F455115

General Info

Members Datasets Scaffolds Average Seq Length
497 290 995 327

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_000748|Ga0590071_000748_2580_3557
Length 325
Sequence MKYRELGRTGWQVSTISFGAWAIGGTWGAVDDAAAMAALHRALDLGVNFFDTADVYGDGHSERLLARLRRERREPFYVATKAGRRLDPHAAEGYRNLTGFIERSLKNLEAEALDLLQLHCPPTQVFYMPEVFDALDTLVRAGKLRHYGVSVERVEEGIKAMDFPGVQSVQIIYNVFRQRPAEVFLPLAAQRRVGVLARLPLSSGMLTGKLTAQSQFASDDHRHFNREGAGFDRGETFSGLDYATGLQAVEELRPVVPPGWTLAQLALRWILMNPAVTCAIPGGRRPEQVQDNVAAADLPDLSPATLAAMATVYDRLARPLVHTRW

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
154 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
155 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
202 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
203 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
204 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
205 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
209 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
210 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
262 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
265 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
273 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
274 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 2597490337 Halobacterium salinarum DSM 3754 Isolate Nodule
283 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
284 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
285 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
286 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
287 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
288 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
289 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
290 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.27
Nodule 0.6
Rhizoplane 4.23
Rhizosphere 76.26
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_000748 3300059421 Bacteria 9086
2 JGI25156J39149_1000060 3300002705 Bacteria 84857
3 JGI25154J39366_1000540 3300002738 Bacteria 18810
4 JGI25157J39369_1000029 3300002741 Bacteria 146928
5 JGI25152J39213_1002286 3300002773 Bacteria 7391
6 JGI25153J46596_10000333 3300003215 Bacteria 33990
7 JGI25153J46596_10011832 3300003215 Bacteria 3825
8 rootH1_10010673 3300003316 Bacteria 2766
9 rootH1_10010674 3300003316 Bacteria 6425
10 rootL2_10278450 3300003322 Bacteria 1494
11 rootH1_10052226 3300003323 Bacteria 12097
12 rootH1_10089266 3300003316 Bacteria 5490
13 rootH1_10089266 3300003323 Bacteria 9644
14 rootH1_10152242 3300003323 Bacteria 7289
15 rootH1_10190425 3300003323 Bacteria 2961
16 Ga0055526_1000608 3300003771 Bacteria 27843
17 Ga0055524_1000203 3300003775 Bacteria 64635
18 Ga0055530_10002233 3300003791 Bacteria 12748
19 Ga0055540_1000023 3300003792 Bacteria 201131
20 Ga0055540_1019694 3300003792 Bacteria 1811
21 Ga0055531_10008652 3300003794 Bacteria 5327
22 Ga0065165_1001800 3300005262 Bacteria 21086
23 Ga0070658_10109551 3300005327 Bacteria 2287
24 Ga0070683_100112673 3300005329 Bacteria 2567
25 Ga0070683_100274460 3300005329 Bacteria 1604
26 Ga0070683_100361632 3300005329 Bacteria 1382
