F455060

General Info

Members Datasets Scaffolds Average Seq Length
497 242 497 179

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10340728|Ga0307508_103407281
Length 202
Sequence MPVAKKLSQFRHRFDVAGDEAVFMKASGFNTFMARVDAAEYGICRRLNRGASFPLPRRVFRIASRLGDGVIWYVLLALLPLLYGAPAVKPAIVMALTGVLGVALYKFLKKIFVRERPFITHTTIDLAMAPLDRYSFPSGHTLHAVSFAWQATAHFPELGWVLVPLAALIASSRVVLGLHYPTDVLAGAAIGASLAELGCSLA

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
178 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
227 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
228 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
232 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
239 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
240 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 2.62
Rhizosphere 80.68
Stem 0
Stem Tuber 0
Unclassified 11.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10100889 3300002067 Bacteria 829
2 JGI25406J46586_10001948 3300003203 Bacteria 9756
3 rootL2_10036603 3300003322 Bacteria 3647
4 rootL2_10227714 3300003322 Bacteria 1607
5 rootH1_10058926 3300003323 Bacteria 3922
6 rootH1_10176081 3300003323 Unclassified 1920
7 rootH1_10239563 3300003323 Bacteria 1061
8 JGI25405J52794_10013153 3300003911 Bacteria 1601
9 JGI25405J52794_10074913 3300003911 Bacteria 741
10 Ga0058863_11972227 3300004799 Unclassified 1098
11 Ga0058862_12785232 3300004803 Unclassified 747
12 Ga0065707_10082099 3300005295 Bacteria 22054
13 Ga0070676_10165887 3300005328 Bacteria 1425
14 Ga0070683_100009452 3300005329 Bacteria 8338
15 Ga0070683_100187580 3300005329 Bacteria 1963
16 Ga0070690_100193710 3300005330 Bacteria 1411
17 Ga0070670_100098793 3300005331 Unclassified 2512
18 Ga0070670_100433835 3300005331 Unclassified 1163
19 Ga0070677_10014782 3300005333 Bacteria 2754
20 Ga0068869_100094366 3300005334 Bacteria 2255
21 Ga0068869_100205189 3300005334 Bacteria 1556
22 Ga0070666_10182379 3300005335 Bacteria 1473
23 Ga0070666_10234457 3300005335 Bacteria 1297
24 Ga0070680_100025689 3300005336 Bacteria 4709
25 Ga0070680_100314086 3300005336 Bacteria 1330
26 Ga0070682_100012382 3300005337 Bacteria 4891
27 Ga0070682_100039795 3300005337 Bacteria 2890
28 Ga0070682_100315044 3300005337 Bacteria 1153
29 Ga0070689_100000790 3300005340 Bacteria 19449
30 Ga0070689_100152843 3300005340 Bacteria 1862
31 Ga0070691_10054457 3300005341 Bacteria 1915
32 Ga0070669_100692959 3300005353 Bacteria 860
33 Ga0070675_100071559 3300005354 Bacteria 2877
34 Ga0070675_100338157 3300005354 Bacteria 1333
35 Ga0070675_100674497 3300005354 Bacteria 940
36 Ga0070671_100002906 3300005355 Bacteria 13333
37 Ga0070673_100688765 3300005364 Bacteria 938
38 Ga0070673_101038495 3300005364 Bacteria 764
39 Ga0070688_100013771 3300005365 Bacteria 4571
40 Ga0070667_100072390 3300005367 Unclassified 2937
41 Ga0070667_100096180 3300005367 Unclassified 2554
42 Ga0070667_100121165 3300005367 Bacteria 2275
43 Ga0070667_100445636 3300005367 Bacteria 1183
44 Ga0070713_100005217 3300005436 Bacteria 8852
45 Ga0070713_100714189 3300005436 Unclassified 957
46 Ga0070710_10054211 3300005437 Bacteria 2262
47 Ga0070701_10018954 3300005438 Bacteria 3243
48 Ga0070705_100009002 3300005440 Bacteria 4955
49 Ga0070700_100024407 3300005441 Bacteria 3550
50 Ga0070700_100053063 3300005441 Bacteria 2529
51 Ga0070694_100026650 3300005444 Bacteria 3748
52 Ga0070663_100025811 3300005455 Unclassified 3971
53 Ga0070662_100304435 3300005457 Bacteria 1296
54 Ga0070681_10001712 3300005458 Bacteria 19633
55 Ga0070681_10018916 3300005458 Bacteria 6892
56 Ga0070681_10021242 3300005458 Bacteria 6506
57 Ga0070685_10057006 3300005466 Bacteria 2273
58 Ga0070685_10151731 3300005466 Bacteria 1469
59 Ga0070685_10230799 3300005466 Bacteria 1217
60 Ga0070685_10543926 3300005466 Bacteria 828
61 Ga0070679_100039352 3300005530 Bacteria 4699
62 Ga0070679_100081025 3300005530 Bacteria 3235
63 Ga0070679_100142182 3300005530 Bacteria 2378
64 Ga0070679_100178075 3300005530 Bacteria 2099
65 Ga0070684_100028758 3300005535 Bacteria 4703
66 Ga0070684_100474633 3300005535 Bacteria 1157
67 Ga0070684_100567261 3300005535 Unclassified 1054
68 Ga0070672_100001343 3300005543 Bacteria 15170
69 Ga0070672_100072344 3300005543 Unclassified 2745
70 Ga0070686_100008319 3300005544 Bacteria 5810
71 Ga0070686_100413820 3300005544 Bacteria 1028
72 Ga0070695_100184584 3300005545 Bacteria 1480
73 Ga0070696_100063141 3300005546 Bacteria 2594
74 Ga0070693_100227695 3300005547 Bacteria 1225
75 Ga0070665_100002359 3300005548 Bacteria 20874
76 Ga0070665_100002869 3300005548 Bacteria 18622
77 Ga0070665_100009724 3300005548 Bacteria 9722
78 Ga0070665_100009812 3300005548 Bacteria 9680
79 Ga0070665_100022575 3300005548 Bacteria 6334
80 Ga0070665_100026547 3300005548 Bacteria 5831
81 Ga0070665_100031831 3300005548 Bacteria 5309
82 Ga0070665_100510941 3300005548 Unclassified 1213
83 Ga0070665_101129701 3300005548 Bacteria 795
84 Ga0068855_100000777 3300005563 Bacteria 39367
85 Ga0068855_100013148 3300005563 Bacteria 9982
86 Ga0068855_100033431 3300005563 Bacteria 6137
87 Ga0068855_100648074 3300005563 Bacteria 1134
88 Ga0070664_100005400 3300005564 Bacteria 10259
89 Ga0070664_100238067 3300005564 Bacteria 1633
90 Ga0068857_100358692 3300005577 Bacteria 1351
91 Ga0068857_101317987 3300005577 Bacteria 701
92 Ga0068854_100122668 3300005578 Bacteria 1975
93 Ga0068856_100065373 3300005614 Bacteria 3595
94 Ga0068856_100241559 3300005614 Bacteria 1821
95 Ga0068856_100560413 3300005614 Bacteria 1164
96 Ga0070702_100001648 3300005615 Bacteria 9251
97 Ga0070702_100188163 3300005615 Bacteria 1356
98 Ga0068852_100718146 3300005616 Bacteria 1010
99 Ga0068859_100000640 3300005617 Bacteria 34948
100 Ga0068859_100039205 3300005617 Bacteria 4752
101 Ga0068859_100079952 3300005617 Bacteria 3310
102 Ga0068859_100225157 3300005617 Bacteria 1964
103 Ga0068859_100998854 3300005617 Bacteria 919
104 Ga0068859_101056023 3300005617 Bacteria 893
105 Ga0068864_100332385 3300005618 Bacteria 1430
106 Ga0068866_10679160 3300005718 Bacteria 704
107 Ga0068861_100005938 3300005719 Bacteria 8296
108 Ga0068861_100008761 3300005719 Bacteria 6967
109 Ga0068861_100056396 3300005719 Bacteria 2999
110 Ga0068851_10067644 3300005834 Bacteria 1843
111 Ga0068851_10271127 3300005834 Unclassified 968
112 Ga0068870_10070321 3300005840 Bacteria 1907
113 Ga0068863_100009426 3300005841 Bacteria 9528
114 Ga0068863_100015836 3300005841 Bacteria 7235
115 Ga0068863_100108325 3300005841 Bacteria 2644
116 Ga0068863_100117598 3300005841 Bacteria 2533
117 Ga0068863_100898454 3300005841 Bacteria 886
118 Ga0068858_100005841 3300005842 Bacteria 12023
119 Ga0068858_100471444 3300005842 Bacteria 1211
120 Ga0068860_100011761 3300005843 Bacteria 8625
121 Ga0068860_100033885 3300005843 Bacteria 4899
122 Ga0068860_100047297 3300005843 Bacteria 4100
123 Ga0068862_100001899 3300005844 Bacteria 18971
124 Ga0068862_100110632 3300005844 Bacteria 2410
125 Ga0068862_100502776 3300005844 Bacteria 1151
126 Ga0081455_10000032 3300005937 Bacteria 146266
127 Ga0081455_10025474 3300005937 Bacteria 5458
128 Ga0081540_1081930 3300005983 Bacteria 1449
129 Ga0081539_10000007 3300005985 Bacteria 532790
130 Ga0070717_10039700 3300006028 Bacteria 3830
131 Ga0075366_10304734 3300006195 Bacteria 975
132 Ga0097621_100025111 3300006237 Bacteria 4660
133 Ga0097621_100097397 3300006237 Bacteria 2470
134 Ga0068871_100159183 3300006358 Bacteria 1930
135 Ga0068871_100178957 3300006358 Bacteria 1821
136 Ga0068871_100386729 3300006358 Bacteria 1244
137 Ga0075428_101590781 3300006844 Bacteria 683
138 Ga0068865_100041882 3300006881 Bacteria 3119
139 Ga0068865_100135606 3300006881 Bacteria 1849
140 Ga0068865_100817748 3300006881 Bacteria 805
141 Ga0097620_100000640 3300006931 Bacteria 34948
142 Ga0097620_100039204 3300006931 Bacteria 4752
143 Ga0097620_100079951 3300006931 Bacteria 3310
