 Bacteria 721
274 Ga0495667_0012698 3300046559 Bacteria 5710
275 Ga0495634_0567515 3300046642 Bacteria 661
276 Ga0495623_0087701 3300046679 Bacteria 1916
277 Ga0495658_0273048 3300046683 Bacteria 1066
278 Ga0495671_0030751 3300046692 Bacteria 2748
279 Ga0495649_0054137 3300046694 Bacteria 2170
280 Ga0495649_0089793 3300046694 Bacteria 1638
281 Ga0495676_0248294 3300047321 Bacteria 1215
282 Ga0495680_0136793 3300047322 Bacteria 1796
283 Ga0495679_024927 3300047446 Bacteria 2007
284 Ga0495679_076993 3300047446 Bacteria 952
285 Ga0495673_0000070 3300047469 Bacteria 217453
286 Ga0495686_0043141 3300047472 Bacteria 2862
287 Ga0495602_0114574 3300048088 Bacteria 2182
288 Ga0496100_0536512 3300048903 Bacteria 904
289 Ga0496101_0038519 3300048904 Bacteria 3396
290 Ga0496102_0021503 3300048905 Bacteria 5706
291 Ga0496102_0195823 3300048905 Bacteria 1904
292 Ga0496103_0270518 3300048906 Bacteria 1093
293 Ga0496104_0005483 3300048907 Bacteria 11112
294 Ga0496104_0017825 3300048907 Bacteria 6474
295 Ga0496104_0030367 3300048907 Bacteria 5021
296 Ga0496104_0096003 3300048907 Bacteria 2836
297 Ga0496104_0197707 3300048907 Bacteria 1922
298 Ga0496104_0684094 3300048907 Bacteria 934
299 Ga0496105_0008102 3300048908 Bacteria 8170
300 Ga0496105_0025364 3300048908 Bacteria 4826
301 Ga0496105_0188535 3300048908 Bacteria 1687
302 Ga0496105_0191010 3300048908 Bacteria 1674
303 Ga0496106_0117653 3300048909 Bacteria 2074
304 Ga0496107_0036088 3300048910 Bacteria 3545
305 Ga0496107_0486563 3300048910 Bacteria 915
306 Ga0496108_0528652 3300048911 Bacteria 1030
307 Ga0496109_0095203 3300048912 Bacteria 2757
308 Ga0496109_0158782 3300048912 Bacteria 2118
309 Ga0496110_0006182 3300048913 Bacteria 9450
310 Ga0496110_0687520 3300048913 Bacteria 924
311 Ga0496111_0432905 3300048914 Bacteria 971
312 Ga0496112_0000174 3300048915 Bacteria 41054
313 Ga0496112_0013924 3300048915 Bacteria 7441
314 Ga0496112_0020953 3300048915 Bacteria 6207
315 Ga0496112_0139641 3300048915 Bacteria 2392
316 Ga0496113_0024011 3300048916 Bacteria 4328
317 Ga0496113_0047664 3300048916 Bacteria 3185
318 Ga0496114_0047860 3300048917 Bacteria 3556
319 Ga0496114_0090482 3300048917 Bacteria 2598
320 Ga0496115_0140523 3300048918 Bacteria 1992
321 Ga0496115_0559020 3300048918 Bacteria 914
322 Ga0496116_0000822 3300048919 Bacteria 39198
323 Ga0496116_0051152 3300048919 Bacteria 2746
324 Ga0496116_0059894 3300048919 Bacteria 2473
325 Ga0496116_0190885 3300048919 Bacteria 1084
326 Ga0496117_0000020 3300048920 Bacteria 458405
327 Ga0496117_0011282 3300048920 Bacteria 8013
328 Ga0496117_0017480 3300048920 Bacteria 5987
329 Ga0496117_0058550 3300048920 Bacteria 2667
330 Ga0496117_0112259 3300048920 Bacteria 1695
331 Ga0496117_0122043 3300048920 Bacteria 1598
332 Ga0496118_0000015 3300048921 Bacteria 551359
333 Ga0496118_0065383 3300048921 Bacteria 2661
334 Ga0496118_0067494 3300048921 Bacteria 2603
335 Ga0496118_0084000 3300048921 Bacteria 2223
336 Ga0496118_0086109 3300048921 Bacteria 2184
337 Ga0496118_0112683 3300048921 Bacteria 1799