27 Ga0070690_100006493 3300005330 Bacteria 6629
28 Ga0070690_100006677 3300005330 Bacteria 6554
29 Ga0070670_100008860 3300005331 Bacteria 8590
30 Ga0068869_100074385 3300005334 Bacteria 2521
31 Ga0068869_100116796 3300005334 Bacteria 2036
32 Ga0068869_100164980 3300005334 Bacteria 1727
33 Ga0070680_100000445 3300005336 Bacteria 28155
34 Ga0070682_100002871 3300005337 Bacteria 9554
35 Ga0070682_100073702 3300005337 Bacteria 2191
36 Ga0070682_100093388 3300005337 Bacteria 1973
37 Ga0068868_100217471 3300005338 Bacteria 1598
38 Ga0070660_100009700 3300005339 Bacteria 6782
39 Ga0070691_10115908 3300005341 Bacteria 1344
40 Ga0070687_100019252 3300005343 Bacteria 3172
41 Ga0070661_100197971 3300005344 Bacteria 1534
42 Ga0070669_100232456 3300005353 Bacteria 1462
43 Ga0070671_100024988 3300005355 Unclassified 4896
44 Ga0070674_100001783 3300005356 Bacteria 11675
45 Ga0070673_100293376 3300005364 Bacteria 1430
46 Ga0070659_100023026 3300005366 Bacteria 4762
47 Ga0070659_100117814 3300005366 Bacteria 2148
48 Ga0070667_100020995 3300005367 Bacteria 5424
49 Ga0070713_100058834 3300005436 Bacteria 3207
50 Ga0070701_10037389 3300005438 Bacteria 2450
51 Ga0070705_100255679 3300005440 Bacteria 1232
52 Ga0070694_100155852 3300005444 Bacteria 1672
53 Ga0070678_100027507 3300005456 Bacteria 3862
54 Ga0070681_10000067 3300005458 Bacteria 75697
55 Ga0070681_10035909 3300005458 Unclassified 4978
56 Ga0070681_10113296 3300005458 Bacteria 2651
57 Ga0070681_10247658 3300005458 Bacteria 1695
58 Ga0068867_100000058 3300005459 Bacteria 68343
59 Ga0070706_100017311 3300005467 Bacteria 6651
60 Ga0070707_100013117 3300005468 Bacteria 7746
61 Ga0070698_100004327 3300005471 Bacteria 15606
62 Ga0070698_100040830 3300005471 Bacteria 4766
63 Ga0070698_100089525 3300005471 Bacteria 3061
64 Ga0070699_100047030 3300005518 Unclassified 3733
65 Ga0070699_100496466 3300005518 Bacteria 1108
66 Ga0070679_100000055 3300005530 Bacteria 84504
67 Ga0070679_100013547 3300005530 Bacteria 7813
68 Ga0070684_100006742 3300005535 Bacteria 8909
69 Ga0070684_100054782 3300005535 Bacteria 3475
70 Ga0070684_100185308 3300005535 Bacteria 1893
71 Ga0070697_100043246 3300005536 Bacteria 3646
72 Ga0070672_100048593 3300005543 Bacteria 3298
73 Ga0070672_100212763 3300005543 Bacteria 1619
74 Ga0070686_100237650 3300005544 Bacteria 1325
75 Ga0070686_100247249 3300005544 Bacteria 1301
76 Ga0070695_100147934 3300005545 Bacteria 1636
77 Ga0070696_100291439 3300005546 Bacteria 1247
78 Ga0068855_100002106 3300005563 Bacteria 24623
79 Ga0068855_100003757 3300005563 Bacteria 18557
80 Ga0068855_100028849 3300005563 Bacteria 6639
81 Ga0068855_100043210 3300005563 Bacteria 5339
82 Ga0068855_100180363 3300005563 Bacteria 2388
83 Ga0068857_100000097 3300005577 Bacteria 51356
84 Ga0068857_100014171 3300005577 Bacteria 6942
85 Ga0068857_100403821 3300005577 Bacteria 1272
86 Ga0068854_100007883 3300005578 Bacteria 6814
87 Ga0068856_100103664 3300005614 Bacteria 2838
88 Ga0068856_100133870 3300005614 Unclassified 2484
89 Ga0070702_100003595 3300005615 Bacteria 6969
90 Ga0070702_100042598 3300005615 Bacteria 2554
