F455087

General Info

Members Datasets Scaffolds Average Seq Length
497 379 994 144

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0090262|Ga0495588_0090262_265_699
Length 144
Sequence METVNPATTAWTRDSVTVEKRDVWTAMKRGFASRCPRCGKGKLFRAFLKVDDHCSECGLDFTPHRADDLPAYLVIVGHIVVPTALWIETNYSPAVWLQLSIYLPFTFIASLALLQPVKGAVVGLQWALRMHGFDEHGADDIAPG

Samples

Sample ID Description Type Environment
1 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
105 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
106 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
107 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
140 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
141 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
142 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
143 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
144 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
249 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
250 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
251 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
255 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
260 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
261 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
262 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
263 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
264 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
265 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
266 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
267 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
268 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
269 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
273 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
274 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
275 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
276 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
277 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
278 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
279 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
280 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
281 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
282 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
283 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
284 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
285 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
286 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
287 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
288 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
289 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
290 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
291 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
292 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
293 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
294 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
295 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
296 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
297 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
298 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
299 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
300 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
301 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
302 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
303 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
304 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
305 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
306 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
307 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
308 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
309 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
310 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
311 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
312 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
313 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
314 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
315 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
316 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
317 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
318 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
319 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
320 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
321 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
322 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
323 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
324 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
325 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
326 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
327 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
328 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
329 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
330 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
331 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
332 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
333 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
334 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