144 Ga0097620_100225143 3300006931 Bacteria 1964
145 Ga0097620_100998689 3300006931 Bacteria 919
146 Ga0097620_101056034 3300006931 Bacteria 893
147 Ga0105250_10142626 3300009092 Bacteria 993
148 Ga0105240_10000924 3300009093 Bacteria 52333
149 Ga0105240_10007172 3300009093 Bacteria 16232
150 Ga0105240_10010358 3300009093 Bacteria 13117
151 Ga0105240_10035511 3300009093 Bacteria 6422
152 Ga0105240_10083928 3300009093 Bacteria 3907
153 Ga0105240_10093982 3300009093 Bacteria 3659
154 Ga0105240_10192191 3300009093 Unclassified 2399
155 Ga0105240_10283008 3300009093 Bacteria 1904
156 Ga0111539_10665230 3300009094 Bacteria 1213
157 Ga0105247_10000151 3300009101 Bacteria 67945
158 Ga0105247_10093357 3300009101 Bacteria 1913
159 Ga0105242_10049932 3300009176 Bacteria 3405
160 Ga0105248_10413860 3300009177 Bacteria 1518
161 Ga0105248_10537985 3300009177 Unclassified 1318
162 Ga0105237_10011349 3300009545 Bacteria 9426
163 Ga0105237_10026319 3300009545 Bacteria 5945
164 Ga0105237_10100990 3300009545 Unclassified 2877
165 Ga0105237_10163497 3300009545 Unclassified 2225
166 Ga0105237_10242618 3300009545 Unclassified 1803
167 Ga0105237_10297953 3300009545 Bacteria 1616
168 Ga0105237_10375537 3300009545 Bacteria 1426
169 Ga0105237_10439988 3300009545 Bacteria 1309
170 Ga0105237_10994830 3300009545 Unclassified 845
171 Ga0105237_11617447 3300009545 Bacteria 655
172 Ga0105238_10010079 3300009551 Bacteria 9478
173 Ga0105238_10027167 3300009551 Bacteria 5832
174 Ga0105238_10029751 3300009551 Bacteria 5563
175 Ga0105238_10521806 3300009551 Bacteria 1190
176 Ga0105238_10573730 3300009551 Bacteria 1134
177 Ga0105238_10883064 3300009551 Bacteria 912
178 Ga0105249_10021699 3300009553 Bacteria 5748
179 Ga0105249_10026206 3300009553 Bacteria 5252
180 Ga0105249_10356176 3300009553 Bacteria 1484
181 Ga0105249_10482212 3300009553 Unclassified 1283
182 Ga0099796_10020163 3300010159 Bacteria 2033
183 Ga0105239_10308419 3300010375 Bacteria 1783
184 Ga0105239_10648423 3300010375 Bacteria 1206
185 Ga0105246_10126467 3300011119 Unclassified 1902
186 Ga0157370_10001360 3300013104 Bacteria 30276
187 Ga0157370_10026601 3300013104 Bacteria 5710
188 Ga0157369_10073141 3300013105 Bacteria 3678
189 Ga0157369_10152670 3300013105 Bacteria 2441
190 Ga0157369_10395645 3300013105 Bacteria 1434
191 Ga0157374_10614312 3300013296 Bacteria 1098
192 Ga0157374_11478600 3300013296 Unclassified 702
193 Ga0157374_11984624 3300013296 Unclassified 608
194 Ga0157378_11616702 3300013297 Bacteria 694
195 Ga0163162_10017947 3300013306 Bacteria 6924
196 Ga0163162_10456859 3300013306 Bacteria 1409
197 Ga0157372_10611161 3300013307 Bacteria 1271
198 Ga0157375_10008273 3300013308 Bacteria 9110
199 Ga0157375_10312067 3300013308 Bacteria 1737
200 Ga0157375_11276391 3300013308 Bacteria 863
201 Ga0163163_10009797 3300014325 Bacteria 8584
202 Ga0163163_10017071 3300014325 Bacteria 6761
203 Ga0163163_10140992 3300014325 Bacteria 2453
204 Ga0163163_10397788 3300014325 Bacteria 1436
205 Ga0163163_10524024 3300014325 Bacteria 1247
206 Ga0157380_10002880 3300014326 Bacteria 11682
207 Ga0157380_10024777 3300014326 Bacteria 4545
208 Ga0157379_10028619 3300014968 Bacteria 4956
209 Ga0157379_10032180 3300014968 Bacteria 4674
210 Ga0157379_10129786 3300014968 Bacteria 2268
211 Ga0157379_10527040 3300014968 Bacteria 1097
212 Ga0157379_10861762 3300014968 Unclassified 858
213 Ga0157376_10209771 3300014969 Bacteria 1798
214 Ga0157376_10540345 3300014969 Bacteria 1152
215 Ga0213873_10123994 3300021358 Bacteria 760
216 Ga0213874_10005073 3300021377 Bacteria 3048
217 Ga0213876_10040203 3300021384 Bacteria 2470
218 Ga0213871_10014669 3300021441 Bacteria 1863
219 Ga0228598_1052870 3300024227 Bacteria 806
220 Ga0207696_1073772 3300025711 Bacteria 947
221 Ga0207682_10020850 3300025893 Bacteria 2575
222 Ga0207710_10000845 3300025900 Bacteria 16526
223 Ga0207710_10082932 3300025900 Bacteria 1490
224 Ga0207680_10225687 3300025903 Bacteria 1286
225 Ga0207680_10251050 3300025903 Bacteria 1222
226 Ga0207647_10064997 3300025904 Bacteria 2215
227 Ga0207699_10039023 3300025906 Bacteria 2725
228 Ga0207699_10210341 3300025906 Bacteria 1323
229 Ga0207645_10016418 3300025907 Bacteria 4902
230 Ga0207643_10078025 3300025908 Bacteria 1915
231 Ga0207707_10000940 3300025912 Bacteria 28134
232 Ga0207707_10003428 3300025912 Bacteria 14061
233 Ga0207707_10126591 3300025912 Bacteria 2234
234 Ga0207707_10424743 3300025912 Unclassified 1139
235 Ga0207707_10627711 3300025912 Unclassified 907
236 Ga0207695_10019074 3300025913 Bacteria 7909
237 Ga0207695_10066813 3300025913 Bacteria 3691
238 Ga0207695_10087128 3300025913 Bacteria 3146
239 Ga0207695_10115249 3300025913 Bacteria 2662
240 Ga0207695_10131207 3300025913 Bacteria 2463
241 Ga0207695_10366976 3300025913 Bacteria 1326
242 Ga0207695_10377336 3300025913 Bacteria 1304
243 Ga0207671_10135125 3300025914 Unclassified 1896
244 Ga0207671_10176655 3300025914 Bacteria 1660
245 Ga0207671_10385412 3300025914 Bacteria 1114
246 Ga0207671_10460539 3300025914 Unclassified 1013
247 Ga0207660_10002352 3300025917 Bacteria 12450
248 Ga0207660_10147678 3300025917 Unclassified 1803
249 Ga0207662_10189322 3300025918 Bacteria 1327
250 Ga0207652_10007114 3300025921 Bacteria 9020
251 Ga0207652_10063758 3300025921 Bacteria 3187
252 Ga0207652_10508615 3300025921 Bacteria 1084
253 Ga0207681_11075055 3300025923 Bacteria 675
254 Ga0207694_10050100 3300025924 Bacteria 3233
255 Ga0207694_10077790 3300025924 Bacteria 2600
256 Ga0207694_10128668 3300025924 Bacteria 2028
257 Ga0207694_10225068 3300025924 Unclassified 1531
258 Ga0207650_10100270 3300025925 Unclassified 2228
259 Ga0207650_10129743 3300025925 Bacteria 1971
260 Ga0207700_10037938 3300025928 Bacteria 3494
261 Ga0207664_11195284 3300025929 Unclassified 678
262 Ga0207644_10133618 3300025931 Unclassified 1903
263 Ga0207690_10733507 3300025932 Unclassified 814
264 Ga0207706_10263038 3300025933 Unclassified 1506
265 Ga0207686_10427987 3300025934 Bacteria 1014
266 Ga0207670_10001235 3300025936 Bacteria 13497
267 Ga0207670_10272475 3300025936 Bacteria 1316
268 Ga0207704_10019757 3300025938 Bacteria 3547
269 Ga0207691_10002273 3300025940 Bacteria 18818
270 Ga0207691_10248187 3300025940 Unclassified 1537
271 Ga0207689_10129980 3300025942 Bacteria 2072
272 Ga0207689_10173430 3300025942 Bacteria 1778
273 Ga0207689_10374036 3300025942 Bacteria 1186
274 Ga0207689_10869260 3300025942 Bacteria 761
275 Ga0207661_10067170 3300025944 Bacteria 2915
276 Ga0207661_10090430 3300025944 Bacteria 2549
277 Ga0207679_10176404 3300025945 Unclassified 1764
278 Ga0207679_10356733 3300025945 Bacteria 1276
279 Ga0207679_10489457 3300025945 Bacteria 1096
280 Ga0207679_10847736 3300025945 Bacteria 835
281 Ga0207679_10893724 3300025945 Unclassified 812
282 Ga0207667_10002266 3300025949 Bacteria 24179
283 Ga0207667_10413246 3300025949 Bacteria 1373
284 Ga0207651_10035802 3300025960 Bacteria 3233
285 Ga0207712_10015561 3300025961 Unclassified 4911
286 Ga0207712_10647615 3300025961 Bacteria 918
287 Ga0207712_10666260 3300025961 Bacteria 906
288 Ga0207640_10146586 3300025981 Unclassified 1728
289 Ga0207640_10332134 3300025981 Bacteria 1215
290 Ga0207658_10040526 3300025986 Bacteria 3367
291 Ga0207658_10055832 3300025986 Bacteria 2928
292 Ga0207658_10108131 3300025986 Unclassified 2193
293 Ga0207703_10002231 3300026035 Bacteria 16970
294 Ga0207703_10085244 3300026035 Bacteria 2643
295 Ga0207703_10572572 3300026035 Bacteria 1066
296 Ga0207678_10082548 3300026067 Bacteria 2750
297 Ga0207678_10120004 3300026067 Unclassified 2244
298 Ga0207708_10022323 3300026075 Bacteria 4779
299 Ga0207708_10144842 3300026075 Bacteria 1866
300 Ga0207702_10314266 3300026078 Unclassified 1490
301 Ga0207702_10436950 3300026078 Bacteria 1268
302 Ga0207702_10857426 3300026078 Bacteria 899
303 Ga0207641_10000281 3300026088 Bacteria 63945
304 Ga0207641_10073959 3300026088 Bacteria 2938