91 Ga0068852_100048670 3300005616 Bacteria 3623
92 Ga0068859_100028125 3300005617 Bacteria 5636
93 Ga0068859_100109272 3300005617 Bacteria 2826
94 Ga0068859_100279136 3300005617 Bacteria 1763
95 Ga0068864_100013413 3300005618 Bacteria 6792
96 Ga0068861_100006534 3300005719 Bacteria 7954
97 Ga0068861_100011051 3300005719 Bacteria 6274
98 Ga0068861_100108968 3300005719 Bacteria 2216
99 Ga0068861_100115651 3300005719 Bacteria 2155
100 Ga0068863_100025889 3300005841 Bacteria 5597
101 Ga0068863_100038450 3300005841 Bacteria 4552
102 Ga0068863_100042658 3300005841 Bacteria 4311
103 Ga0068863_100316159 3300005841 Bacteria 1516
104 Ga0068858_100069858 3300005842 Bacteria 3255
105 Ga0068860_100075281 3300005843 Bacteria 3210
106 Ga0068860_100082750 3300005843 Bacteria 3052
107 Ga0070717_10120651 3300006028 Bacteria 2246
108 Ga0070716_100000007 3300006173 Bacteria 256300
109 Ga0075366_10008135 3300006195 Bacteria 5818
110 Ga0075366_10038791 3300006195 Bacteria 2814
111 Ga0097621_100011109 3300006237 Bacteria 6624
112 Ga0097621_100265955 3300006237 Bacteria 1506
113 Ga0068871_100002231 3300006358 Bacteria 13155
114 Ga0068871_100300884 3300006358 Bacteria 1408
115 Ga0075428_100030342 3300006844 Bacteria 5980
116 Ga0075429_100062518 3300006880 Unclassified 3244
117 Ga0097620_100028125 3300006931 Bacteria 5636
118 Ga0097620_100109274 3300006931 Bacteria 2826
119 Ga0097620_100279133 3300006931 Bacteria 1763
120 Ga0079104_1000273 3300006946 Bacteria 67267
121 Ga0105240_10003216 3300009093 Bacteria 25591
122 Ga0105240_10029073 3300009093 Bacteria 7207
123 Ga0111539_10248705 3300009094 Bacteria 2070
124 Ga0105245_10002289 3300009098 Bacteria 17333
125 Ga0105245_10158127 3300009098 Bacteria 2148
126 Ga0105245_10332068 3300009098 Bacteria 1501
127 Ga0114129_10072978 3300009147 Bacteria 4782
128 Ga0114129_10360209 3300009147 Bacteria 1925
129 Ga0114129_10808424 3300009147 Bacteria 1195
130 Ga0105243_10006273 3300009148 Bacteria 9186
131 Ga0105243_10006803 3300009148 Bacteria 8815
132 Ga0105243_10429539 3300009148 Bacteria 1234
133 Ga0105241_10012649 3300009174 Bacteria 6193
134 Ga0105241_10127645 3300009174 Bacteria 2055
135 Ga0105241_10396415 3300009174 Bacteria 1209
136 Ga0105248_10047890 3300009177 Bacteria 4794
137 Ga0105237_10067073 3300009545 Bacteria 3582
138 Ga0105238_10003035 3300009551 Bacteria 16749
139 Ga0105239_10106603 3300010375 Bacteria 3104
140 Ga0105239_10344514 3300010375 Bacteria 1682
141 Ga0105246_10033030 3300011119 Bacteria 3436
142 Ga0105246_10189449 3300011119 Bacteria 1591
143 Ga0157369_10330933 3300013105 Bacteria 1583
144 Ga0157374_10153038 3300013296 Bacteria 2243
145 Ga0157378_10023275 3300013297 Bacteria 5452
146 Ga0157378_10227765 3300013297 Bacteria 1774
147 Ga0157375_10152790 3300013308 Bacteria 2445
148 Ga0157380_10215689 3300014326 Bacteria 1714
149 Ga0157377_10000092 3300014745 Bacteria 65323
150 Ga0157377_10018526 3300014745 Bacteria 3619
151 Ga0157376_10011888 3300014969 Bacteria 6436
152 Ga0157376_10059378 3300014969 Bacteria 3206
153 Ga0157376_10092308 3300014969 Bacteria 2625
154 Ga0163161_10041810 3300017792 Bacteria 3294