335 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
336 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
337 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
338 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
339 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
340 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
341 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
342 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
343 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
344 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
345 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
346 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
347 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
348 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
349 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
350 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
351 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
352 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
353 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
354 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
355 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
356 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
357 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
358 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
359 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
360 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
361 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
362 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
363 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
364 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
365 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
366 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
367 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
368 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
369 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
370 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
371 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
372 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
373 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
374 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
375 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
376 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
377 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
378 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
379 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.07
Metatranscriptomes 0.2
Isolates 21.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.49
Nodule 17.51
Rhizoplane 5.03
Rhizosphere 52.31
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495588_0090262 3300046674 Bacteria 1605
2 JGI25165J46597_1011926 3300003214 Bacteria 1228
3 JGI25153J46596_10004942 3300003215 Bacteria 7085
4 JGI25160J50197_1001994 3300003354 Bacteria 9742
5 Ga0055542_1003986 3300003762 Bacteria 3753
6 Ga0055531_10011335 3300003794 Bacteria 4315
7 Ga0055531_10017361 3300003794 Bacteria 3043
8 JGI25405J52794_10017454 3300003911 Bacteria 1425
9 Ga0055543_1001961 3300004625 Bacteria 7328
10 Ga0065165_1001623 3300005262 Bacteria 22903
11 Ga0065165_1010370 3300005262 Bacteria 4040
12 Ga0065165_1022952 3300005262 Bacteria 2126
13 Ga0070658_10160243 3300005327 Bacteria 1887
14 Ga0070671_101012969 3300005355 Bacteria 728
15 Ga0070709_10002626 3300005434 Bacteria 9703
16 Ga0070714_100012170 3300005435 Bacteria 6857
17 Ga0070713_100013925 3300005436 Bacteria 5954
18 Ga0070713_100238132 3300005436 Bacteria 1656
19 Ga0070713_100334507 3300005436 Bacteria 1402
20 Ga0070710_10001750 3300005437 Bacteria 10274
21 Ga0070710_10206926 3300005437 Bacteria 1242
22 Ga0070710_10735489 3300005437 Bacteria 699
23 Ga0070711_100004679 3300005439 Bacteria 8102
24 Ga0070708_100243735 3300005445 Bacteria 1688
25 Ga0070706_100387150 3300005467 Bacteria 1302
26 Ga0070706_100398546 3300005467 Unclassified 1281
27 Ga0070698_100560727 3300005471 Bacteria 1082
28 Ga0070699_100905768 3300005518 Bacteria 808
29 Ga0070684_100101115 3300005535 Bacteria 2575
30 Ga0070697_100108207 3300005536 Bacteria 2314
31 Ga0070697_100222758 3300005536 Bacteria 1608
32 Ga0068853_100136142 3300005539 Bacteria 2202
33 Ga0068853_100148325 3300005539 Bacteria 2110
34 Ga0068855_100713705 3300005563 Bacteria 1072
35 Ga0068857_100127826 3300005577 Bacteria 2290
36 Ga0068854_101124355 3300005578 Bacteria 701
37 Ga0068856_101008541 3300005614 Bacteria 851
38 Ga0068852_100120244 3300005616 Bacteria 2403
39 Ga0068852_101360931 3300005616 Bacteria 732
40 Ga0068859_100129767 3300005617 Bacteria 2592
41 Ga0068866_10231903 3300005718 Bacteria 1120
42 Ga0068863_100074152 3300005841 Bacteria 3219
43 Ga0068858_100558360 3300005842 Bacteria 1109
44 Ga0068860_100084760 3300005843 Bacteria 3014
45 Ga0081455_10026268 3300005937 Bacteria 5361
46 Ga0081540_1160280 3300005983 Bacteria 874
47 Ga0081540_1192803 3300005983 Bacteria 749
48 Ga0070717_11718919 3300006028 Bacteria 568
49 Ga0075365_10069838 3300006038 Bacteria 2361
50 Ga0075364_10226155 3300006051 Bacteria 1270
51 Ga0075432_10238115 3300006058 Bacteria 734
52 Ga0070715_10000266 3300006163 Bacteria 12656
53 Ga0070716_100003732 3300006173 Bacteria 7210
54 Ga0070716_100079385 3300006173 Bacteria 1954