338 Ga0496118_0296335 3300048921 Bacteria 891
339 Ga0496119_0000001 3300048922 Bacteria 789520
340 Ga0496119_0000570 3300048922 Bacteria 49795
341 Ga0496119_0004132 3300048922 Bacteria 14619
342 Ga0496119_0037558 3300048922 Bacteria 3144
343 Ga0496119_0048323 3300048922 Bacteria 2639
344 Ga0496119_0063171 3300048922 Bacteria 2203
345 Ga0496120_0001357 3300048923 Bacteria 30064
346 Ga0496120_0013952 3300048923 Bacteria 5377
347 Ga0496120_0014667 3300048923 Bacteria 5211
348 Ga0496120_0056320 3300048923 Bacteria 2219
349 Ga0496120_0059059 3300048923 Bacteria 2150
350 Ga0496120_0090621 3300048923 Bacteria 1634
351 Ga0496120_0097004 3300048923 Bacteria 1564
352 Ga0496121_0002791 3300048924 Bacteria 25878
353 Ga0496121_0004182 3300048924 Bacteria 19708
354 Ga0496121_0005490 3300048924 Bacteria 16237
355 Ga0496121_0011142 3300048924 Bacteria 10027
356 Ga0496121_0021549 3300048924 Bacteria 6306
357 Ga0496121_0026582 3300048924 Bacteria 5446
358 Ga0496121_0077596 3300048924 Bacteria 2644
359 Ga0496121_0254529 3300048924 Bacteria 1216
360 Ga0496122_0000005 3300048925 Bacteria 630659
361 Ga0496122_0000545 3300048925 Bacteria 77927
362 Ga0496122_0005034 3300048925 Bacteria 15989
363 Ga0496122_0020988 3300048925 Bacteria 5868
364 Ga0496122_0036641 3300048925 Bacteria 3961
365 Ga0496122_0066110 3300048925 Bacteria 2615
366 Ga0496122_0077012 3300048925 Bacteria 2344
367 Ga0496122_0158816 3300048925 Bacteria 1382
368 Ga0496122_0181173 3300048925 Bacteria 1256
369 Ga0496123_0000008 3300048926 Bacteria 630628
370 Ga0496123_0000189 3300048926 Bacteria 124719
371 Ga0496123_0001541 3300048926 Bacteria 31819
372 Ga0496123_0004639 3300048926 Bacteria 14281
373 Ga0496123_0004842 3300048926 Bacteria 13867
374 Ga0496123_0048962 3300048926 Bacteria 2838
375 Ga0496123_0051244 3300048926 Bacteria 2749
376 Ga0496123_0059083 3300048926 Bacteria 2482
377 Ga0496123_0088323 3300048926 Bacteria 1851
378 Ga0496123_0117770 3300048926 Bacteria 1501
379 Ga0496124_0005677 3300048927 Bacteria 13914
380 Ga0496124_0050562 3300048927 Bacteria 3541
381 Ga0496124_0055080 3300048927 Bacteria 3363
382 Ga0496124_0062902 3300048927 Bacteria 3103
383 Ga0496124_0092507 3300048927 Bacteria 2463
384 Ga0496124_0150393 3300048927 Bacteria 1827
385 Ga0496124_0582045 3300048927 Bacteria 732
386 Ga0496125_0000009 3300048928 Bacteria 677678
387 Ga0496125_0002253 3300048928 Bacteria 25624
388 Ga0496125_0015717 3300048928 Bacteria 7299
389 Ga0496125_0018863 3300048928 Bacteria 6530
390 Ga0496125_0057728 3300048928 Bacteria 3140
391 Ga0496125_0062948 3300048928 Bacteria 2962
392 Ga0496125_0344563 3300048928 Bacteria 892
393 Ga0496126_0001084 3300048929 Bacteria 45796
394 Ga0496126_0003320 3300048929 Bacteria 20471
395 Ga0496126_0019591 3300048929 Bacteria 6661
396 Ga0496126_0027413 3300048929 Bacteria 5440
397 Ga0496126_0063383 3300048929 Bacteria 3313
398 Ga0496126_0113333 3300048929 Bacteria 2360
399 Ga0496126_0282496 3300048929 Bacteria 1374
400 Ga0496126_0309267 3300048929 Bacteria 1301
401 Ga0501031_0002273 3300049568 Bacteria 12170