305 Ga0207641_10126889 3300026088 Bacteria 2285
306 Ga0207641_10260972 3300026088 Bacteria 1622
307 Ga0207648_10132095 3300026089 Bacteria 2198
308 Ga0207648_10403300 3300026089 Bacteria 1239
309 Ga0207648_10479253 3300026089 Bacteria 1136
310 Ga0207676_10177618 3300026095 Bacteria 1861
311 Ga0207676_10370668 3300026095 Bacteria 1330
312 Ga0207674_10087623 3300026116 Unclassified 3106
313 Ga0207675_100001550 3300026118 Bacteria 22998
314 Ga0207675_100011512 3300026118 Bacteria 8278
315 Ga0207675_100036315 3300026118 Unclassified 4597
316 Ga0207675_100187328 3300026118 Bacteria 1984
317 Ga0265357_1003182 3300028023 Unclassified 1408
318 Ga0268266_10001031 3300028379 Bacteria 35110
319 Ga0268266_10006128 3300028379 Bacteria 11069
320 Ga0268266_10009342 3300028379 Bacteria 8642
321 Ga0268266_10009475 3300028379 Bacteria 8570
322 Ga0268266_10009611 3300028379 Bacteria 8504
323 Ga0268266_10134622 3300028379 Bacteria 2212
324 Ga0268266_10169020 3300028379 Bacteria 1984
325 Ga0268266_10860401 3300028379 Bacteria 876
326 Ga0268265_10006938 3300028380 Bacteria 7662
327 Ga0268265_10354055 3300028380 Bacteria 1342
328 Ga0268265_10837977 3300028380 Bacteria 899
329 Ga0268264_10000095 3300028381 Bacteria 230806
330 Ga0268264_10316880 3300028381 Bacteria 1473
331 Ga0265334_10079214 3300028573 Bacteria 1212
332 Ga0307515_10072464 3300028794 Bacteria 4648
333 Ga0307515_10086231 3300028794 Bacteria 4005
334 Ga0307515_10095416 3300028794 Unclassified 3661
335 Ga0307511_10002379 3300030521 Bacteria 19674
336 Ga0265320_10025296 3300031240 Bacteria 3123
337 Ga0265339_10062319 3300031249 Bacteria 2005
338 Ga0265331_10018020 3300031250 Bacteria 3670
339 Ga0265331_10200419 3300031250 Bacteria 899
340 Ga0307513_10008271 3300031456 Bacteria 13342
341 Ga0307513_10022248 3300031456 Bacteria 7457
342 Ga0307513_10224812 3300031456 Bacteria 1695
343 Ga0307513_10265728 3300031456 Bacteria 1502
344 Ga0307509_10000084 3300031507 Bacteria 131262
345 Ga0307508_10340728 3300031616 Bacteria 1091
346 Ga0307518_10245158 3300031838 Bacteria 1145
347 Ga0307406_10175782 3300031901 Unclassified 1554
348 Ga0307407_10136989 3300031903 Bacteria 1574
349 Ga0307411_10024128 3300032005 Bacteria 3619
350 Ga0307507_10266531 3300033179 Bacteria 1087
351 Ga0307510_10000010 3300033180 Bacteria 377457
352 Ga0307510_10027472 3300033180 Bacteria 6520
353 Ga0373936_0009487 3300035113 Unclassified 3670
354 Ga0373956_0006684 3300035119 Bacteria 4626
355 Ga0373957_0005602 3300035120 Bacteria 3901
356 Ga0373955_0347179 3300035172 Bacteria 898
357 Ga0373933_0025610 3300035724 Bacteria 3384
358 Ga0373933_0493274 3300035724 Unclassified 802
359 Ga0373937_0026876 3300036401 Bacteria 5202
360 Ga0373937_0155514 3300036401 Bacteria 2143
361 Ga0373937_0479618 3300036401 Unclassified 1181
362 Ga0373925_1363534 3300037068 Bacteria 581
363 Ga0395898_0301882 3300037466 Bacteria 1527
364 Ga0436364_0076894 3300037853 Bacteria 1039
365 Ga0436364_1515784 3300037853 Bacteria 669
366 Ga0436365_0602547 3300039437 Bacteria 6521
367 Ga0436365_0704320 3300039437 Bacteria 1137
368 Ga0436365_0926236 3300039437 Bacteria 2923
369 Ga0436360_0651768 3300039438 Bacteria 4662
370 Ga0436360_0710363 3300039438 Bacteria 1045
371 Ga0436360_0716812 3300039438 Bacteria 1129
372 Ga0436360_0898563 3300039438 Bacteria 5033
373 Ga0436361_0702717 3300039447 Bacteria 929
374 Ga0436361_0754665 3300039447 Bacteria 6169
375 Ga0436363_0508371 3300039450 Bacteria 12404
376 Ga0436363_0748181 3300039450 Bacteria 7090
377 Ga0436363_1102673 3300039450 Bacteria 2060
378 Ga0451800_0995622 3300041459 Bacteria 609
379 Ga0451807_1817092 3300041486 Bacteria 2183
380 Ga0451853_0271959 3300041512 Unclassified 980
381 Ga0451853_1451912 3300041512 Bacteria 1299
382 Ga0439464_0106147 3300042439 Bacteria 857
383 Ga0450916_040849 3300042530 Bacteria 705
384 Ga0466969_0000260 3300044656 Bacteria 28906
385 Ga0466969_0006527 3300044656 Bacteria 6204
386 Ga0466969_0051551 3300044656 Bacteria 2025
387 Ga0466972_0054285 3300044658 Bacteria 1928
388 Ga0466966_0010660 3300044684 Bacteria 6109
389 Ga0466966_0015079 3300044684 Bacteria 5112
390 Ga0466966_0047298 3300044684 Bacteria 2744
391 Ga0466961_0001164 3300044693 Bacteria 16189
392 Ga0466961_0562958 3300044693 Bacteria 686
393 Ga0466964_0000142 3300044706 Bacteria 19111
394 Ga0466971_0000830 3300044719 Bacteria 12523
395 Ga0466970_0004977 3300044765 Bacteria 6565
396 Ga0466970_0141649 3300044765 Bacteria 1325
397 Ga0466959_0004527 3300045049 Bacteria 9326
398 Ga0466959_0044773 3300045049 Bacteria 3259
399 Ga0466959_0046775 3300045049 Bacteria 3184
400 Ga0466959_0129610 3300045049 Bacteria 1788
401 Ga0466959_0148419 3300045049 Bacteria 1654
402 Ga0466959_0769402 3300045049 Bacteria 644
403 Ga0466958_0241926 3300045836 Bacteria 1153
404 Ga0495603_0362071 3300046455 Bacteria 832
405 Ga0495638_0011047 3300046460 Bacteria 6240
406 Ga0495638_0036234 3300046460 Bacteria 3144
407 Ga0495638_0108918 3300046460 Bacteria 1647
408 Ga0495641_0349226 3300046461 Bacteria 669
409 Ga0495580_0539696 3300046472 Bacteria 775
410 Ga0495606_0290280 3300046507 Bacteria 890
411 Ga0495616_0004035 3300046513 Bacteria 9324
412 Ga0495616_0029322 3300046513 Bacteria 2907
413 Ga0495632_0020636 3300046519 Bacteria 3563
414 Ga0495632_0089094 3300046519 Unclassified 1465
415 Ga0495632_0097115 3300046519 Bacteria 1391
416 Ga0495667_0686666 3300046559 Unclassified 635
417 Ga0495668_0156351 3300046616 Bacteria 1249
418 Ga0495625_0042029 3300046660 Bacteria 3324
419 Ga0495625_0045773 3300046660 Bacteria 3161
420 Ga0495625_0080297 3300046660 Unclassified 2272
421 Ga0495625_0493415 3300046660 Unclassified 750
422 Ga0495649_0004854 3300046694 Bacteria 8690
423 Ga0495649_0366142 3300046694 Bacteria 727
424 Ga0495604_0102339 3300047317 Bacteria 2103
425 Ga0495675_0390285 3300047444 Bacteria 813
426 Ga0495686_0205469 3300047472 Bacteria 1128
427 Ga0495602_0216916 3300048088 Bacteria 1447
428 Ga0496100_0083303 3300048903 Bacteria 2165
429 Ga0496102_0006392 3300048905 Bacteria 10044
430 Ga0496102_0049203 3300048905 Bacteria 3835
431 Ga0496102_0109390 3300048905 Bacteria 2575
432 Ga0496103_0043369 3300048906 Unclassified 2769
433 Ga0496103_0084875 3300048906 Bacteria 1995
434 Ga0496105_0447640 3300048908 Unclassified 1020
435 Ga0496105_0487769 3300048908 Bacteria 969
436 Ga0496108_0366176 3300048911 Bacteria 1258
437 Ga0496112_0159325 3300048915 Bacteria 2223
438 Ga0496114_1142229 3300048917 Bacteria 664
439 Ga0496117_0000157 3300048920 Bacteria 144837
440 Ga0496117_0243413 3300048920 Bacteria 986
441 Ga0496118_0000117 3300048921 Bacteria 144884
442 Ga0496118_0009362 3300048921 Bacteria 9917
443 Ga0496119_0000502 3300048922 Bacteria 53334
444 Ga0496119_0005405 3300048922 Bacteria 12268
445 Ga0496119_0026046 3300048922 Bacteria 4066
446 Ga0496119_0333035 3300048922 Bacteria 740
447 Ga0496120_0001182 3300048923 Bacteria 33205
448 Ga0496120_0018355 3300048923 Unclassified 4511
449 Ga0496121_0065315 3300048924 Bacteria 2961
450 Ga0496121_0134588 3300048924 Bacteria 1843
451 Ga0496121_0149449 3300048924 Bacteria 1721
452 Ga0496121_0317441 3300048924 Bacteria 1050
453 Ga0496124_0179544 3300048927 Unclassified 1630
454 Ga0496125_0001312 3300048928 Bacteria 36809
455 Ga0496125_0023822 3300048928 Bacteria 5642
456 Ga0496125_0027318 3300048928 Bacteria 5176
457 Ga0496125_0247855 3300048928 Bacteria 1126
458 Ga0496126_0004205 3300048929 Bacteria 17338
459 Ga0496126_0100215 3300048929 Bacteria 2536
460 Ga0496126_0111636 3300048929 Bacteria 2381
461 Ga0496126_0144795 3300048929 Bacteria 2042
462 Ga0496126_0168202 3300048929 Unclassified 1869
463 Ga0496126_0201304 3300048929 Bacteria 1681
464 Ga0496126_0245689 3300048929 Unclassified 1493
465 Ga0501042_0115559 3300049578 Bacteria 1932
466 Ga0501076_0817836 3300049592 Bacteria 769
467 Ga0501044_1058902 3300049823 Unclassified 681
468 nmdc:mga0n895_1312910_c1 3300050512 Bacteria 694