55 Ga0070716_100114536 3300006173 Bacteria 1677
56 Ga0070716_100237628 3300006173 Bacteria 1234
57 Ga0070716_100364957 3300006173 Bacteria 1027
58 Ga0070712_100044663 3300006175 Bacteria 3056
59 Ga0070712_100061062 3300006175 Bacteria 2661
60 Ga0070712_100225413 3300006175 Bacteria 1486
61 Ga0075362_10244279 3300006177 Bacteria 882
62 Ga0075367_10414211 3300006178 Bacteria 853
63 Ga0075369_10058327 3300006186 Bacteria 1681
64 Ga0075369_10100118 3300006186 Bacteria 1300
65 Ga0075370_10249034 3300006353 Bacteria 1053
66 Ga0075370_10411725 3300006353 Bacteria 812
67 Ga0068871_100605711 3300006358 Bacteria 997
68 Ga0097620_100129761 3300006931 Bacteria 2592
69 Ga0099824_1018161 3300006942 Bacteria 5854
70 Ga0099794_10111793 3300007265 Bacteria 1369
71 Ga0099795_10075483 3300007788 Bacteria 1280
72 Ga0105240_10039339 3300009093 Bacteria 6057
73 Ga0105245_10596251 3300009098 Bacteria 1131
74 Ga0105247_10020110 3300009101 Bacteria 4013
75 Ga0105241_10519248 3300009174 Bacteria 1065
76 Ga0105237_10551823 3300009545 Bacteria 1159
77 Ga0099796_10016025 3300010159 Bacteria 2205
78 Ga0099796_10047165 3300010159 Bacteria 1482
79 Ga0105239_10204235 3300010375 Bacteria 2214
80 Ga0105239_10387766 3300010375 Bacteria 1580
81 Ga0105239_10782580 3300010375 Bacteria 1093
82 Ga0105239_11796806 3300010375 Bacteria 710
83 Ga0157371_10265721 3300013102 Bacteria 1237
84 Ga0157370_10120891 3300013104 Bacteria 2445
85 Ga0157370_10612567 3300013104 Bacteria 996
86 Ga0157369_11162095 3300013105 Bacteria 788
87 Ga0157378_11604432 3300013297 Bacteria 696
88 Ga0163162_10223195 3300013306 Bacteria 2014
89 Ga0157372_10037018 3300013307 Bacteria 5380
90 Ga0163163_12882054 3300014325 Bacteria 537
91 Ga0206350_10299931 3300020080 Bacteria 848
92 Ga0209148_1000493 3300025254 Bacteria 40546
93 Ga0209233_1008850 3300025261 Bacteria 3087
94 Ga0209233_1009635 3300025261 Bacteria 2932
95 Ga0209233_1023600 3300025261 Bacteria 1555
96 Ga0209564_1031054 3300025295 Bacteria 1641
97 Ga0209758_1000100 3300025297 Bacteria 227948
98 Ga0209758_1001732 3300025297 Bacteria 24300
99 Ga0209758_1002189 3300025297 Bacteria 20469
100 Ga0209758_1058778 3300025297 Bacteria 1283
101 Ga0209256_1002940 3300025299 Bacteria 12791
102 Ga0209256_1036264 3300025299 Bacteria 1295
103 Ga0207426_1000382 3300025302 Bacteria 76034
104 Ga0207426_1065160 3300025302 Bacteria 1034
105 Ga0209051_1078665 3300025303 Bacteria 960
106 Ga0209257_1001443 3300025304 Bacteria 28086
107 Ga0209257_1048923 3300025304 Bacteria 1207
108 Ga0207692_10158341 3300025898 Bacteria 1303
109 Ga0207692_10567348 3300025898 Bacteria 727
110 Ga0207642_10148801 3300025899 Bacteria 1244
111 Ga0207710_10019276 3300025900 Bacteria 2910
112 Ga0207647_10272812 3300025904 Bacteria 967
113 Ga0207699_10005962 3300025906 Bacteria 5865
114 Ga0207699_10109450 3300025906 Bacteria 1768
115 Ga0207705_10113969 3300025909 Bacteria 2000
116 Ga0207684_10117761 3300025910 Bacteria 2276
117 Ga0207684_10169978 3300025910 Bacteria 1879
118 Ga0207684_11261461 3300025910 Unclassified 610
119 Ga0207707_10663465 3300025912 Bacteria 878
120 Ga0207707_10682882 3300025912 Bacteria 863
121 Ga0207693_10001357 3300025915 Bacteria 21659
122 Ga0207693_10022673 3300025915 Bacteria 4988
123 Ga0207693_10047889 3300025915 Bacteria 3358
124 Ga0207663_10005723 3300025916 Bacteria 6288
125 Ga0207663_10408156 3300025916 Bacteria 1040
126 Ga0207663_10947603 3300025916 Bacteria 689
127 Ga0207657_10218263 3300025919 Bacteria 1529
128 Ga0207687_10136105 3300025927 Bacteria 1858
129 Ga0207700_10223629 3300025928 Bacteria 1597
130 Ga0207700_10274706 3300025928 Bacteria 1447
131 Ga0207700_10295245 3300025928 Bacteria 1398
132 Ga0207664_10216751 3300025929 Bacteria 1658
133 Ga0207664_10827719 3300025929 Bacteria 832
134 Ga0207644_10544581 3300025931 Bacteria 960
135 Ga0207704_10603806 3300025938 Bacteria 899
136 Ga0207665_10006211 3300025939 Bacteria 7935
137 Ga0207665_10018185 3300025939 Bacteria 4618
138 Ga0207665_10076546 3300025939 Bacteria 2295
139 Ga0207665_10133785 3300025939 Bacteria 1762
140 Ga0207665_10604348 3300025939 Bacteria 857
141 Ga0207665_11478167 3300025939 Bacteria 540
142 Ga0207661_10382615 3300025944 Bacteria 1274
143 Ga0207667_10410821 3300025949 Bacteria 1378
144 Ga0207667_10418204 3300025949 Bacteria 1364
145 Ga0207667_10458318 3300025949 Bacteria 1295
146 Ga0207667_11248007 3300025949 Bacteria 721
147 Ga0207640_10310611 3300025981 Bacteria 1251
148 Ga0207640_11211682 3300025981 Bacteria 671
149 Ga0207658_10503801 3300025986 Bacteria 1079
150 Ga0207639_10416798 3300026041 Bacteria 1213
151 Ga0207678_10180439 3300026067 Bacteria 1803
152 Ga0207678_10743036 3300026067 Bacteria 865
153 Ga0207678_10807494 3300026067 Bacteria 828
154 Ga0207702_10265697 3300026078 Bacteria 1617
155 Ga0207702_10595596 3300026078 Bacteria 1084
156 Ga0207641_10041261 3300026088 Bacteria 3867
157 Ga0207641_10251826 3300026088 Bacteria 1650
158 Ga0207648_10259200 3300026089 Bacteria 1551
159 Ga0207676_11142872 3300026095 Bacteria 771
160 Ga0207674_11077219 3300026116 Bacteria 773
161 Ga0207698_10044419 3300026142 Bacteria 3339
162 Ga0209389_1000068 3300027296 Bacteria 98954
163 Ga0209389_1000092 3300027296 Bacteria 82555
164 Ga0209589_1000115 3300027357 Bacteria 82537
165 Ga0209489_100340 3300027361 Bacteria 82555
166 Ga0209489_113471 3300027361 Bacteria 6562