402 Ga0501031_0385479 3300049568 Bacteria 907
403 Ga0501032_0000110 3300049569 Bacteria 70189
404 Ga0501033_0000728 3300049570 Bacteria 30172
405 Ga0501033_0189932 3300049570 Bacteria 1470
406 Ga0501034_0000181 3300049571 Bacteria 117767
407 Ga0501034_0860153 3300049571 Bacteria 796
408 Ga0501036_0002326 3300049572 Bacteria 14864
409 Ga0501036_0209522 3300049572 Bacteria 1638
410 Ga0501038_0001231 3300049574 Bacteria 23218
411 Ga0501038_0554433 3300049574 Bacteria 874
412 Ga0501039_0000114 3300049575 Bacteria 54651
413 Ga0501039_0323997 3300049575 Bacteria 1211
414 Ga0501042_0001978 3300049578 Bacteria 12351
415 Ga0501043_0000188 3300049579 Bacteria 56057
416 Ga0501046_0000153 3300049580 Bacteria 71187
417 Ga0501047_0000230 3300049581 Bacteria 66338
418 Ga0501047_0013652 3300049581 Bacteria 7710
419 Ga0501048_0000095 3300049582 Bacteria 47963
420 Ga0501067_0000405 3300049583 Bacteria 23546
421 Ga0501068_0006301 3300049584 Bacteria 6536
422 Ga0501069_0001561 3300049585 Bacteria 11323
423 Ga0501070_0041247 3300049586 Bacteria 3845
424 Ga0501070_0147287 3300049586 Bacteria 1943
425 Ga0501071_0009488 3300049587 Bacteria 6483
426 Ga0501072_0003713 3300049588 Bacteria 11511
427 Ga0501073_0000055 3300049589 Bacteria 71726
428 Ga0501074_0011825 3300049590 Bacteria 6345
429 Ga0501079_0027937 3300049741 Bacteria 4327
430 Ga0501080_0004187 3300049742 Bacteria 12790
431 Ga0501083_0000382 3300049744 Bacteria 28074
432 Ga0501035_0000355 3300049822 Bacteria 52714
433 Ga0501044_0000716 3300049823 Bacteria 40010
434 Ga0501044_0162580 3300049823 Bacteria 2208
435 nmdc:mga00v17_8725_c1 3300050491 Bacteria 5459
436 nmdc:mga0k408_11296_c1 3300050493 Bacteria 4858
437 nmdc:mga0sz30_228794_c1 3300050516 Bacteria 827
438 Ga0495595_0024830 3300053084 Bacteria 2649
439 Ga0500651_0035959 3300053093 Bacteria 3121
440 Ga0500572_000440 3300053111 Bacteria 14582
441 Ga0500595_002874 3300053119 Bacteria 8258
442 Ga0500595_005286 3300053119 Bacteria 5658
443 Ga0500559_0178621 3300053136 Bacteria 1000
444 Ga0500588_0047585 3300053146 Bacteria 1323
445 Ga0500622_0180037 3300053156 Bacteria 977
446 Ga0501084_0001342 3300054114 Bacteria 19438
447 2513694409 2513237101 Bacteria 7952346
448 2547695212 2547132181 Bacteria 4945084
449 2548650350 2547132416 Bacteria 4633861
450 2555257556 2554235234 Bacteria 5762085
451 2562462927 2561511199 Bacteria 5155034
452 2601532415 2600255256 Bacteria 5597742
453 2601537785 2600255257 Bacteria 5597196
454 2601756559 2600255310 Bacteria 5600903
455 2601762960 2600255311 Bacteria 5598766
456 2603638143 2602042046 Bacteria 5483348
457 2603642638 2602042047 Bacteria 4697674
458 2603698321 2602042066 Bacteria 4423871
459 2603703229 2602042067 Bacteria 4863713
460 2603866571 2602042109 Bacteria 5152801
461 2671103161 2667528172 Bacteria 5170840
462 2681997687 2681812866 Bacteria 4552357
463 2682006786 2681812869 Bacteria 5014465
464 2712469779 2711768156 Bacteria 4471618
465 2753855765 2751185917 Bacteria 4551186
466 2765588762 2765235842 Bacteria 4799256
467 2775538766 2775506706 Bacteria 4873073