469 Ga0495619_0145347 3300053085 Bacteria 1635
470 Ga0500583_0033451 3300053092 Bacteria 2275
471 Ga0500583_0049932 3300053092 Bacteria 1938
472 Ga0500641_0017961 3300053096 Bacteria 2655
473 Ga0500641_0118612 3300053096 Bacteria 1140
474 Ga0500641_0160072 3300053096 Bacteria 971
475 Ga0500556_0010765 3300053104 Bacteria 2692
476 Ga0500558_074155 3300053106 Unclassified 1398
477 Ga0500617_003799 3300053124 Bacteria 5533
478 Ga0500628_076494 3300053129 Bacteria 849
479 Ga0500652_131791 3300053131 Bacteria 1043
480 Ga0500559_0062481 3300053136 Unclassified 1663
481 Ga0500559_0147361 3300053136 Unclassified 1104
482 Ga0500577_0312126 3300053142 Bacteria 687
483 Ga0500579_199993 3300053143 Bacteria 741
484 Ga0500588_0000938 3300053146 Bacteria 5169
485 Ga0500616_0000062 3300053153 Bacteria 245744
486 Ga0500616_0021031 3300053153 Bacteria 3662
487 Ga0500622_0009628 3300053156 Bacteria 5339
488 Ga0500639_096314 3300053163 Unclassified 1465
489 Ga0500637_0001136 3300053178 Bacteria 11003
490 Ga0500637_0049721 3300053178 Bacteria 2387
491 Ga0500637_0097634 3300053178 Unclassified 1703
492 Ga0500637_0253844 3300053178 Bacteria 980
493 Ga0500611_106640 3300053727 Bacteria 732
494 Ga0500656_011735 3300053732 Bacteria 979
495 Ga0587088_050464 3300059508 Unclassified 813
496 Ga0587076_073309 3300059645 Bacteria 715
497 Ga0466962_0002832 3300061719 Bacteria 8257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003911 JGI25405J52794_10074913 JGI25405J52794_100749131 147
2 3300005937 Ga0081455_10025474 Ga0081455_100254744 147
3 3300053129 Ga0500628_076494 Ga0500628_076494_302_793 147
4 3300005364 Ga0070673_101038495 Ga0070673_1010384951 148
5 3300005578 Ga0068854_100122668 Ga0068854_1001226682 148
6 3300025981 Ga0207640_10332134 Ga0207640_103321341 148
7 3300026067 Ga0207678_10082548 Ga0207678_100825483 148
8 3300036401 Ga0373937_0479618 Ga0373937_0479618_444_977 148
9 3300046559 Ga0495667_0686666 Ga0495667_0686666_71_604 148
10 3300025942 Ga0207689_10374036 Ga0207689_103740362 149
11 3300005466 Ga0070685_10230799 Ga0070685_102307991 150
12 3300046694 Ga0495649_0004854 Ga0495649_0004854_3117_3650 150
13 3300049578 Ga0501042_0115559 Ga0501042_0115559_537_1055 151
14 3300042439 Ga0439464_0106147 Ga0439464_0106147_198_731 152
15 3300005543 Ga0070672_100001343 Ga0070672_1000013435 153
16 3300005841 Ga0068863_100108325 Ga0068863_1001083252 153
17 3300006358 Ga0068871_100386729 Ga0068871_1003867292 153
18 3300006881 Ga0068865_100041882 Ga0068865_1000418822 153
19 3300013308 Ga0157375_10008273 Ga0157375_100082738 153
20 3300014969 Ga0157376_10209771 Ga0157376_102097712 153
21 3300025938 Ga0207704_10019757 Ga0207704_100197573 153
22 3300025940 Ga0207691_10002273 Ga0207691_1000227314 153
23 3300026088 Ga0207641_10073959 Ga0207641_100739592 153
24 3300025945 Ga0207679_10847736 Ga0207679_108477362 155
25 3300031901 Ga0307406_10175782 Ga0307406_101757822 155
26 3300035120 Ga0373957_0005602 Ga0373957_0005602_3226_3765 155
27 3300035172 Ga0373955_0347179 Ga0373955_0347179_117_656 155
28 3300035724 Ga0373933_0025610 Ga0373933_0025610_2739_3278 155
29 3300047317 Ga0495604_0102339 Ga0495604_0102339_109_648 155
30 3300047444 Ga0495675_0390285 Ga0495675_0390285_19_558 155
31 3300048088 Ga0495602_0216916 Ga0495602_0216916_292_831 155
32 3300053085 Ga0495619_0145347 Ga0495619_0145347_77_616 155
33 3300005354 Ga0070675_100674497 Ga0070675_1006744971 157
34 3300005441 Ga0070700_100053063 Ga0070700_1000530632 157
35 3300024227 Ga0228598_1052870 Ga0228598_10528701 157
36 3300037068 Ga0373925_1363534 Ga0373925_1363534_23_535 157
37 3300044684 Ga0466966_0047298 Ga0466966_0047298_1751_2275 157
38 3300044693 Ga0466961_0562958 Ga0466961_0562958_20_532 157
39 3300046460 Ga0495638_0036234 Ga0495638_0036234_376_888 157
40 3300046660 Ga0495625_0042029 Ga0495625_0042029_2391_2903 157
41 3300005544 Ga0070686_100413820 Ga0070686_1004138201 158
42 3300013297 Ga0157378_11616702 Ga0157378_116167021 159
43 3300049592 Ga0501076_0817836 Ga0501076_0817836_197_736 159
44 3300005458 Ga0070681_10001712 Ga0070681_1000171218 160
45 3300005530 Ga0070679_100178075 Ga0070679_1001780751 160
46 3300009551 Ga0105238_10883064 Ga0105238_108830642 160
47 3300025912 Ga0207707_10003428 Ga0207707_100034283 160
48 3300025921 Ga0207652_10508615 Ga0207652_105086151 160
49 3300003322 rootL2_10036603 rootL2_100366032 161
50 3300003323 rootH1_10176081 rootH1_101760812 161
51 3300003323 rootH1_10239563 rootH1_102395632 161
52 3300005328 Ga0070676_10165887 Ga0070676_101658872 161
53 3300005330 Ga0070690_100193710 Ga0070690_1001937102 161
54 3300005331 Ga0070670_100098793 Ga0070670_1000987932 161
55 3300005331 Ga0070670_100433835 Ga0070670_1004338352 161
56 3300005333 Ga0070677_10014782 Ga0070677_100147822 161
57 3300005334 Ga0068869_100094366 Ga0068869_1000943662 161
58 3300005334 Ga0068869_100205189 Ga0068869_1002051892 161
59 3300005335 Ga0070666_10234457 Ga0070666_102344572 161
60 3300005337 Ga0070682_100012382 Ga0070682_1000123822 161
61 3300005337 Ga0070682_100039795 Ga0070682_1000397952 161
62 3300005337 Ga0070682_100315044 Ga0070682_1003150441 161
63 3300005340 Ga0070689_100000790 Ga0070689_10000079013 161
64 3300005340 Ga0070689_100152843 Ga0070689_1001528432 161
65 3300005341 Ga0070691_10054457 Ga0070691_100544571 161
66 3300005353 Ga0070669_100692959 Ga0070669_1006929591 161
67 3300005354 Ga0070675_100071559 Ga0070675_1000715592 161
68 3300005354 Ga0070675_100338157 Ga0070675_1003381572 161
69 3300005364 Ga0070673_100688765 Ga0070673_1006887652 161
70 3300005365 Ga0070688_100013771 Ga0070688_1000137712 161
71 3300005367 Ga0070667_100072390 Ga0070667_1000723902 161
72 3300005438 Ga0070701_10018954 Ga0070701_100189542 161
73 3300005440 Ga0070705_100009002 Ga0070705_1000090023 161
74 3300005441 Ga0070700_100024407 Ga0070700_1000244072 161
75 3300005444 Ga0070694_100026650 Ga0070694_1000266504 161
76 3300005455 Ga0070663_100025811 Ga0070663_1000258113 161
77 3300005457 Ga0070662_100304435 Ga0070662_1003044352 161
78 3300005466 Ga0070685_10057006 Ga0070685_100570062 161
79 3300005466 Ga0070685_10151731 Ga0070685_101517312 161
80 3300005466 Ga0070685_10543926 Ga0070685_105439261 161
81 3300005530 Ga0070679_100142182 Ga0070679_1001421823 161
82 3300005535 Ga0070684_100474633 Ga0070684_1004746331 161
83 3300005535 Ga0070684_100567261 Ga0070684_1005672611 161
84 3300005543 Ga0070672_100072344 Ga0070672_1000723442 161
85 3300005544 Ga0070686_100008319 Ga0070686_1000083196 161
86 3300005545 Ga0070695_100184584 Ga0070695_1001845842 161
87 3300005546 Ga0070696_100063141 Ga0070696_1000631413 161
88 3300005547 Ga0070693_100227695 Ga0070693_1002276952 161
89 3300005548 Ga0070665_100009812 Ga0070665_1000098128 161
90 3300005548 Ga0070665_100026547 Ga0070665_1000265472 161
91 3300005548 Ga0070665_100031831 Ga0070665_1000318312 161
92 3300005548 Ga0070665_101129701 Ga0070665_1011297011 161
93 3300005563 Ga0068855_100013148 Ga0068855_1000131489 161
94 3300005563 Ga0068855_100033431 Ga0068855_1000334315 161
95 3300005563 Ga0068855_100648074 Ga0068855_1006480741 161
96 3300005564 Ga0070664_100005400 Ga0070664_1000054009 161
97 3300005577 Ga0068857_101317987 Ga0068857_1013179871 161
98 3300005614 Ga0068856_100241559 Ga0068856_1002415592 161
99 3300005614 Ga0068856_100560413 Ga0068856_1005604132 161
100 3300005615 Ga0070702_100001648 Ga0070702_1000016488 161
101 3300005616 Ga0068852_100718146 Ga0068852_1007181462 161
102 3300005617 Ga0068859_100039205 Ga0068859_1000392052 161
103 3300005617 Ga0068859_100079952 Ga0068859_1000799522 161
104 3300005617 Ga0068859_101056023 Ga0068859_1010560231 161
105 3300005618 Ga0068864_100332385 Ga0068864_1003323851 161
106 3300005718 Ga0068866_10679160 Ga0068866_106791601 161
107 3300005719 Ga0068861_100005938 Ga0068861_1000059382 161
108 3300005719 Ga0068861_100008761 Ga0068861_1000087615 161
109 3300005719 Ga0068861_100056396 Ga0068861_1000563964 161