167 Ga0209700_100117 3300027363 Bacteria 115595
168 Ga0268264_10000084 3300028381 Bacteria 242128
169 Ga0265334_10090155 3300028573 Bacteria 1119
170 Ga0265330_10153369 3300031235 Bacteria 979
171 Ga0265340_10080673 3300031247 Bacteria 1532
172 Ga0265339_10241466 3300031249 Bacteria 877
173 Ga0265316_11054934 3300031344 Bacteria 564
174 Ga0307508_10476238 3300031616 Bacteria 842
175 Ga0265314_10055914 3300031711 Bacteria 2720
176 Ga0265314_10075131 3300031711 Bacteria 2249
177 Ga0265342_10002241 3300031712 Bacteria 16904
178 Ga0265342_10268689 3300031712 Bacteria 905
179 Ga0307516_10042765 3300031730 Bacteria 4492
180 Ga0307516_10193479 3300031730 Bacteria 1758
181 Ga0315911_1000029 3300033442 Bacteria 82350
182 Ga0373923_0018900 3300035111 Bacteria 2660
183 Ga0373936_0074159 3300035113 Bacteria 1407
184 Ga0373953_0000640 3300035117 Bacteria 9722
185 Ga0373954_0000067 3300035118 Bacteria 37060
186 Ga0373956_0011308 3300035119 Bacteria 3676
187 Ga0373956_0292302 3300035119 Bacteria 776
188 Ga0373957_0099573 3300035120 Bacteria 1162
189 Ga0373957_0313304 3300035120 Bacteria 667
190 Ga0373955_0003543 3300035172 Bacteria 6870
191 Ga0373924_0079468 3300035410 Bacteria 1393
192 Ga0373931_0186689 3300035691 Bacteria 1231
193 Ga0373935_0671431 3300035692 Bacteria 761
194 Ga0373935_1043958 3300035692 Bacteria 608
195 Ga0373927_0015767 3300035695 Bacteria 4987
196 Ga0373927_0030629 3300035695 Bacteria 3510
197 Ga0373933_0004250 3300035724 Bacteria 7887
198 Ga0373933_0147723 3300035724 Bacteria 1487
199 Ga0373947_0042436 3300035725 Bacteria 2715
200 Ga0373947_0043170 3300035725 Bacteria 2693
201 Ga0373937_0014291 3300036401 Bacteria 7006
202 Ga0373925_0154139 3300037068 Bacteria 1806
203 Ga0395900_0496805 3300037418 Bacteria 1171
204 Ga0395905_0002179 3300037471 Bacteria 22137
205 Ga0436364_1334658 3300037853 Bacteria 1328
206 Ga0436364_1473104 3300037853 Bacteria 4659
207 Ga0395901_0038765 3300038443 Bacteria 4929
208 Ga0395901_0204896 3300038443 Bacteria 2067
209 Ga0436365_0261035 3300039437 Bacteria 1882
210 Ga0436365_0400373 3300039437 Bacteria 1950
211 Ga0436365_0746238 3300039437 Bacteria 576
212 Ga0436365_0949535 3300039437 Bacteria 1342
213 Ga0436365_1843246 3300039437 Bacteria 4333
214 Ga0451791_0682776 3300041451 Bacteria 1150
215 Ga0451797_1097118 3300041453 Bacteria 1020
216 Ga0451795_1528108 3300041456 Bacteria 711
217 Ga0451833_0045373 3300041491 Bacteria 1006
218 Ga0451835_0920193 3300041492 Bacteria 738
219 Ga0451841_1267291 3300041498 Bacteria 753
220 Ga0451853_0785409 3300041512 Bacteria 565
221 Ga0466961_0392386 3300044693 Bacteria 843
222 Ga0466964_0541209 3300044706 Bacteria 631
223 Ga0466964_0822891 3300044706 Bacteria 526
224 Ga0466968_0678949 3300044735 Bacteria 525
225 Ga0466957_1329646 3300044842 Bacteria 522
226 Ga0466959_0009099 3300045049 Bacteria 7051
227 Ga0466959_0063375 3300045049 Bacteria 2685
228 Ga0466967_0051109 3300045976 Bacteria 3621
229 Ga0466967_0170044 3300045976 Bacteria 2050
230 Ga0495592_0001030 3300046454 Bacteria 19355
231 Ga0495603_0036924 3300046455 Bacteria 2932
232 Ga0495629_0000398 3300046459 Bacteria 36605
233 Ga0495638_0296449 3300046460 Bacteria 873
234 Ga0495641_0154769 3300046461 Bacteria 1025
235 Ga0495651_0004166 3300046462 Bacteria 11071
236 Ga0495653_0000598 3300046463 Bacteria 27691
237 Ga0495580_0188870 3300046472 Bacteria 1421
238 Ga0495582_0270670 3300046473 Bacteria 975
239 Ga0495605_0307942 3300046474 Bacteria 669
240 Ga0495584_0443057 3300046491 Bacteria 660
241 Ga0495585_0099244 3300046492 Bacteria 1559
242 Ga0495608_0004383 3300046511 Bacteria 10114
243 Ga0495628_0030305 3300046516 Bacteria 4381
244 Ga0495630_1471932 3300046517 Bacteria 511
245 Ga0495648_0000552 3300046524 Bacteria 40192
246 Ga0495652_0009435 3300046529 Bacteria 8863
247 Ga0495640_0021304 3300046533 Bacteria 4759
248 Ga0495587_0018340 3300046536 Bacteria 4340
249 Ga0495645_0265239 3300046543 Bacteria 1135
250 Ga0495622_0298596 3300046557 Bacteria 702
251 Ga0495667_0000305 3300046559 Bacteria 31224
252 Ga0495656_0231953 3300046615 Bacteria 926
253 Ga0495634_0012910 3300046642 Bacteria 6045
254 Ga0495611_0415209 3300046648 Bacteria 614
255 Ga0495635_0000102 3300046663 Bacteria 50623
256 Ga0495659_0035265 3300046664 Bacteria 1762
257 Ga0495661_0561748 3300046665 Bacteria 539
258 Ga0495657_0000677 3300046675 Bacteria 30671
259 Ga0495657_0639832 3300046675 Bacteria 614
260 Ga0495599_0001882 3300046678 Bacteria 12160
261 Ga0495623_0149011 3300046679 Bacteria 1384
262 Ga0495646_0005928 3300046680 Bacteria 7744
263 Ga0495613_0024285 3300046689 Bacteria 4516
264 Ga0495589_0097177 3300046794 Bacteria 1427
265 Ga0495600_0041727 3300046809 Bacteria 2990
266 Ga0495604_0001099 3300047317 Bacteria 22454
267 Ga0495674_0013937 3300047319 Bacteria 7542
268 Ga0495676_0092277 3300047321 Bacteria 2261
269 Ga0495680_0018405 3300047322 Bacteria 5932
270 Ga0495675_0024914 3300047444 Bacteria 3816
271 Ga0495684_0000088 3300047471 Bacteria 64704
272 Ga0495593_0009454 3300047673 Bacteria 5657
273 Ga0495602_0028311 3300048088 Bacteria 5364
274 Ga0496100_1495014 3300048903 Bacteria 533
275 Ga0496101_0041445 3300048904 Bacteria 3283
276 Ga0496101_0229452 3300048904 Bacteria 1443
277 Ga0496104_0079709 3300048907 Bacteria 3121
278 Ga0496107_0247583 3300048910 Bacteria 1326
279 Ga0496107_0680827 3300048910 Bacteria 757
280 Ga0496107_1173378 3300048910 Bacteria 553