468 2791922435 2791354903 Bacteria 4937680
469 2792314779 2791355010 Bacteria 4864581
470 2813729120 2811995292 Bacteria 5303342
471 2814696686 2814123068 Bacteria 5687681
472 2821119572 2821118458 Bacteria 4714306
473 2823374552 2823373977 Bacteria 4779415
474 2844427318 2844425489 Bacteria 4854065
475 2884088978 2884086401 Bacteria 5005459
476 2919108752 2919108558 Bacteria 5897419
477 2922364660 2922361189 Bacteria 7436256
478 2923634639 2923634449 Bacteria 4753480
479 2927834311 2927833300 Bacteria 4923934
480 2935626860 2935625433 Bacteria 5042964
481 2939568978 2939568625 Bacteria 4542555
482 2939573734 2939573065 Bacteria 4926053
483 2939607646 2939607340 Bacteria 4719256
484 2939619397 2939617950 Bacteria 4820956
485 2939643974 2939642701 Bacteria 4475280
486 2971823323 2971820967 Bacteria 5823634
487 2974312316 2974310843 Bacteria 4947816
488 2974438275 2974435778 Bacteria 4876478
489 8006995243 8006994254 Bacteria 8309700
490 8018222897 8018221730 Bacteria 4616064
491 8018408345 8018405270 Bacteria 4978981
492 8019506281 8019504834 Bacteria 4819156
493 8055090969 8055087960 Bacteria 4784273
494 8055094539 8055092621 Bacteria 4873875
495 8055099948 8055097453 Bacteria 4865496
496 8056679265 8056673599 Bacteria 7871253
497 8057309396 8057304971 Bacteria 4649742
498 Ga0307517_10000650
499 SwRhRL2b_contig_3499652
500 SwRhRL2b_contig_417135
501 JGI25152J39213_1000258
502 JGI25406J46586_10000063
503 rootH2_10040041
504 Ga0058692_1000173
505 Ga0058692_1023707
506 Ga0065704_10000297
507 Ga0065704_10017960
508 Ga0065704_10075730
509 Ga0070676_10244209
510 Ga0070677_10061338
511 Ga0068869_100174437
512 Ga0070682_100179767
513 Ga0070682_100652816
514 Ga0070689_100124092
515 Ga0070668_100327288
516 Ga0070675_100672914
517 Ga0070671_100186667
518 Ga0070667_100316030
519 Ga0070709_10542428
520 Ga0070714_101077436
521 Ga0070713_100072059
522 Ga0070713_100251402
523 Ga0070710_10000445
524 Ga0070711_100022381
525 Ga0070711_100590635
526 Ga0070678_100047169
527 Ga0070678_100334852
528 Ga0070678_101043000
529 Ga0070685_10237486
530 Ga0070684_100479172
531 Ga0070672_100716481
532 Ga0070686_100603832
533 Ga0070665_100002066
534 Ga0070665_100611327
535 Ga0068855_100975595
536 Ga0070664_100616243
537 Ga0068857_100531653
538 Ga0068854_100038513
539 Ga0068856_100000834
540 Ga0068852_100450967
541 Ga0068859_100287319
542 Ga0068866_10428686
543 Ga0068860_100661383
544 Ga0068862_100171193
545 Ga0068862_100893390
546 Ga0081538_10090683
547 Ga0081540_1057941
548 Ga0081539_10000229
549 Ga0070717_10016697
550 Ga0075364_10003017
551 Ga0075364_10004940
552 Ga0070716_100452074
553 Ga0070712_100163562
554 Ga0070712_100529447
555 Ga0075369_10251287
556 Ga0075366_10004738
557 Ga0075366_10054749
558 Ga0075434_101060988
559 Ga0068865_100376736
560 Ga0097620_100287297
561 Ga0079104_1000218
562 Ga0079104_1000263
563 Ga0079104_1000716
564 Ga0079104_1004871
565 Ga0079104_1007607
566 Ga0079104_1009919
567 Ga0099794_10035208
568 Ga0105251_10005550
569 Ga0105251_10018129
570 Ga0105251_10022954
571 Ga0105251_10082355