110 3300005834 Ga0068851_10067644 Ga0068851_100676442 161
111 3300005834 Ga0068851_10271127 Ga0068851_102711271 161
112 3300005840 Ga0068870_10070321 Ga0068870_100703212 161
113 3300005841 Ga0068863_100015836 Ga0068863_1000158362 161
114 3300005841 Ga0068863_100117598 Ga0068863_1001175983 161
115 3300005841 Ga0068863_100898454 Ga0068863_1008984542 161
116 3300005842 Ga0068858_100471444 Ga0068858_1004714442 161
117 3300005843 Ga0068860_100011761 Ga0068860_1000117616 161
118 3300005843 Ga0068860_100047297 Ga0068860_1000472974 161
119 3300005844 Ga0068862_100001899 Ga0068862_1000018996 161
120 3300005983 Ga0081540_1081930 Ga0081540_10819302 161
121 3300006237 Ga0097621_100097397 Ga0097621_1000973973 161
122 3300006358 Ga0068871_100178957 Ga0068871_1001789572 161
123 3300006881 Ga0068865_100135606 Ga0068865_1001356062 161
124 3300006881 Ga0068865_100817748 Ga0068865_1008177481 161
125 3300006931 Ga0097620_100039204 Ga0097620_1000392042 161
126 3300006931 Ga0097620_100079951 Ga0097620_1000799512 161
127 3300006931 Ga0097620_101056034 Ga0097620_1010560342 161
128 3300009093 Ga0105240_10007172 Ga0105240_100071722 161
129 3300009093 Ga0105240_10010358 Ga0105240_100103588 161
130 3300009093 Ga0105240_10083928 Ga0105240_100839282 161
131 3300009093 Ga0105240_10192191 Ga0105240_101921912 161
132 3300009094 Ga0111539_10665230 Ga0111539_106652301 161
133 3300009101 Ga0105247_10093357 Ga0105247_100933571 161
134 3300009176 Ga0105242_10049932 Ga0105242_100499321 161
135 3300009177 Ga0105248_10537985 Ga0105248_105379852 161
136 3300009545 Ga0105237_10100990 Ga0105237_101009903 161
137 3300009545 Ga0105237_10163497 Ga0105237_101634971 161
138 3300009545 Ga0105237_10242618 Ga0105237_102426182 161
139 3300009545 Ga0105237_10994830 Ga0105237_109948302 161
140 3300009545 Ga0105237_11617447 Ga0105237_116174471 161
141 3300009551 Ga0105238_10010079 Ga0105238_100100793 161
142 3300009551 Ga0105238_10029751 Ga0105238_100297514 161
143 3300009551 Ga0105238_10521806 Ga0105238_105218062 161
144 3300009551 Ga0105238_10573730 Ga0105238_105737302 161
145 3300009553 Ga0105249_10356176 Ga0105249_103561761 161
146 3300009553 Ga0105249_10482212 Ga0105249_104822122 161
147 3300010375 Ga0105239_10648423 Ga0105239_106484232 161
148 3300011119 Ga0105246_10126467 Ga0105246_101264672 161
149 3300013104 Ga0157370_10001360 Ga0157370_1000136021 161
150 3300013104 Ga0157370_10026601 Ga0157370_100266014 161
151 3300013105 Ga0157369_10073141 Ga0157369_100731412 161
152 3300013105 Ga0157369_10395645 Ga0157369_103956452 161
153 3300013296 Ga0157374_11478600 Ga0157374_114786001 161
154 3300013306 Ga0163162_10017947 Ga0163162_100179473 161
155 3300013306 Ga0163162_10456859 Ga0163162_104568592 161
156 3300013307 Ga0157372_10611161 Ga0157372_106111612 161
157 3300013308 Ga0157375_10312067 Ga0157375_103120672 161
158 3300013308 Ga0157375_11276391 Ga0157375_112763912 161
159 3300014325 Ga0163163_10017071 Ga0163163_100170714 161
160 3300014325 Ga0163163_10397788 Ga0163163_103977882 161
161 3300014325 Ga0163163_10524024 Ga0163163_105240242 161
162 3300014326 Ga0157380_10002880 Ga0157380_100028807 161
163 3300014326 Ga0157380_10024777 Ga0157380_100247772 161
164 3300014968 Ga0157379_10527040 Ga0157379_105270402 161
165 3300014969 Ga0157376_10540345 Ga0157376_105403452 161
166 3300025893 Ga0207682_10020850 Ga0207682_100208502 161
167 3300025900 Ga0207710_10082932 Ga0207710_100829322 161
168 3300025904 Ga0207647_10064997 Ga0207647_100649972 161
169 3300025907 Ga0207645_10016418 Ga0207645_100164184 161
170 3300025908 Ga0207643_10078025 Ga0207643_100780252 161
171 3300025912 Ga0207707_10000940 Ga0207707_1000094010 161
172 3300025912 Ga0207707_10126591 Ga0207707_101265912 161
173 3300025913 Ga0207695_10066813 Ga0207695_100668134 161
174 3300025913 Ga0207695_10115249 Ga0207695_101152492 161
175 3300025913 Ga0207695_10377336 Ga0207695_103773362 161
176 3300025914 Ga0207671_10135125 Ga0207671_101351252 161
177 3300025914 Ga0207671_10385412 Ga0207671_103854122 161
178 3300025914 Ga0207671_10460539 Ga0207671_104605392 161
179 3300025917 Ga0207660_10002352 Ga0207660_1000235210 161
180 3300025918 Ga0207662_10189322 Ga0207662_101893222 161
181 3300025921 Ga0207652_10007114 Ga0207652_100071147 161
182 3300025923 Ga0207681_11075055 Ga0207681_110750551 161
183 3300025924 Ga0207694_10050100 Ga0207694_100501003 161
184 3300025924 Ga0207694_10077790 Ga0207694_100777902 161
185 3300025924 Ga0207694_10128668 Ga0207694_101286682 161
186 3300025925 Ga0207650_10100270 Ga0207650_101002702 161
187 3300025925 Ga0207650_10129743 Ga0207650_101297431 161
188 3300025931 Ga0207644_10133618 Ga0207644_101336182 161
189 3300025932 Ga0207690_10733507 Ga0207690_107335071 161
190 3300025933 Ga0207706_10263038 Ga0207706_102630382 161
191 3300025934 Ga0207686_10427987 Ga0207686_104279872 161
192 3300025936 Ga0207670_10001235 Ga0207670_1000123513 161
193 3300025936 Ga0207670_10272475 Ga0207670_102724752 161
194 3300025940 Ga0207691_10248187 Ga0207691_102481872 161
195 3300025942 Ga0207689_10129980 Ga0207689_101299802 161
196 3300025942 Ga0207689_10173430 Ga0207689_101734302 161
197 3300025942 Ga0207689_10869260 Ga0207689_108692602 161
198 3300025945 Ga0207679_10176404 Ga0207679_101764041 161
199 3300025945 Ga0207679_10356733 Ga0207679_103567332 161
200 3300025945 Ga0207679_10489457 Ga0207679_104894571 161
201 3300025949 Ga0207667_10413246 Ga0207667_104132462 161
202 3300025960 Ga0207651_10035802 Ga0207651_100358022 161
203 3300025961 Ga0207712_10647615 Ga0207712_106476151 161
204 3300025981 Ga0207640_10146586 Ga0207640_101465862 161
205 3300025986 Ga0207658_10055832 Ga0207658_100558323 161
206 3300026035 Ga0207703_10002231 Ga0207703_1000223115 161
207 3300026067 Ga0207678_10120004 Ga0207678_101200042 161
208 3300026075 Ga0207708_10022323 Ga0207708_100223233 161
209 3300026075 Ga0207708_10144842 Ga0207708_101448422 161
210 3300026078 Ga0207702_10436950 Ga0207702_104369502 161
211 3300026078 Ga0207702_10857426 Ga0207702_108574261 161
212 3300026088 Ga0207641_10000281 Ga0207641_1000028121 161
213 3300026088 Ga0207641_10260972 Ga0207641_102609722 161
214 3300026089 Ga0207648_10132095 Ga0207648_101320951 161
215 3300026089 Ga0207648_10403300 Ga0207648_104033002 161
216 3300026089 Ga0207648_10479253 Ga0207648_104792532 161
217 3300026095 Ga0207676_10177618 Ga0207676_101776182 161
218 3300026095 Ga0207676_10370668 Ga0207676_103706682 161
219 3300026116 Ga0207674_10087623 Ga0207674_100876233 161
220 3300026118 Ga0207675_100001550 Ga0207675_10000155014 161
221 3300026118 Ga0207675_100011512 Ga0207675_1000115129 161
222 3300026118 Ga0207675_100187328 Ga0207675_1001873282 161
223 3300028379 Ga0268266_10009342 Ga0268266_100093422 161
224 3300028379 Ga0268266_10009475 Ga0268266_100094754 161
225 3300028379 Ga0268266_10169020 Ga0268266_101690202 161
226 3300028379 Ga0268266_10860401 Ga0268266_108604011 161
227 3300028380 Ga0268265_10006938 Ga0268265_100069386 161
228 3300028381 Ga0268264_10000095 Ga0268264_10000095185 161
229 3300028381 Ga0268264_10316880 Ga0268264_103168802 161
230 3300028794 Ga0307515_10095416 Ga0307515_100954163 161
231 3300031456 Ga0307513_10008271 Ga0307513_100082716 161
232 3300031456 Ga0307513_10265728 Ga0307513_102657281 161
233 3300031838 Ga0307518_10245158 Ga0307518_102451581 161
234 3300031903 Ga0307407_10136989 Ga0307407_101369892 161
235 3300032005 Ga0307411_10024128 Ga0307411_100241282 161
236 3300033179 Ga0307507_10266531 Ga0307507_102665312 161
237 3300033180 Ga0307510_10000010 Ga0307510_1000001032 161
238 3300033180 Ga0307510_10027472 Ga0307510_100274724 161
239 3300041459 Ga0451800_0995622 Ga0451800_0995622_13_546 161
240 3300041512 Ga0451853_0271959 Ga0451853_0271959_367_900 161
241 3300041512 Ga0451853_1451912 Ga0451853_1451912_625_1161 161
242 3300042530 Ga0450916_040849 Ga0450916_040849_113_646 161