281 Ga0496108_0195566 3300048911 Bacteria 1754
282 Ga0496108_0583812 3300048911 Bacteria 974
283 Ga0496109_0386912 3300048912 Bacteria 1321
284 Ga0496109_0526158 3300048912 Bacteria 1116
285 Ga0496110_0682535 3300048913 Bacteria 928
286 Ga0496110_0713931 3300048913 Bacteria 904
287 Ga0496110_1048522 3300048913 Bacteria 723
288 Ga0496111_0034791 3300048914 Bacteria 3598
289 Ga0496111_1129770 3300048914 Bacteria 557
290 Ga0496112_0089547 3300048915 Bacteria 3045
291 Ga0496113_0087190 3300048916 Bacteria 2399
292 Ga0496114_0123838 3300048917 Bacteria 2226
293 Ga0496115_0021991 3300048918 Bacteria 4933
294 Ga0496115_0033726 3300048918 Bacteria 4043
295 Ga0496115_1449740 3300048918 Bacteria 505
296 Ga0496118_0170454 3300048921 Bacteria 1331
297 Ga0496121_0023336 3300048924 Bacteria 5962
298 Ga0496121_0219095 3300048924 Bacteria 1342
299 Ga0496121_0382686 3300048924 Bacteria 927
300 Ga0496124_0107198 3300048927 Bacteria 2255
301 Ga0496125_0137981 3300048928 Bacteria 1702
302 Ga0496125_0193470 3300048928 Bacteria 1340
303 Ga0496126_0041919 3300048929 Bacteria 4232
304 Ga0496126_0069725 3300048929 Bacteria 3135
305 Ga0496126_0099408 3300048929 Bacteria 2548
306 Ga0496126_0255261 3300048929 Bacteria 1459
307 Ga0501031_0000620 3300049568 Bacteria 20973
308 Ga0501032_0003195 3300049569 Bacteria 12615
309 Ga0501032_0067877 3300049569 Bacteria 2381
310 Ga0501033_0000241 3300049570 Bacteria 52500
311 Ga0501033_0371109 3300049570 Bacteria 1000
312 Ga0501034_0000021 3300049571 Bacteria 266023
313 Ga0501034_0156939 3300049571 Bacteria 2249
314 Ga0501036_0000055 3300049572 Bacteria 73738
315 Ga0501037_0000398 3300049573 Bacteria 36170
316 Ga0501037_0054358 3300049573 Bacteria 2928
317 Ga0501038_0001235 3300049574 Bacteria 23202
318 Ga0501038_0022568 3300049574 Bacteria 5637
319 Ga0501039_0000293 3300049575 Bacteria 35520
320 Ga0501042_0156470 3300049578 Bacteria 1644
321 Ga0501043_0000033 3300049579 Bacteria 139500
322 Ga0501043_0197263 3300049579 Bacteria 1563
323 Ga0501046_0000452 3300049580 Bacteria 41240
324 Ga0501047_0000574 3300049581 Bacteria 39096
325 Ga0501047_0314850 3300049581 Bacteria 1405
326 Ga0501048_0000261 3300049582 Bacteria 35293
327 Ga0501067_0000045 3300049583 Bacteria 73394
328 Ga0501068_0003740 3300049584 Bacteria 8231
329 Ga0501069_0003820 3300049585 Bacteria 7754
330 Ga0501070_0002498 3300049586 Bacteria 16116
331 Ga0501070_0040157 3300049586 Bacteria 3902
332 Ga0501070_1060926 3300049586 Bacteria 626
333 Ga0501071_0057045 3300049587 Bacteria 2822
334 Ga0501072_0010633 3300049588 Bacteria 7009
335 Ga0501073_0000064 3300049589 Bacteria 65843
336 Ga0501074_0003795 3300049590 Bacteria 10738
337 Ga0501079_0002056 3300049741 Bacteria 14424
338 Ga0501080_0015417 3300049742 Bacteria 7044
339 Ga0501083_0000182 3300049744 Bacteria 40680
340 Ga0501035_0000241 3300049822 Bacteria 65546
341 Ga0501035_0078135 3300049822 Bacteria 2924
342 Ga0501035_0279464 3300049822 Bacteria 1411
343 Ga0501044_0000640 3300049823 Bacteria 42246
344 Ga0501044_0216597 3300049823 Bacteria 1867
345 Ga0501044_0369917 3300049823 Bacteria 1350
346 nmdc:mga0yw44_154923_c1 3300050492 Bacteria 1497
347 nmdc:mga0yw44_819436_c1 3300050492 Bacteria 632
348 nmdc:mga0k408_157786_c1 3300050493 Bacteria 1351
349 nmdc:mga0k408_399098_c1 3300050493 Bacteria 818
350 nmdc:mga07m45_463030_c1 3300050496 Bacteria 735
351 nmdc:mga0sz30_155795_c1 3300050516 Bacteria 1011
352 nmdc:mga0sz30_55549_c1 3300050516 Bacteria 1685
353 Ga0495601_0271054 3300053077 Bacteria 1107
354 Ga0500610_0204333 3300053079 Bacteria 949
355 Ga0495595_0003426 3300053084 Bacteria 6293
356 Ga0495619_0000166 3300053085 Bacteria 48296
357 Ga0495619_0260562 3300053085 Bacteria 1202
358 Ga0500647_0020921 3300053091 Bacteria 3049
359 Ga0500566_0000516 3300053094 Bacteria 21571
360 Ga0500640_015214 3300053095 Bacteria 3215
361 Ga0500557_000001 3300053105 Bacteria 241298
362 Ga0500569_002811 3300053109 Bacteria 3476
363 Ga0500572_000055 3300053111 Bacteria 34260
364 Ga0500595_006079 3300053119 Bacteria 5175
365 Ga0500595_035396 3300053119 Bacteria 1644
366 Ga0500608_024336 3300053122 Bacteria 2827
367 Ga0500608_267368 3300053122 Bacteria 656
368 Ga0500614_055157 3300053123 Bacteria 1055
369 Ga0500642_0000494 3300053130 Bacteria 12169
370 Ga0500559_0003497 3300053136 Bacteria 7705
371 Ga0500561_0135166 3300053137 Bacteria 760
372 Ga0500568_0214014 3300053139 Bacteria 704
373 Ga0500577_0149516 3300053142 Bacteria 990
374 Ga0500590_110998 3300053148 Bacteria 1301
375 Ga0500590_247257 3300053148 Bacteria 712
376 Ga0500590_333589 3300053148 Bacteria 551
377 Ga0500603_004001 3300053150 Bacteria 3153
378 Ga0500603_012467 3300053150 Bacteria 1954
379 Ga0500630_003623 3300053159 Bacteria 7478
380 Ga0500638_047245 3300053162 Bacteria 2084
381 Ga0500639_000004 3300053163 Bacteria 216921
382 Ga0500639_252059 3300053163 Bacteria 706
383 Ga0500637_0511472 3300053178 Bacteria 592
384 Ga0500625_000402 3300053729 Bacteria 11239
385 Ga0500609_014041 3300053731 Bacteria 1084
386 Ga0500596_000144 3300053735 Bacteria 10776
387 Ga0500601_019853 3300053737 Bacteria 774
388 Ga0501084_0002154 3300054114 Bacteria 15762
389 Ga0501082_0003212 3300060353 Bacteria 14245
390 2507509530 2507262055 Bacteria 8048963
391 2508543575 2508501009 Bacteria 7784016
392 2508698637 2508501042 Bacteria 8719808
393 2511398577 2511231028 Bacteria 8046582