572 Ga0105251_10173043
573 Ga0105251_10281622
574 Ga0105244_10000014
575 Ga0105244_10000015
576 Ga0105244_10003108
577 Ga0105244_10018724
578 Ga0105244_10022687
579 Ga0105244_10032784
580 Ga0105244_10109592
581 Ga0105250_10000113
582 Ga0105250_10001565
583 Ga0105250_10002837
584 Ga0105250_10024034
585 Ga0105250_10062449
586 Ga0105240_11229544
587 Ga0105245_10436194
588 Ga0105245_10469329
589 Ga0105247_10055749
590 Ga0105247_10214365
591 Ga0105241_10209095
592 Ga0105242_10403812
593 Ga0105242_10588541
594 Ga0105237_10354741
595 Ga0105238_10264160
596 Ga0105249_11865103
597 Ga0105239_10578749
598 Ga0105239_10641643
599 Ga0105239_10992950
600 Ga0105246_10068897
601 Ga0157373_10088238
602 Ga0157373_10369881
603 Ga0157371_10005293
604 Ga0157371_10011201
605 Ga0157371_10031460
606 Ga0157371_10298184
607 Ga0157370_10031309
608 Ga0157370_10324928
609 Ga0157369_10014873
610 Ga0157374_10713189
611 Ga0157374_11299063
612 Ga0157378_10066194
613 Ga0157378_10810204
614 Ga0163162_10021244
615 Ga0157372_10250117
616 Ga0157372_11162326
617 Ga0157375_10116688
618 Ga0157375_11202641
619 Ga0163163_10078629
620 Ga0183366_1001
621 Ga0183370_1001
622 Ga0183369_1001
623 Ga0183368_1001
624 Ga0209129_1000004
625 Ga0209129_1001872
626 Ga0207666_1006533
627 Ga0209455_1010420
628 Ga0209758_1000979
629 Ga0209758_1035904
630 Ga0209256_1003652
631 Ga0207696_1000005
632 Ga0207696_1000218
633 Ga0207696_1005166
634 Ga0207696_1006697
635 Ga0207655_1000001
636 Ga0207655_1000009
637 Ga0207655_1000061
638 Ga0207655_1000063
639 Ga0207655_1000587
640 Ga0207713_1000002
641 Ga0207713_1000003
642 Ga0207713_1000029
643 Ga0207713_1001124
644 Ga0207713_1004844
645 Ga0207713_1008737
646 Ga0207713_1019774
647 Ga0207713_1037152
648 Ga0207692_10000771
649 Ga0207710_10104993
650 Ga0207645_10296088
651 Ga0207643_10049455
652 Ga0207654_10198642
653 Ga0207671_10459935
654 Ga0207693_10004909
655 Ga0207663_10000271
656 Ga0207652_10359478
657 Ga0207650_10520768
658 Ga0207700_10012754
659 Ga0207700_10073328
660 Ga0207664_10012360
661 Ga0207664_10166096
662 Ga0207664_10901248
663 Ga0207644_10178393
664 Ga0207686_10621269
665 Ga0207709_10460775
666 Ga0207670_10459339
667 Ga0207665_10000806
668 Ga0207691_10199503
669 Ga0207689_10190449
670 Ga0207679_10536776
671 Ga0207712_10373687
672 Ga0207668_10297571
673 Ga0207640_10016193
674 Ga0207703_10078878
675 Ga0207678_10111199
676 Ga0207708_10737434
677 Ga0207702_10000802
678 Ga0207674_10003836
679 Ga0207675_100569920
680 Ga0207683_10080882
681 Ga0207698_10110450
682 Ga0209281_1000001
683 Ga0209281_1000006
684 Ga0209281_1000287
685 Ga0209281_1000414
686 Ga0209281_1000494
687 Ga0209281_1000638
688 Ga0209281_1001677
689 Ga0209281_1001997
690 Ga0209371_1000001
691 Ga0209371_1000002
692 Ga0209371_1000041
693 Ga0209371_1000109
694 Ga0209371_1001290
695 Ga0209371_1004220
696 Ga0209371_1020119
697 Ga0209371_1026683
698 Ga0209371_1027418
699 Ga0268266_10000693
700 Ga0268266_10432391
701 Ga0268265_10276049
702 Ga0268264_10092679
703 Ga0268264_10984556
704 Ga0268256_1000001
705 Ga0268256_1000002