243 3300044656 Ga0466969_0000260 Ga0466969_0000260_17556_18092 161
244 3300044684 Ga0466966_0015079 Ga0466966_0015079_1777_2313 161
245 3300044765 Ga0466970_0141649 Ga0466970_0141649_240_776 161
246 3300045049 Ga0466959_0004527 Ga0466959_0004527_1469_2005 161
247 3300046455 Ga0495603_0362071 Ga0495603_0362071_111_644 161
248 3300046460 Ga0495638_0011047 Ga0495638_0011047_2920_3453 161
249 3300046460 Ga0495638_0108918 Ga0495638_0108918_1006_1539 161
250 3300046461 Ga0495641_0349226 Ga0495641_0349226_34_570 161
251 3300046507 Ga0495606_0290280 Ga0495606_0290280_75_611 161
252 3300046513 Ga0495616_0004035 Ga0495616_0004035_8172_8705 161
253 3300046513 Ga0495616_0029322 Ga0495616_0029322_936_1469 161
254 3300046519 Ga0495632_0089094 Ga0495632_0089094_416_952 161
255 3300046616 Ga0495668_0156351 Ga0495668_0156351_593_1126 161
256 3300046660 Ga0495625_0045773 Ga0495625_0045773_147_680 161
257 3300046660 Ga0495625_0080297 Ga0495625_0080297_758_1294 161
258 3300046660 Ga0495625_0493415 Ga0495625_0493415_206_739 161
259 3300046694 Ga0495649_0366142 Ga0495649_0366142_73_609 161
260 3300047472 Ga0495686_0205469 Ga0495686_0205469_352_885 161
261 3300048905 Ga0496102_0006392 Ga0496102_0006392_2567_3103 161
262 3300048905 Ga0496102_0049203 Ga0496102_0049203_1537_2073 161
263 3300048906 Ga0496103_0043369 Ga0496103_0043369_2120_2656 161
264 3300048906 Ga0496103_0084875 Ga0496103_0084875_263_799 161
265 3300048908 Ga0496105_0487769 Ga0496105_0487769_209_745 161
266 3300048917 Ga0496114_1142229 Ga0496114_1142229_22_558 161
267 3300048920 Ga0496117_0000157 Ga0496117_0000157_15495_16031 161
268 3300048920 Ga0496117_0243413 Ga0496117_0243413_325_861 161
269 3300048921 Ga0496118_0000117 Ga0496118_0000117_15542_16078 161
270 3300048921 Ga0496118_0009362 Ga0496118_0009362_1581_2117 161
271 3300048922 Ga0496119_0000502 Ga0496119_0000502_29245_29781 161
272 3300048922 Ga0496119_0005405 Ga0496119_0005405_4534_5070 161
273 3300048922 Ga0496119_0026046 Ga0496119_0026046_2497_3033 161
274 3300048922 Ga0496119_0333035 Ga0496119_0333035_129_665 161
275 3300048923 Ga0496120_0001182 Ga0496120_0001182_11143_11679 161
276 3300048923 Ga0496120_0018355 Ga0496120_0018355_2537_3073 161
277 3300048924 Ga0496121_0134588 Ga0496121_0134588_741_1277 161
278 3300048924 Ga0496121_0149449 Ga0496121_0149449_427_963 161
279 3300048924 Ga0496121_0317441 Ga0496121_0317441_353_889 161
280 3300048927 Ga0496124_0179544 Ga0496124_0179544_207_743 161
281 3300048928 Ga0496125_0001312 Ga0496125_0001312_31799_32335 161
282 3300048928 Ga0496125_0023822 Ga0496125_0023822_4505_5041 161
283 3300048929 Ga0496126_0144795 Ga0496126_0144795_730_1266 161
284 3300048929 Ga0496126_0168202 Ga0496126_0168202_1020_1556 161
285 3300048929 Ga0496126_0201304 Ga0496126_0201304_569_1105 161
286 3300053092 Ga0500583_0049932 Ga0500583_0049932_111_647 161
287 3300053106 Ga0500558_074155 Ga0500558_074155_718_1254 161
288 3300053136 Ga0500559_0062481 Ga0500559_0062481_417_953 161
289 3300053727 Ga0500611_106640 Ga0500611_106640_68_601 161
290 3300059645 Ga0587076_073309 Ga0587076_073309_84_620 161
291 3300002067 JGI24735J21928_10100889 JGI24735J21928_101008891 162
292 3300003203 JGI25406J46586_10001948 JGI25406J46586_100019482 162
293 3300003322 rootL2_10227714 rootL2_102277142 162
294 3300003323 rootH1_10058926 rootH1_100589261 162
295 3300003911 JGI25405J52794_10013153 JGI25405J52794_100131532 162
296 3300004799 Ga0058863_11972227 Ga0058863_119722272 162
297 3300004803 Ga0058862_12785232 Ga0058862_127852321 162
298 3300005295 Ga0065707_10082099 Ga0065707_1008209919 162
299 3300005329 Ga0070683_100009452 Ga0070683_1000094528 162
300 3300005329 Ga0070683_100187580 Ga0070683_1001875801 162
301 3300005335 Ga0070666_10182379 Ga0070666_101823792 162
302 3300005336 Ga0070680_100025689 Ga0070680_1000256891 162
303 3300005336 Ga0070680_100314086 Ga0070680_1003140862 162
304 3300005355 Ga0070671_100002906 Ga0070671_10000290610 162
305 3300005367 Ga0070667_100096180 Ga0070667_1000961802 162
306 3300005367 Ga0070667_100121165 Ga0070667_1001211651 162
307 3300005367 Ga0070667_100445636 Ga0070667_1004456362 162
308 3300005436 Ga0070713_100005217 Ga0070713_1000052177 162
309 3300005436 Ga0070713_100714189 Ga0070713_1007141891 162
310 3300005437 Ga0070710_10054211 Ga0070710_100542112 162
311 3300005458 Ga0070681_10018916 Ga0070681_100189167 162
312 3300005458 Ga0070681_10021242 Ga0070681_100212424 162
313 3300005530 Ga0070679_100039352 Ga0070679_1000393523 162
314 3300005530 Ga0070679_100081025 Ga0070679_1000810252 162
315 3300005535 Ga0070684_100028758 Ga0070684_1000287586 162
316 3300005548 Ga0070665_100002359 Ga0070665_10000235919 162
317 3300005548 Ga0070665_100002869 Ga0070665_10000286913 162
318 3300005548 Ga0070665_100009724 Ga0070665_1000097242 162
319 3300005548 Ga0070665_100022575 Ga0070665_1000225755 162
320 3300005548 Ga0070665_100510941 Ga0070665_1005109412 162
321 3300005563 Ga0068855_100000777 Ga0068855_10000077733 162
322 3300005564 Ga0070664_100238067 Ga0070664_1002380672 162
323 3300005577 Ga0068857_100358692 Ga0068857_1003586922 162
324 3300005614 Ga0068856_100065373 Ga0068856_1000653733 162
325 3300005615 Ga0070702_100188163 Ga0070702_1001881631 162
326 3300005617 Ga0068859_100000640 Ga0068859_10000064031 162
327 3300005617 Ga0068859_100225157 Ga0068859_1002251572 162
328 3300005617 Ga0068859_100998854 Ga0068859_1009988541 162
329 3300005841 Ga0068863_100009426 Ga0068863_1000094263 162
330 3300005842 Ga0068858_100005841 Ga0068858_1000058412 162
331 3300005843 Ga0068860_100033885 Ga0068860_1000338853 162
332 3300005844 Ga0068862_100110632 Ga0068862_1001106321 162
333 3300005844 Ga0068862_100502776 Ga0068862_1005027762 162
334 3300005937 Ga0081455_10000032 Ga0081455_1000003236 162
335 3300005985 Ga0081539_10000007 Ga0081539_10000007341 162
336 3300006028 Ga0070717_10039700 Ga0070717_100397002 162
337 3300006195 Ga0075366_10304734 Ga0075366_103047342 162
338 3300006237 Ga0097621_100025111 Ga0097621_1000251112 162
339 3300006358 Ga0068871_100159183 Ga0068871_1001591832 162
340 3300006844 Ga0075428_101590781 Ga0075428_1015907812 162
341 3300006931 Ga0097620_100000640 Ga0097620_10000064031 162
342 3300006931 Ga0097620_100225143 Ga0097620_1002251432 162
343 3300006931 Ga0097620_100998689 Ga0097620_1009986892 162
344 3300009092 Ga0105250_10142626 Ga0105250_101426262 162
345 3300009093 Ga0105240_10000924 Ga0105240_1000092411 162
346 3300009093 Ga0105240_10035511 Ga0105240_100355116 162
347 3300009093 Ga0105240_10093982 Ga0105240_100939821 162
348 3300009093 Ga0105240_10283008 Ga0105240_102830082 162
349 3300009101 Ga0105247_10000151 Ga0105247_1000015131 162
350 3300009177 Ga0105248_10413860 Ga0105248_104138602 162
351 3300009545 Ga0105237_10011349 Ga0105237_100113494 162
352 3300009545 Ga0105237_10026319 Ga0105237_100263195 162
353 3300009545 Ga0105237_10297953 Ga0105237_102979532 162
354 3300009545 Ga0105237_10375537 Ga0105237_103755371 162
355 3300009545 Ga0105237_10439988 Ga0105237_104399882 162
356 3300009551 Ga0105238_10027167 Ga0105238_100271674 162
357 3300009553 Ga0105249_10021699 Ga0105249_100216993 162
358 3300009553 Ga0105249_10026206 Ga0105249_100262062 162
359 3300010159 Ga0099796_10020163 Ga0099796_100201632 162
360 3300010375 Ga0105239_10308419 Ga0105239_103084192 162
361 3300013105 Ga0157369_10152670 Ga0157369_101526702 162
362 3300013296 Ga0157374_10614312 Ga0157374_106143121 162
363 3300013296 Ga0157374_11984624 Ga0157374_119846241 162
364 3300014325 Ga0163163_10009797 Ga0163163_100097976 162
365 3300014325 Ga0163163_10140992 Ga0163163_101409923 162
366 3300014968 Ga0157379_10028619 Ga0157379_100286193 162
367 3300014968 Ga0157379_10032180 Ga0157379_100321804 162
368 3300014968 Ga0157379_10129786 Ga0157379_101297862 162
369 3300014968 Ga0157379_10861762 Ga0157379_108617621 162
370 3300021358 Ga0213873_10123994 Ga0213873_101239941 162
371 3300021377 Ga0213874_10005073 Ga0213874_100050733 162