394 2513638094 2513237094 Bacteria 8789602
395 2513659591 2513237096 Bacteria 8722461
396 2513705179 2513237102 Bacteria 7703324
397 2513859644 2513237137 Bacteria 9558895
398 2513879371 2513237139 Bacteria 8737671
399 2513921689 2513237145 Bacteria 8979722
400 2514016678 2513237161 Bacteria 8871253
401 2515631235 2515154112 Bacteria 8294334
402 2517106592 2517093001 Bacteria 9002274
403 2517893272 2517572143 Bacteria 9484767
404 2617354034 2617270735 Bacteria 9163226
405 2793064714 2791355196 Bacteria 7323613
406 2805920269 2802429603 Bacteria 8777136
407 2824606591 2824600985 Bacteria 8488197
408 2824613093 2824609381 Bacteria 8672835
409 2824624550 2824617872 Bacteria 8814715
410 2824630703 2824626560 Bacteria 8813858
411 2824640361 2824635225 Bacteria 8785348
412 2824647844 2824644064 Bacteria 8743947
413 2824655814 2824653114 Bacteria 8493680
414 2824676235 2824671348 Bacteria 8369588
415 2824692307 2824687955 Bacteria 8360029
416 2824700644 2824696289 Bacteria 8335049
417 2824718894 2824714736 Bacteria 8717648
418 2824730570 2824723954 Bacteria 8758240
419 2838128690 2838122688 Bacteria 8803140
420 2841948508 2841941048 Bacteria 8688029
421 2841956377 2841949485 Bacteria 8680857
422 2841967151 2841966195 Bacteria 8673214
423 2841979449 2841974524 Bacteria 8931498
424 2841989929 2841983080 Bacteria 8395090
425 2842039941 2842038055 Bacteria 8002051
426 2842047114 2842045827 Bacteria 8006841
427 2847935079 2847930680 Bacteria 9342022
428 2847945641 2847939898 Bacteria 8606328
429 2849080184 2849076700 Bacteria 7039503
430 2857510432 2857509624 Bacteria 7472071
431 2874613307 2874612657 Bacteria 8252029
432 2874626984 2874620515 Bacteria 8290088
433 2874636445 2874628541 Bacteria 8630250
434 2874651200 2874645413 Bacteria 8214782
435 2879090808 2879083081 Bacteria 8587928
436 2879134681 2879127579 Bacteria 8294491
437 2879143164 2879142872 Bacteria 8267021
438 2881673080 2881665667 Bacteria 8175609
439 2885373423 2885366525 Bacteria 8326213
440 2885374866 2885374607 Bacteria 8927485
441 2885410324 2885409591 Bacteria 9235467
442 2888423523 2888419890 Bacteria 7857137
443 2904669685 2904666416 Bacteria 8226587
444 2904696684 2904690495 Bacteria 9412302
445 2906636175 2906635258 Bacteria 8601019
446 2906667978 2906660503 Bacteria 8595048
447 2908761304 2908756301 Bacteria 8864324
448 2935611593 2935608549 Bacteria 8203142
449 2935648968 2935648319 Bacteria 8801166
450 2935656950 2935656913 Bacteria 8965014
451 2935698881 2935694250 Bacteria 9291695
452 2935775825 2935769743 Bacteria 7878163
453 2935780748 2935777560 Bacteria 8077691
454 2935791438 2935785616 Bacteria 7962367
455 2935799686 2935793552 Bacteria 8012592
456 2935821070 2935819856 Bacteria 8261050
457 2935850670 2935847175 Bacteria 8228321
458 2935915453 2935908558 Bacteria 8568796
459 2935921445 2935916978 Bacteria 9113783
460 2935932949 2935926038 Bacteria 8601059
461 2935941440 2935934488 Bacteria 8602579
462 2935949723 2935942939 Bacteria 8599779
463 2935958418 2935951376 Bacteria 8602333
464 2935974412 2935967501 Bacteria 8603075
465 2935980784 2935975950 Bacteria 8347125
466 2935989151 2935984226 Bacteria 8302647
467 2936011878 2936011229 Bacteria 8801034
468 2936020473 2936019824 Bacteria 8804134
469 2936029167 2936028420 Bacteria 8965941
470 2936047196 2936046547 Bacteria 8903709
471 2936061424 2936055302 Bacteria 8785755
472 3005511705 3005506211 Bacteria 6943378
473 3005598276 3005594810 Bacteria 8716512
474 3005713992 3005710791 Bacteria 7622528
475 8016530567 8016522445 Bacteria 8156687
476 8016535849 8016530956 Bacteria 8155261
477 8016540127 8016539877 Bacteria 8155419
478 8016553103 8016548790 Bacteria 8155074
479 8016561485 8016557553 Bacteria 8154380
480 8016574194 8016566248 Bacteria 8158151
481 8016578296 8016575299 Bacteria 8154085
482 8016599331 8016595262 Bacteria 8149947
483 8016611705 8016603502 Bacteria 8731218
484 8016627757 8016622563 Bacteria 7999408
485 8019535576 8019530166 Bacteria 8155624
486 8019543908 8019538911 Bacteria 7872763
487 8019554861 8019547302 Bacteria 7996444
488 8019627115 8019619141 Bacteria 9218857
489 8019635433 8019629233 Bacteria 8687553
490 8019644268 8019638758 Bacteria 9062356
491 8019657327 8019648815 Bacteria 10014479
492 8019663243 8019659431 Bacteria 8577854
493 8019672856 8019668869 Bacteria 8791617
494 8019683287 8019678201 Bacteria 8863603
495 8019688995 8019687851 Bacteria 8712826
496 8056695775 8056689827 Bacteria 6712655
497 8056972565 8056967851 Bacteria 9038162
498 Ga0495588_0090262
499 JGI25165J46597_1011926
500 JGI25153J46596_10004942
501 JGI25160J50197_1001994
502 Ga0055542_1003986
503 Ga0055531_10011335
504 Ga0055531_10017361
505 JGI25405J52794_10017454
506 Ga0055543_1001961
507 Ga0065165_1001623
508 Ga0065165_1010370
509 Ga0065165_1022952
510 Ga0070658_10160243
511 Ga0070671_101012969
512 Ga0070709_10002626
513 Ga0070714_100012170
514 Ga0070713_100013925
515 Ga0070713_100238132
516 Ga0070713_100334507
517 Ga0070710_10001750
518 Ga0070710_10206926
519 Ga0070710_10735489
520 Ga0070711_100004679
521 Ga0070708_100243735
522 Ga0070706_100387150
523 Ga0070706_100398546
524 Ga0070698_100560727
525 Ga0070699_100905768
526 Ga0070684_100101115
527 Ga0070697_100108207
528 Ga0070697_100222758
529 Ga0068853_100136142
530 Ga0068853_100148325
531 Ga0068855_100713705
532 Ga0068857_100127826
533 Ga0068854_101124355
534 Ga0068856_101008541