706 Ga0268256_1000003
707 Ga0268256_1001101
708 Ga0268256_1019354
709 Ga0268256_1024769
710 Ga0268256_1031161
711 Ga0268256_1056072
712 Ga0265332_10101745
713 Ga0265339_10113664
714 Ga0307513_10488474
715 Ga0307508_10425855
716 Ga0265342_10003627
717 Ga0307416_101006985
718 Ga0307416_101488036
719 Ga0307415_100322803
720 Ga0307510_10100445
721 Ga0373929_0021466
722 Ga0373944_0174733
723 Ga0373949_0023972
724 Ga0373952_0027661
725 Ga0373932_0158301
726 Ga0373939_0102281
727 Ga0373954_0275839
728 Ga0373954_0373962
729 Ga0373956_0116468
730 Ga0373955_0336202
731 Ga0373962_0055069
732 Ga0373924_0014733
733 Ga0373931_0020357
734 Ga0373927_0164113
735 Ga0373937_0138191
736 Ga0373937_0216953
737 Ga0436364_0131993
738 Ga0436364_0347935
739 Ga0436365_0852872
740 Ga0436365_0971002
741 Ga0436365_1825975
742 Ga0436363_0447320
743 Ga0436363_1006654
744 Ga0439438_014932
745 Ga0451802_1008840
746 Ga0451853_0203668
747 Ga0439452_000028
748 Ga0439452_000246
749 Ga0439452_000493
750 Ga0439452_013766
751 Ga0466981_0000002
752 Ga0466982_0377016
753 Ga0466966_0429452
754 Ga0466963_0356724
755 Ga0495591_000100
756 Ga0495591_047577
757 Ga0495638_0138241
758 Ga0495638_0173427
759 Ga0495651_0008485
760 Ga0495651_0100300
761 Ga0495650_0000005
762 Ga0495639_0175015
763 Ga0495664_0264878
764 Ga0495607_0179735
765 Ga0495606_0000244
766 Ga0495620_0017021
767 Ga0495628_0002476
768 Ga0495643_0095644
769 Ga0495648_0021306
770 Ga0495640_0522380
771 Ga0495667_0012698
772 Ga0495634_0567515
773 Ga0495623_0087701
774 Ga0495658_0273048
775 Ga0495671_0030751
776 Ga0495649_0054137
777 Ga0495649_0089793
778 Ga0495676_0248294
779 Ga0495680_0136793
780 Ga0495679_024927
781 Ga0495679_076993
782 Ga0495673_0000070
783 Ga0495686_0043141
784 Ga0495602_0114574
785 Ga0496100_0536512
786 Ga0496101_0038519
787 Ga0496102_0021503
788 Ga0496102_0195823
789 Ga0496103_0270518
790 Ga0496104_0005483
791 Ga0496104_0017825
792 Ga0496104_0030367
793 Ga0496104_0096003
794 Ga0496104_0197707
795 Ga0496104_0684094
796 Ga0496105_0008102
797 Ga0496105_0025364
798 Ga0496105_0188535
799 Ga0496105_0191010
800 Ga0496106_0117653
801 Ga0496107_0036088
802 Ga0496107_0486563
803 Ga0496108_0528652
804 Ga0496109_0095203
805 Ga0496109_0158782
806 Ga0496110_0006182
807 Ga0496110_0687520
808 Ga0496111_0432905
809 Ga0496112_0000174
810 Ga0496112_0013924
811 Ga0496112_0020953
812 Ga0496112_0139641
813 Ga0496113_0024011
814 Ga0496113_0047664
815 Ga0496114_0047860
816 Ga0496114_0090482
817 Ga0496115_0140523
818 Ga0496115_0559020
819 Ga0496116_0000822
820 Ga0496116_0051152
821 Ga0496116_0059894
822 Ga0496116_0190885
823 Ga0496117_0000020
824 Ga0496117_0011282
825 Ga0496117_0017480
826 Ga0496117_0058550
827 Ga0496117_0112259
828 Ga0496117_0122043
829 Ga0496118_0000015
830 Ga0496118_0065383
831 Ga0496118_0067494
832 Ga0496118_0084000
833 Ga0496118_0086109
834 Ga0496118_0112683
835 Ga0496118_0296335
836 Ga0496119_0000001
837 Ga0496119_0000570
838 Ga0496119_0004132
839 Ga0496119_0037558
840 Ga0496119_0048323
841 Ga0496119_0063171
842 Ga0496120_0001357
843 Ga0496120_0013952