155 Ga0207427_100324 3300025231 Bacteria 32209
156 Ga0209258_100660 3300025242 Bacteria 24858
157 Ga0207425_1000167 3300025245 Bacteria 55344
158 Ga0209646_1000111 3300025246 Bacteria 155786
159 Ga0209026_1000054 3300025250 Bacteria 242508
160 Ga0209677_100105 3300025253 Bacteria 89277
161 Ga0209677_102438 3300025253 Bacteria 6999
162 Ga0209759_1000043 3300025256 Bacteria 242513
163 Ga0209759_1001974 3300025256 Bacteria 9857
164 Ga0209759_1011374 3300025256 Bacteria 2536
165 Ga0209129_1000154 3300025258 Bacteria 109449
166 Ga0209673_1010409 3300025273 Bacteria 3923
167 Ga0209673_1015388 3300025273 Bacteria 2909
168 Ga0209675_1011902 3300025291 Bacteria 2845
169 Ga0209564_1000445 3300025295 Bacteria 71213
170 Ga0209758_1000226 3300025297 Bacteria 120484
171 Ga0209758_1000338 3300025297 Bacteria 87042
172 Ga0209050_1000748 3300025298 Bacteria 46763
173 Ga0209050_1000783 3300025298 Bacteria 45279
174 Ga0209050_1024178 3300025298 Bacteria 2112
175 Ga0209256_1000024 3300025299 Bacteria 448909
176 Ga0209256_1013398 3300025299 Bacteria 3043
177 Ga0209051_1000079 3300025303 Bacteria 201183
178 Ga0209051_1000808 3300025303 Bacteria 32707
179 Ga0209051_1011807 3300025303 Bacteria 4278
180 Ga0209257_1000183 3300025304 Bacteria 156618
181 Ga0207680_10102909 3300025903 Bacteria 1838
182 Ga0207684_10006757 3300025910 Bacteria 10411
183 Ga0207684_10035566 3300025910 Bacteria 4229
184 Ga0207654_10010606 3300025911 Bacteria 4692
185 Ga0207654_10110458 3300025911 Bacteria 1710
186 Ga0207707_10000003 3300025912 Bacteria 642592
187 Ga0207707_10047634 3300025912 Unclassified 3733
188 Ga0207695_10009981 3300025913 Bacteria 11666
189 Ga0207695_10057045 3300025913 Bacteria 4060
190 Ga0207695_10208303 3300025913 Bacteria 1867
191 Ga0207695_10292425 3300025913 Bacteria 1521
192 Ga0207695_10390670 3300025913 Bacteria 1276
193 Ga0207671_10027728 3300025914 Bacteria 4234
194 Ga0207671_10063286 3300025914 Bacteria 2749
195 Ga0207693_10297010 3300025915 Bacteria 1265
196 Ga0207660_10000449 3300025917 Bacteria 27096
197 Ga0207662_10008532 3300025918 Bacteria 5615
198 Ga0207662_10016463 3300025918 Bacteria 4173
199 Ga0207657_10025444 3300025919 Bacteria 5458
200 Ga0207652_10000111 3300025921 Bacteria 88571
201 Ga0207652_10040495 3300025921 Bacteria 3957
202 Ga0207646_10016303 3300025922 Bacteria 6973
203 Ga0207694_10001305 3300025924 Bacteria 21455
204 Ga0207694_10004991 3300025924 Bacteria 10266
205 Ga0207687_10002013 3300025927 Bacteria 13949
206 Ga0207687_10024900 3300025927 Bacteria 4002
207 Ga0207644_10466240 3300025931 Bacteria 1039
208 Ga0207686_10052127 3300025934 Bacteria 2552
209 Ga0207709_10046681 3300025935 Bacteria 2630
210 Ga0207670_10000013 3300025936 Bacteria 211834
211 Ga0207670_10002264 3300025936 Bacteria 10075
212 Ga0207670_10086829 3300025936 Bacteria 2202
213 Ga0207669_10012477 3300025937 Bacteria 4180
214 Ga0207669_10306226 3300025937 Bacteria 1210
215 Ga0207665_10000018 3300025939 Bacteria 122653
216 Ga0207691_10004845 3300025940 Bacteria 13012
217 Ga0207691_10032424 3300025940 Bacteria 4870
218 Ga0207711_10528210 3300025941 Bacteria 1100