535 Ga0068852_100120244
536 Ga0068852_101360931
537 Ga0068859_100129767
538 Ga0068866_10231903
539 Ga0068863_100074152
540 Ga0068858_100558360
541 Ga0068860_100084760
542 Ga0081455_10026268
543 Ga0081540_1160280
544 Ga0081540_1192803
545 Ga0070717_11718919
546 Ga0075365_10069838
547 Ga0075364_10226155
548 Ga0075432_10238115
549 Ga0070715_10000266
550 Ga0070716_100003732
551 Ga0070716_100079385
552 Ga0070716_100114536
553 Ga0070716_100237628
554 Ga0070716_100364957
555 Ga0070712_100044663
556 Ga0070712_100061062
557 Ga0070712_100225413
558 Ga0075362_10244279
559 Ga0075367_10414211
560 Ga0075369_10058327
561 Ga0075369_10100118
562 Ga0075370_10249034
563 Ga0075370_10411725
564 Ga0068871_100605711
565 Ga0097620_100129761
566 Ga0099824_1018161
567 Ga0099794_10111793
568 Ga0099795_10075483
569 Ga0105240_10039339
570 Ga0105245_10596251
571 Ga0105247_10020110
572 Ga0105241_10519248
573 Ga0105237_10551823
574 Ga0099796_10016025
575 Ga0099796_10047165
576 Ga0105239_10204235
577 Ga0105239_10387766
578 Ga0105239_10782580
579 Ga0105239_11796806
580 Ga0157371_10265721
581 Ga0157370_10120891
582 Ga0157370_10612567
583 Ga0157369_11162095
584 Ga0157378_11604432
585 Ga0163162_10223195
586 Ga0157372_10037018
587 Ga0163163_12882054
588 Ga0206350_10299931
589 Ga0209148_1000493
590 Ga0209233_1008850
591 Ga0209233_1009635
592 Ga0209233_1023600
593 Ga0209564_1031054
594 Ga0209758_1000100
595 Ga0209758_1001732
596 Ga0209758_1002189
597 Ga0209758_1058778
598 Ga0209256_1002940
599 Ga0209256_1036264
600 Ga0207426_1000382
601 Ga0207426_1065160
602 Ga0209051_1078665
603 Ga0209257_1001443
604 Ga0209257_1048923
605 Ga0207692_10158341
606 Ga0207692_10567348
607 Ga0207642_10148801
608 Ga0207710_10019276
609 Ga0207647_10272812
610 Ga0207699_10005962
611 Ga0207699_10109450
612 Ga0207705_10113969
613 Ga0207684_10117761
614 Ga0207684_10169978
615 Ga0207684_11261461
616 Ga0207707_10663465
617 Ga0207707_10682882
618 Ga0207693_10001357
619 Ga0207693_10022673
620 Ga0207693_10047889
621 Ga0207663_10005723
622 Ga0207663_10408156
623 Ga0207663_10947603
624 Ga0207657_10218263
625 Ga0207687_10136105
626 Ga0207700_10223629
627 Ga0207700_10274706
628 Ga0207700_10295245
629 Ga0207664_10216751
630 Ga0207664_10827719
631 Ga0207644_10544581
632 Ga0207704_10603806
633 Ga0207665_10006211
634 Ga0207665_10018185
635 Ga0207665_10076546
636 Ga0207665_10133785
637 Ga0207665_10604348
638 Ga0207665_11478167
639 Ga0207661_10382615
640 Ga0207667_10410821
641 Ga0207667_10418204
642 Ga0207667_10458318
643 Ga0207667_11248007
644 Ga0207640_10310611
645 Ga0207640_11211682
646 Ga0207658_10503801
647 Ga0207639_10416798
648 Ga0207678_10180439
649 Ga0207678_10743036
650 Ga0207678_10807494
651 Ga0207702_10265697
652 Ga0207702_10595596
653 Ga0207641_10041261
654 Ga0207641_10251826
655 Ga0207648_10259200
656 Ga0207676_11142872
657 Ga0207674_11077219
658 Ga0207698_10044419
659 Ga0209389_1000068
660 Ga0209389_1000092
661 Ga0209589_1000115
662 Ga0209489_100340
663 Ga0209489_113471
664 Ga0209700_100117
665 Ga0268264_10000084
666 Ga0265334_10090155
667 Ga0265330_10153369
668 Ga0265340_10080673
669 Ga0265339_10241466
670 Ga0265316_11054934
671 Ga0307508_10476238
672 Ga0265314_10055914
673 Ga0265314_10075131
674 Ga0265342_10002241
675 Ga0265342_10268689
676 Ga0307516_10042765
677 Ga0307516_10193479
678 Ga0315911_1000029
679 Ga0373923_0018900
680 Ga0373936_0074159
681 Ga0373953_0000640
682 Ga0373954_0000067
683 Ga0373956_0011308
684 Ga0373956_0292302
685 Ga0373957_0099573
686 Ga0373957_0313304
687 Ga0373955_0003543
688 Ga0373924_0079468
689 Ga0373931_0186689
690 Ga0373935_0671431
691 Ga0373935_1043958
692 Ga0373927_0015767
693 Ga0373927_0030629
694 Ga0373933_0004250
695 Ga0373933_0147723
696 Ga0373947_0042436
697 Ga0373947_0043170
698 Ga0373937_0014291
699 Ga0373925_0154139
700 Ga0395900_0496805
701 Ga0395905_0002179
702 Ga0436364_1334658
703 Ga0436364_1473104
704 Ga0395901_0038765
705 Ga0395901_0204896
706 Ga0436365_0261035
707 Ga0436365_0400373
708 Ga0436365_0746238
709 Ga0436365_0949535
710 Ga0436365_1843246
711 Ga0451791_0682776
712 Ga0451797_1097118
713 Ga0451795_1528108
714 Ga0451833_0045373
715 Ga0451835_0920193
716 Ga0451841_1267291
717 Ga0451853_0785409
718 Ga0466961_0392386
719 Ga0466964_0541209
720 Ga0466964_0822891
721 Ga0466968_0678949
722 Ga0466957_1329646
723 Ga0466959_0009099
724 Ga0466959_0063375
725 Ga0466967_0051109
726 Ga0466967_0170044
727 Ga0495592_0001030
728 Ga0495603_0036924
729 Ga0495629_0000398
730 Ga0495638_0296449
731 Ga0495641_0154769
732 Ga0495651_0004166
733 Ga0495653_0000598
734 Ga0495580_0188870
735 Ga0495582_0270670
736 Ga0495605_0307942
737 Ga0495584_0443057
738 Ga0495585_0099244
739 Ga0495608_0004383
740 Ga0495628_0030305
741 Ga0495630_1471932
742 Ga0495648_0000552
743 Ga0495652_0009435
744 Ga0495640_0021304
745 Ga0495587_0018340
746 Ga0495645_0265239
747 Ga0495622_0298596
748 Ga0495667_0000305
749 Ga0495656_0231953
750 Ga0495634_0012910
751 Ga0495611_0415209
752 Ga0495635_0000102
753 Ga0495659_0035265
754 Ga0495661_0561748
755 Ga0495657_0000677
756 Ga0495657_0639832
757 Ga0495599_0001882
758 Ga0495623_0149011
759 Ga0495646_0005928
760 Ga0495613_0024285
761 Ga0495589_0097177
762 Ga0495600_0041727
763 Ga0495604_0001099
764 Ga0495674_0013937
765 Ga0495676_0092277
766 Ga0495680_0018405
767 Ga0495675_0024914
768 Ga0495684_0000088
769 Ga0495593_0009454
770 Ga0495602_0028311