844 Ga0496120_0014667
845 Ga0496120_0056320
846 Ga0496120_0059059
847 Ga0496120_0090621
848 Ga0496120_0097004
849 Ga0496121_0002791
850 Ga0496121_0004182
851 Ga0496121_0005490
852 Ga0496121_0011142
853 Ga0496121_0021549
854 Ga0496121_0026582
855 Ga0496121_0077596
856 Ga0496121_0254529
857 Ga0496122_0000005
858 Ga0496122_0000545
859 Ga0496122_0005034
860 Ga0496122_0020988
861 Ga0496122_0036641
862 Ga0496122_0066110
863 Ga0496122_0077012
864 Ga0496122_0158816
865 Ga0496122_0181173
866 Ga0496123_0000008
867 Ga0496123_0000189
868 Ga0496123_0001541
869 Ga0496123_0004639
870 Ga0496123_0004842
871 Ga0496123_0048962
872 Ga0496123_0051244
873 Ga0496123_0059083
874 Ga0496123_0088323
875 Ga0496123_0117770
876 Ga0496124_0005677
877 Ga0496124_0050562
878 Ga0496124_0055080
879 Ga0496124_0062902
880 Ga0496124_0092507
881 Ga0496124_0150393
882 Ga0496124_0582045
883 Ga0496125_0000009
884 Ga0496125_0002253
885 Ga0496125_0015717
886 Ga0496125_0018863
887 Ga0496125_0057728
888 Ga0496125_0062948
889 Ga0496125_0344563
890 Ga0496126_0001084
891 Ga0496126_0003320
892 Ga0496126_0019591
893 Ga0496126_0027413
894 Ga0496126_0063383
895 Ga0496126_0113333
896 Ga0496126_0282496
897 Ga0496126_0309267
898 Ga0501031_0002273
899 Ga0501031_0385479
900 Ga0501032_0000110
901 Ga0501033_0000728
902 Ga0501033_0189932
903 Ga0501034_0000181
904 Ga0501034_0860153
905 Ga0501036_0002326
906 Ga0501036_0209522
907 Ga0501038_0001231
908 Ga0501038_0554433
909 Ga0501039_0000114
910 Ga0501039_0323997
911 Ga0501042_0001978
912 Ga0501043_0000188
913 Ga0501046_0000153
914 Ga0501047_0000230
915 Ga0501047_0013652
916 Ga0501048_0000095
917 Ga0501067_0000405
918 Ga0501068_0006301
919 Ga0501069_0001561
920 Ga0501070_0041247
921 Ga0501070_0147287
922 Ga0501071_0009488
923 Ga0501072_0003713
924 Ga0501073_0000055
925 Ga0501074_0011825
926 Ga0501079_0027937
927 Ga0501080_0004187
928 Ga0501083_0000382
929 Ga0501035_0000355
930 Ga0501044_0000716
931 Ga0501044_0162580
932 nmdc:mga00v17_8725_c1
933 nmdc:mga0k408_11296_c1
934 nmdc:mga0sz30_228794_c1
935 Ga0495595_0024830
936 Ga0500651_0035959
937 Ga0500572_000440
938 Ga0500595_002874
939 Ga0500595_005286
940 Ga0500559_0178621
941 Ga0500588_0047585
942 Ga0500622_0180037
943 Ga0501084_0001342
944 2513694409
945 2547695212
946 2548650350
947 2555257556
948 2562462927
949 2601532415
950 2601537785
951 2601756559
952 2601762960
953 2603638143
954 2603642638
955 2603698321
956 2603703229
957 2603866571
958 2671103161
959 2681997687
960 2682006786
961 2712469779
962 2753855765
963 2765588762
964 2775538766
965 2791922435
966 2792314779
967 2813729120
968 2814696686
969 2821119572
970 2823374552
971 2844427318
972 2884088978
973 2919108752
974 2922364660
975 2923634639
976 2927834311
977 2935626860
978 2939568978
979 2939573734
980 2939607646
981 2939619397
982 2939643974
983 2971823323
984 2974312316
985 2974438275
986 8006995243
987 8018222897
988 8018408345
989 8019506281
990 8055090969
991 8055094539
992 8055099948
993 8056679265
994 8057309396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