219 Ga0207689_10003548 3300025942 Bacteria 14265
220 Ga0207689_10020376 3300025942 Bacteria 5581
221 Ga0207689_10140445 3300025942 Bacteria 1990
222 Ga0207661_10000570 3300025944 Bacteria 23531
223 Ga0207661_10095911 3300025944 Bacteria 2481
224 Ga0207661_10167383 3300025944 Bacteria 1911
225 Ga0207661_10264234 3300025944 Bacteria 1534
226 Ga0207661_10329378 3300025944 Bacteria 1374
227 Ga0207679_10353867 3300025945 Bacteria 1281
228 Ga0207667_10000835 3300025949 Bacteria 39794
229 Ga0207667_10007769 3300025949 Bacteria 12820
230 Ga0207667_10521130 3300025949 Bacteria 1204
231 Ga0207651_10054343 3300025960 Bacteria 2744
232 Ga0207640_10045251 3300025981 Bacteria 2825
233 Ga0207678_10092705 3300026067 Bacteria 2582
234 Ga0207708_10062866 3300026075 Bacteria 2836
235 Ga0207702_10000946 3300026078 Bacteria 29831
236 Ga0207702_10205545 3300026078 Bacteria 1828
237 Ga0207641_10013701 3300026088 Bacteria 6654
238 Ga0207641_10053900 3300026088 Bacteria 3411
239 Ga0207648_10000164 3300026089 Bacteria 68327
240 Ga0207648_10057614 3300026089 Bacteria 3390
241 Ga0207648_10105606 3300026089 Bacteria 2471
242 Ga0207676_10009777 3300026095 Bacteria 6820
243 Ga0207676_10075709 3300026095 Bacteria 2716
244 Ga0207674_10004499 3300026116 Bacteria 16753
245 Ga0207674_10004696 3300026116 Bacteria 16388
246 Ga0207675_100000765 3300026118 Bacteria 32007
247 Ga0207675_100002481 3300026118 Bacteria 18263
248 Ga0207675_100003378 3300026118 Bacteria 15602
249 Ga0207675_100244170 3300026118 Bacteria 1736
250 Ga0209281_1000135 3300027111 Bacteria 183462
251 Ga0209974_10011028 3300027876 Bacteria 3042
252 Ga0268266_10293140 3300028379 Bacteria 1516
253 Ga0268266_10306052 3300028379 Bacteria 1484
254 Ga0268264_10143187 3300028381 Bacteria 2134
255 Ga0268264_10168259 3300028381 Bacteria 1980
256 Ga0265337_1032477 3300028556 Bacteria 1543
257 Ga0265326_10004446 3300028558 Bacteria 4490
258 Ga0265326_10012600 3300028558 Unclassified 2483
259 Ga0265319_1000351 3300028563 Bacteria 33480
260 Ga0265319_1004043 3300028563 Bacteria 7410
261 Ga0265319_1009789 3300028563 Bacteria 4047
262 Ga0265334_10034404 3300028573 Unclassified 2011
263 Ga0265334_10049754 3300028573 Bacteria 1611
264 Ga0265318_10005409 3300028577 Bacteria 5995
265 Ga0265323_10029122 3300028653 Bacteria 2067
266 Ga0265322_10015060 3300028654 Bacteria 2236
267 Ga0265336_10000008 3300028666 Bacteria 336082
268 Ga0265336_10000300 3300028666 Bacteria 33668
269 Ga0307517_10064160 3300028786 Bacteria 3419
270 Ga0307517_10094049 3300028786 Bacteria 2424
271 Ga0307515_10000139 3300028794 Bacteria 173074
272 Ga0307515_10019192 3300028794 Bacteria 12325
273 Ga0307515_10025988 3300028794 Bacteria 10101
274 Ga0265338_10000388 3300028800 Bacteria 78700
275 Ga0265338_10004894 3300028800 Bacteria 17831
276 Ga0265338_10039130 3300028800 Bacteria 4480
277 Ga0265338_10064725 3300028800 Bacteria 3177
278 Ga0265338_10114717 3300028800 Bacteria 2161
279 Ga0265324_10005636 3300029957 Bacteria 5359
280 Ga0307512_10015107 3300030522 Bacteria 7171
281 Ga0265330_10002208 3300031235 Bacteria 10741
282 Ga0265330_10022755 3300031235 Bacteria 2851