771 Ga0496100_1495014
772 Ga0496101_0041445
773 Ga0496101_0229452
774 Ga0496104_0079709
775 Ga0496107_0247583
776 Ga0496107_0680827
777 Ga0496107_1173378
778 Ga0496108_0195566
779 Ga0496108_0583812
780 Ga0496109_0386912
781 Ga0496109_0526158
782 Ga0496110_0682535
783 Ga0496110_0713931
784 Ga0496110_1048522
785 Ga0496111_0034791
786 Ga0496111_1129770
787 Ga0496112_0089547
788 Ga0496113_0087190
789 Ga0496114_0123838
790 Ga0496115_0021991
791 Ga0496115_0033726
792 Ga0496115_1449740
793 Ga0496118_0170454
794 Ga0496121_0023336
795 Ga0496121_0219095
796 Ga0496121_0382686
797 Ga0496124_0107198
798 Ga0496125_0137981
799 Ga0496125_0193470
800 Ga0496126_0041919
801 Ga0496126_0069725
802 Ga0496126_0099408
803 Ga0496126_0255261
804 Ga0501031_0000620
805 Ga0501032_0003195
806 Ga0501032_0067877
807 Ga0501033_0000241
808 Ga0501033_0371109
809 Ga0501034_0000021
810 Ga0501034_0156939
811 Ga0501036_0000055
812 Ga0501037_0000398
813 Ga0501037_0054358
814 Ga0501038_0001235
815 Ga0501038_0022568
816 Ga0501039_0000293
817 Ga0501042_0156470
818 Ga0501043_0000033
819 Ga0501043_0197263
820 Ga0501046_0000452
821 Ga0501047_0000574
822 Ga0501047_0314850
823 Ga0501048_0000261
824 Ga0501067_0000045
825 Ga0501068_0003740
826 Ga0501069_0003820
827 Ga0501070_0002498
828 Ga0501070_0040157
829 Ga0501070_1060926
830 Ga0501071_0057045
831 Ga0501072_0010633
832 Ga0501073_0000064
833 Ga0501074_0003795
834 Ga0501079_0002056
835 Ga0501080_0015417
836 Ga0501083_0000182
837 Ga0501035_0000241
838 Ga0501035_0078135
839 Ga0501035_0279464
840 Ga0501044_0000640
841 Ga0501044_0216597
842 Ga0501044_0369917
843 nmdc:mga0yw44_154923_c1
844 nmdc:mga0yw44_819436_c1
845 nmdc:mga0k408_157786_c1
846 nmdc:mga0k408_399098_c1
847 nmdc:mga07m45_463030_c1
848 nmdc:mga0sz30_155795_c1
849 nmdc:mga0sz30_55549_c1
850 Ga0495601_0271054
851 Ga0500610_0204333
852 Ga0495595_0003426
853 Ga0495619_0000166
854 Ga0495619_0260562
855 Ga0500647_0020921
856 Ga0500566_0000516
857 Ga0500640_015214
858 Ga0500557_000001
859 Ga0500569_002811
860 Ga0500572_000055
861 Ga0500595_006079
862 Ga0500595_035396
863 Ga0500608_024336
864 Ga0500608_267368
865 Ga0500614_055157
866 Ga0500642_0000494
867 Ga0500559_0003497
868 Ga0500561_0135166
869 Ga0500568_0214014
870 Ga0500577_0149516
871 Ga0500590_110998
872 Ga0500590_247257
873 Ga0500590_333589
874 Ga0500603_004001
875 Ga0500603_012467
876 Ga0500630_003623
877 Ga0500638_047245
878 Ga0500639_000004
879 Ga0500639_252059
880 Ga0500637_0511472
881 Ga0500625_000402
882 Ga0500609_014041
883 Ga0500596_000144
884 Ga0500601_019853
885 Ga0501084_0002154
886 Ga0501082_0003212
887 2507509530
888 2508543575
889 2508698637
890 2511398577
891 2513638094
892 2513659591
893 2513705179
894 2513859644
895 2513879371
896 2513921689
897 2514016678
898 2515631235
899 2517106592
900 2517893272
901 2617354034
902 2793064714
903 2805920269
904 2824606591
905 2824613093
906 2824624550
907 2824630703
908 2824640361
909 2824647844
910 2824655814
911 2824676235
912 2824692307
913 2824700644
914 2824718894
915 2824730570
916 2838128690
917 2841948508
918 2841956377
919 2841967151
920 2841979449
921 2841989929
922 2842039941
923 2842047114
924 2847935079
925 2847945641
926 2849080184
927 2857510432
928 2874613307
929 2874626984
930 2874636445
931 2874651200
932 2879090808
933 2879134681
934 2879143164
935 2881673080
936 2885373423
937 2885374866
938 2885410324
939 2888423523
940 2904669685
941 2904696684
942 2906636175
943 2906667978
944 2908761304
945 2935611593
946 2935648968
947 2935656950
948 2935698881
949 2935775825
950 2935780748
951 2935791438
952 2935799686
953 2935821070
954 2935850670
955 2935915453
956 2935921445
957 2935932949
958 2935941440
959 2935949723
960 2935958418
961 2935974412
962 2935980784
963 2935989151
964 2936011878
965 2936020473
966 2936029167
967 2936047196
968 2936061424
969 3005511705
970 3005598276
971 3005713992
972 8016530567
973 8016535849
974 8016540127
975 8016553103
976 8016561485
977 8016574194
978 8016578296
979 8016599331
980 8016611705
981 8016627757
982 8019535576
983 8019543908
984 8019554861
985 8019627115
986 8019635433
987 8019644268
988 8019657327
989 8019663243
990 8019672856
991 8019683287
992 8019688995
993 8056695775
994 8056972565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06170

DUF983

Protein of unknown function (DUF983)

44

126

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_Q9VEF6_1_169_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4956 86 146 1.20.140.150
af_I1K0K7_497_567_1.10.260.100 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain); 0.3339 61 124 1.10.260.100
af_Q9W0H3_1_305_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.3337 77 131 3.40.50.1820
af_Q9ZUV9_60_465_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3272 62 132 1.20.1530.20
af_I1K0K7_497_567_1.10.260.100 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain); 0.2917 61 124 1.10.260.100
ID Description Score Start End GO Terms
AF-A0A4Y9EPG5-F1-model_v4 DUF983 domain-containing protein 0.8656 26 133 GO:0016020
AF-A0A059FNV1-F1-model_v4 DUF983 domain-containing protein 0.8546 23 133 GO:0016020
AF-A0A4Q4CX04-F1-model_v4 DUF983 domain-containing protein 0.8493 26 134 GO:0016020
AF-A0A521GY24-F1-model_v4 DUF983 domain-containing protein 0.8486 25 133 GO:0016020
AF-A0A3L7J9N3-F1-model_v4 DUF983 domain-containing protein 0.8479 22 133 GO:0016020

Map