372 3300021384 Ga0213876_10040203 Ga0213876_100402031 162
373 3300021441 Ga0213871_10014669 Ga0213871_100146692 162
374 3300025711 Ga0207696_1073772 Ga0207696_10737722 162
375 3300025900 Ga0207710_10000845 Ga0207710_1000084510 162
376 3300025903 Ga0207680_10225687 Ga0207680_102256872 162
377 3300025903 Ga0207680_10251050 Ga0207680_102510502 162
378 3300025906 Ga0207699_10039023 Ga0207699_100390232 162
379 3300025906 Ga0207699_10210341 Ga0207699_102103411 162
380 3300025912 Ga0207707_10424743 Ga0207707_104247432 162
381 3300025912 Ga0207707_10627711 Ga0207707_106277112 162
382 3300025913 Ga0207695_10019074 Ga0207695_100190743 162
383 3300025913 Ga0207695_10087128 Ga0207695_100871282 162
384 3300025913 Ga0207695_10131207 Ga0207695_101312073 162
385 3300025913 Ga0207695_10366976 Ga0207695_103669762 162
386 3300025914 Ga0207671_10176655 Ga0207671_101766552 162
387 3300025917 Ga0207660_10147678 Ga0207660_101476783 162
388 3300025921 Ga0207652_10063758 Ga0207652_100637583 162
389 3300025924 Ga0207694_10225068 Ga0207694_102250682 162
390 3300025928 Ga0207700_10037938 Ga0207700_100379381 162
391 3300025929 Ga0207664_11195284 Ga0207664_111952841 162
392 3300025944 Ga0207661_10067170 Ga0207661_100671702 162
393 3300025944 Ga0207661_10090430 Ga0207661_100904301 162
394 3300025945 Ga0207679_10893724 Ga0207679_108937242 162
395 3300025949 Ga0207667_10002266 Ga0207667_1000226611 162
396 3300025961 Ga0207712_10015561 Ga0207712_100155612 162
397 3300025961 Ga0207712_10666260 Ga0207712_106662602 162
398 3300025986 Ga0207658_10040526 Ga0207658_100405262 162
399 3300025986 Ga0207658_10108131 Ga0207658_101081312 162
400 3300026035 Ga0207703_10085244 Ga0207703_100852442 162
401 3300026035 Ga0207703_10572572 Ga0207703_105725721 162
402 3300026078 Ga0207702_10314266 Ga0207702_103142662 162
403 3300026088 Ga0207641_10126889 Ga0207641_101268892 162
404 3300026118 Ga0207675_100036315 Ga0207675_1000363155 162
405 3300028023 Ga0265357_1003182 Ga0265357_10031822 162
406 3300028379 Ga0268266_10001031 Ga0268266_1000103133 162
407 3300028379 Ga0268266_10006128 Ga0268266_100061288 162
408 3300028379 Ga0268266_10009611 Ga0268266_100096115 162
409 3300028379 Ga0268266_10134622 Ga0268266_101346222 162
410 3300028380 Ga0268265_10354055 Ga0268265_103540552 162
411 3300028380 Ga0268265_10837977 Ga0268265_108379772 162
412 3300028573 Ga0265334_10079214 Ga0265334_100792142 162
413 3300028794 Ga0307515_10072464 Ga0307515_100724642 162
414 3300028794 Ga0307515_10086231 Ga0307515_100862313 162
415 3300030521 Ga0307511_10002379 Ga0307511_100023795 162
416 3300031240 Ga0265320_10025296 Ga0265320_100252962 162
417 3300031249 Ga0265339_10062319 Ga0265339_100623192 162
418 3300031250 Ga0265331_10018020 Ga0265331_100180204 162
419 3300031250 Ga0265331_10200419 Ga0265331_102004192 162
420 3300031456 Ga0307513_10022248 Ga0307513_100222482 162
421 3300031456 Ga0307513_10224812 Ga0307513_102248121 162
422 3300031507 Ga0307509_10000084 Ga0307509_1000008487 162
423 3300031616 Ga0307508_10340728 Ga0307508_103407281 162
424 3300035113 Ga0373936_0009487 Ga0373936_0009487_1433_1972 162
425 3300035119 Ga0373956_0006684 Ga0373956_0006684_293_832 162
426 3300035724 Ga0373933_0493274 Ga0373933_0493274_21_560 162
427 3300036401 Ga0373937_0026876 Ga0373937_0026876_3807_4346 162
428 3300036401 Ga0373937_0155514 Ga0373937_0155514_1391_1936 162
429 3300037466 Ga0395898_0301882 Ga0395898_0301882_470_1018 162
430 3300037853 Ga0436364_0076894 Ga0436364_0076894_131_700 162
431 3300037853 Ga0436364_1515784 Ga0436364_1515784_55_594 162
432 3300039437 Ga0436365_0602547 Ga0436365_0602547_2328_2867 162
433 3300039437 Ga0436365_0704320 Ga0436365_0704320_14_553 162
434 3300039437 Ga0436365_0926236 Ga0436365_0926236_315_854 162
435 3300039438 Ga0436360_0651768 Ga0436360_0651768_2725_3264 162
436 3300039438 Ga0436360_0710363 Ga0436360_0710363_283_822 162
437 3300039438 Ga0436360_0716812 Ga0436360_0716812_439_1008 162
438 3300039438 Ga0436360_0898563 Ga0436360_0898563_1420_1959 162
439 3300039447 Ga0436361_0702717 Ga0436361_0702717_289_828 162
440 3300039447 Ga0436361_0754665 Ga0436361_0754665_4630_5169 162
441 3300039450 Ga0436363_0508371 Ga0436363_0508371_6601_7140 162
442 3300039450 Ga0436363_0748181 Ga0436363_0748181_5852_6391 162
443 3300039450 Ga0436363_1102673 Ga0436363_1102673_22_561 162
444 3300041486 Ga0451807_1817092 Ga0451807_1817092_1567_2112 162
445 3300044656 Ga0466969_0006527 Ga0466969_0006527_4119_4718 162
446 3300044656 Ga0466969_0051551 Ga0466969_0051551_148_687 162
447 3300044658 Ga0466972_0054285 Ga0466972_0054285_632_1171 162
448 3300044684 Ga0466966_0010660 Ga0466966_0010660_3317_3916 162
449 3300044693 Ga0466961_0001164 Ga0466961_0001164_10265_10864 162
450 3300044706 Ga0466964_0000142 Ga0466964_0000142_3272_3871 162
451 3300044719 Ga0466971_0000830 Ga0466971_0000830_5137_5736 162
452 3300044765 Ga0466970_0004977 Ga0466970_0004977_849_1448 162
453 3300045049 Ga0466959_0044773 Ga0466959_0044773_1995_2594 162
454 3300045049 Ga0466959_0046775 Ga0466959_0046775_2351_2890 162
455 3300045049 Ga0466959_0129610 Ga0466959_0129610_723_1271 162
456 3300045049 Ga0466959_0148419 Ga0466959_0148419_1033_1572 162
457 3300045049 Ga0466959_0769402 Ga0466959_0769402_14_553 162
458 3300045836 Ga0466958_0241926 Ga0466958_0241926_273_872 162
459 3300046472 Ga0495580_0539696 Ga0495580_0539696_144_683 162
460 3300046519 Ga0495632_0020636 Ga0495632_0020636_1871_2410 162
461 3300046519 Ga0495632_0097115 Ga0495632_0097115_43_582 162
462 3300048903 Ga0496100_0083303 Ga0496100_0083303_590_1129 162
463 3300048905 Ga0496102_0109390 Ga0496102_0109390_330_869 162
464 3300048908 Ga0496105_0447640 Ga0496105_0447640_338_877 162
465 3300048911 Ga0496108_0366176 Ga0496108_0366176_323_862 162
466 3300048915 Ga0496112_0159325 Ga0496112_0159325_626_1165 162
467 3300048924 Ga0496121_0065315 Ga0496121_0065315_1796_2335 162
468 3300048928 Ga0496125_0027318 Ga0496125_0027318_1310_1849 162
469 3300048928 Ga0496125_0247855 Ga0496125_0247855_38_583 162
470 3300048929 Ga0496126_0004205 Ga0496126_0004205_2524_3063 162
471 3300048929 Ga0496126_0100215 Ga0496126_0100215_1133_1672 162
472 3300048929 Ga0496126_0111636 Ga0496126_0111636_879_1418 162
473 3300048929 Ga0496126_0245689 Ga0496126_0245689_15_623 162
474 3300049823 Ga0501044_1058902 Ga0501044_1058902_100_639 162
475 3300050512 nmdc:mga0n895_1312910_c1 nmdc:mga0n895_1312910_c1_131_670 162
476 3300053092 Ga0500583_0033451 Ga0500583_0033451_1248_1787 162
477 3300053096 Ga0500641_0017961 Ga0500641_0017961_638_1177 162
478 3300053096 Ga0500641_0118612 Ga0500641_0118612_565_1104 162
479 3300053096 Ga0500641_0160072 Ga0500641_0160072_205_744 162
480 3300053104 Ga0500556_0010765 Ga0500556_0010765_1759_2298 162
481 3300053124 Ga0500617_003799 Ga0500617_003799_2412_2951 162
482 3300053131 Ga0500652_131791 Ga0500652_131791_120_659 162
483 3300053136 Ga0500559_0147361 Ga0500559_0147361_406_945 162
484 3300053142 Ga0500577_0312126 Ga0500577_0312126_22_561 162
485 3300053143 Ga0500579_199993 Ga0500579_199993_107_646 162
486 3300053146 Ga0500588_0000938 Ga0500588_0000938_2968_3507 162
487 3300053153 Ga0500616_0000062 Ga0500616_0000062_225989_226528 162
488 3300053153 Ga0500616_0021031 Ga0500616_0021031_1632_2171 162
489 3300053156 Ga0500622_0009628 Ga0500622_0009628_3884_4423 162
490 3300053163 Ga0500639_096314 Ga0500639_096314_738_1277 162
491 3300053178 Ga0500637_0001136 Ga0500637_0001136_3136_3675 162
492 3300053178 Ga0500637_0049721 Ga0500637_0049721_1305_1844 162
493 3300053178 Ga0500637_0097634 Ga0500637_0097634_516_1124 162
494 3300053178 Ga0500637_0253844 Ga0500637_0253844_176_715 162
495 3300053732 Ga0500656_011735 Ga0500656_011735_77_616 162
496 3300059508 Ga0587088_050464 Ga0587088_050464_226_771 162
497 3300061719 Ga0466962_0002832 Ga0466962_0002832_2174_2773 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01569