33

109

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

42

110

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

37

115

0.87

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

134

223

0.86

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

138

232

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kgi-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from shigella flexneri, target efi-507258, bound gsh, tev-his-tag linker in active site 0.9923 1 200
1n2a-assembly1.cif.gz_A crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site 0.9894 1 201
1n2a-assembly1.cif.gz_B crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site 0.9894 1 201
4kgi-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from shigella flexneri, target efi-507258, bound gsh, tev-his-tag linker in active site 0.9874 1 200
1n2a-assembly1.cif.gz_B crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site 0.9842 1 201
ID Description Score Start End Superfamily
af_P0A9D2_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9996 1 79 3.40.30.10
af_P0A9D2_2_199_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9969 3 199 3.50.50.60
1a0fB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9914 83 188 1.20.1050.10
1n2aB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9912 83 188 1.20.1050.10
1n2aA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9889 83 188 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2J4QS22-F1-model_v4 Glutathione transferase GstA 1.009 1 69 GO:0016740
AF-A0A0E1VN16-F1-model_v4 deleted 1.007 2 69
AF-W1XSY3-F1-model_v4 Glutathione S-transferase GstA 1.001 1 93 GO:0016740
AF-A0A7U5VBW2-F1-model_v4 deleted 0.9984 1 201
AF-A0A809QXL6-F1-model_v4 deleted 0.9984 1 201

Map