283 Ga0265332_10016968 3300031238 Bacteria 3212
284 Ga0265328_10003648 3300031239 Bacteria 6784
285 Ga0265320_10000650 3300031240 Bacteria 26560
286 Ga0265320_10003526 3300031240 Bacteria 10475
287 Ga0265320_10003547 3300031240 Bacteria 10445
288 Ga0265320_10003894 3300031240 Bacteria 9870
289 Ga0265320_10004074 3300031240 Bacteria 9600
290 Ga0265320_10052201 3300031240 Bacteria 1981
291 Ga0265320_10061694 3300031240 Bacteria 1787
292 Ga0265325_10001828 3300031241 Bacteria 14706
293 Ga0265325_10067545 3300031241 Bacteria 1801
294 Ga0265325_10120951 3300031241 Bacteria 1262
295 Ga0265329_10000039 3300031242 Bacteria 54196
296 Ga0265340_10000150 3300031247 Bacteria 35902
297 Ga0265340_10005432 3300031247 Bacteria 7079
298 Ga0265340_10007489 3300031247 Bacteria 5926
299 Ga0265340_10010199 3300031247 Bacteria 5032
300 Ga0265340_10011247 3300031247 Bacteria 4765
301 Ga0265340_10031711 3300031247 Bacteria 2641
302 Ga0265339_10000042 3300031249 Bacteria 119235
303 Ga0265339_10007059 3300031249 Bacteria 7293
304 Ga0265339_10010722 3300031249 Bacteria 5677
305 Ga0265339_10016920 3300031249 Bacteria 4332
306 Ga0265339_10020708 3300031249 Bacteria 3838
307 Ga0265331_10000784 3300031250 Bacteria 26462
308 Ga0265316_10000383 3300031344 Bacteria 50345
309 Ga0265316_10015041 3300031344 Bacteria 6782
310 Ga0265316_10026776 3300031344 Bacteria 4789
311 Ga0265316_10030370 3300031344 Bacteria 4431
312 Ga0265316_10044962 3300031344 Bacteria 3508
313 Ga0265316_10054682 3300031344 Unclassified 3125
314 Ga0265316_10070050 3300031344 Bacteria 2706
315 Ga0307513_10039393 3300031456 Bacteria 5239
316 Ga0307513_10126045 3300031456 Bacteria 2516
317 Ga0307509_10038283 3300031507 Bacteria 5234
318 Ga0307509_10093130 3300031507 Bacteria 3077
319 Ga0307509_10114998 3300031507 Bacteria 2684
320 Ga0307408_100000114 3300031548 Bacteria 89451
321 Ga0265313_10030606 3300031595 Bacteria 2768
322 Ga0307508_10036786 3300031616 Bacteria 4407
323 Ga0307514_10000762 3300031649 Bacteria 53648
324 Ga0265314_10000002 3300031711 Bacteria 2092193
325 Ga0265314_10000106 3300031711 Bacteria 126173
326 Ga0265314_10001335 3300031711 Bacteria 27972
327 Ga0265314_10020682 3300031711 Bacteria 5077
328 Ga0265314_10047400 3300031711 Bacteria 3024
329 Ga0265314_10063449 3300031711 Bacteria 2506
330 Ga0265314_10108286 3300031711 Bacteria 1771
331 Ga0265342_10000315 3300031712 Bacteria 55145
332 Ga0265342_10000374 3300031712 Bacteria 49345
333 Ga0265342_10001318 3300031712 Bacteria 23274
334 Ga0265342_10001897 3300031712 Bacteria 18807
335 Ga0265342_10002528 3300031712 Bacteria 15752
336 Ga0265342_10014944 3300031712 Bacteria 5129
337 Ga0265342_10062507 3300031712 Bacteria 2191
338 Ga0316576_10205232 3300031727 Bacteria 1484
339 Ga0307516_10000269 3300031730 Bacteria 66734
340 Ga0307516_10001810 3300031730 Bacteria 29379
341 Ga0307409_100016416 3300031995 Bacteria 4898
342 Ga0307507_10110318 3300033179 Bacteria 2252
343 Ga0373949_0000081 3300035090 Bacteria 35760
344 Ga0373953_0104884 3300035117 Bacteria 1192
345 Ga0373956_0007560 3300035119 Bacteria 4378
346 Ga0373957_0120290 3300035120 Bacteria 1062