PAP2

PAP2 superfamily

87

200

0.91

PF14378

PAP2_3

PAP2 superfamily

58

196

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w36-assembly1.cif.gz_A crystal structure of holo-type bacterial vanadium-dependent chloroperoxidase 0.7765 95 157
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.7631 6 159
8bm3-assembly4.cif.gz_D h207a mutant of e. coli pgpb, a pap2 type phosphatidyl glycerol phosphate and c55-pp phosphatase, in complex with farnesyl pyrophosphate 0.7367 5 160
5jki-assembly1.cif.gz_A crystal structure of the first transmembrane pap2 type phosphatidylglycerolphosphate phosphatase from bacillus subtilis 0.7243 7 160
8bm3-assembly4.cif.gz_D h207a mutant of e. coli pgpb, a pap2 type phosphatidyl glycerol phosphate and c55-pp phosphatase, in complex with farnesyl pyrophosphate 0.7127 5 160
ID Description Score Start End Superfamily
af_A0A0R4IR05_291_364_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8786 95 153 1.20.144.10
af_Q7X8A2_297_367_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.878 91 156 1.20.144.10
af_Q965Q4_174_247_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8778 95 156 1.20.144.10
af_Q4JM44_220_293_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8771 95 153 1.20.144.10
af_A0A0N7KFG1_1_446_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.8691 93 157 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A257NXZ4-F1-model_v4 undecaprenyl-diphosphate phosphatase (EC 3.6.1.27) (Undecaprenyl pyrophosphate phosphatase) 0.8711 17 160 GO:0016020
AF-A0A259BCS4-F1-model_v4 undecaprenyl-diphosphate phosphatase (EC 3.6.1.27) (Undecaprenyl pyrophosphate phosphatase) 0.8693 17 160 GO:0016020
AF-A0A1Y5H134-F1-model_v4 undecaprenyl-diphosphate phosphatase (EC 3.6.1.27) (Undecaprenyl pyrophosphate phosphatase) 0.8657 17 160 GO:0016020
AF-A0A1Z7YSV7-F1-model_v4 undecaprenyl-diphosphate phosphatase (EC 3.6.1.27) (Undecaprenyl pyrophosphate phosphatase) 0.8648 16 160 GO:0016020
AF-A0A2S5T483-F1-model_v4 Phosphatase PAP2 family protein (Undecaprenyl-diphosphatase) 0.8641 14 161 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.88 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map