347 Ga0373955_0050514 3300035172 Bacteria 2262
348 Ga0373955_0134325 3300035172 Bacteria 1446
349 Ga0316574_0064594 3300035398 Bacteria 2303
350 Ga0373931_0006145 3300035691 Bacteria 5597
351 Ga0373935_0054993 3300035692 Bacteria 2536
352 Ga0373927_0102919 3300035695 Bacteria 1858
353 Ga0373927_0231165 3300035695 Bacteria 1215
354 Ga0373933_0021691 3300035724 Bacteria 3651
355 Ga0373937_0002556 3300036401 Bacteria 15123
356 Ga0373937_0033720 3300036401 Bacteria 4652
357 Ga0373937_0083197 3300036401 Bacteria 2961
358 Ga0373937_0145251 3300036401 Bacteria 2220
359 Ga0373937_0190842 3300036401 Bacteria 1925
360 Ga0373925_0115553 3300037068 Bacteria 2078
361 Ga0395900_0021112 3300037418 Bacteria 6655
362 Ga0395905_0008117 3300037471 Bacteria 10374
363 Ga0395905_0013641 3300037471 Bacteria 7785
364 Ga0395905_0236189 3300037471 Bacteria 1708
365 Ga0436364_1139589 3300037853 Bacteria 1329
366 Ga0395901_0009810 3300038443 Bacteria 9709
367 Ga0436365_0731303 3300039437 Bacteria 1256
368 Ga0436361_0812699 3300039447 Bacteria 2477
369 Ga0436361_1079266 3300039447 Bacteria 7219
370 Ga0451789_1108154 3300041443 Bacteria 1438
371 Ga0451789_1137927 3300041443 Bacteria 2216
372 Ga0451793_0833192 3300041452 Bacteria 2511
373 Ga0451793_1284212 3300041452 Bacteria 1957
374 Ga0451797_0973833 3300041453 Bacteria 1751
375 Ga0451798_0866974 3300041458 Bacteria 5233
376 Ga0451800_0771921 3300041459 Bacteria 2014
377 Ga0451802_0912654 3300041460 Bacteria 1717
378 Ga0451807_0107758 3300041486 Bacteria 3758
379 Ga0451807_0272962 3300041486 Bacteria 7662
380 Ga0451807_1332070 3300041486 Bacteria 6661
381 Ga0451837_0373664 3300041494 Bacteria 1664
382 Ga0450919_000973 3300042121 Bacteria 3706
383 Ga0450918_000697 3300042531 Bacteria 7114
384 Ga0451577_0016728 3300042876 Bacteria 6782
385 Ga0451577_0020310 3300042876 Bacteria 6097
386 Ga0453683_0024830 3300044673 Bacteria 3811
387 Ga0453684_0000012 3300044712 Bacteria 1062512
388 Ga0453684_0002989 3300044712 Bacteria 39341
389 Ga0453684_0019192 3300044712 Bacteria 10424
390 Ga0453684_0056768 3300044712 Bacteria 5075
391 Ga0453684_0062134 3300044712 Bacteria 4786
392 Ga0453684_0177840 3300044712 Bacteria 2500
393 Ga0453684_0209775 3300044712 Unclassified 2265
394 Ga0453684_0249667 3300044712 Bacteria 2038
395 Ga0453684_0257052 3300044712 Bacteria 2003
396 Ga0453684_0267369 3300044712 Bacteria 1956
397 Ga0453684_0340026 3300044712 Bacteria 1695
398 Ga0451576_0020674 3300045051 Bacteria 7164
399 Ga0451576_0030927 3300045051 Bacteria 5712
400 Ga0451576_0044549 3300045051 Bacteria 4677
401 Ga0451576_0068352 3300045051 Bacteria 3697
402 Ga0451576_0452044 3300045051 Bacteria 1349
403 Ga0495641_0030225 3300046461 Bacteria 2601
404 Ga0495664_0100129 3300046477 Bacteria 1745
405 Ga0495583_0000017 3300046506 Bacteria 310888
406 Ga0495606_0002111 3300046507 Bacteria 24140
407 Ga0495606_0116152 3300046507 Bacteria 1608
408 Ga0495616_0022670 3300046513 Bacteria 3388
409 Ga0495628_0129281 3300046516 Bacteria 1933
410 Ga0495630_0068959 3300046517 Bacteria 2660
411 Ga0495632_0001312 3300046519 Bacteria 21028
412 Ga0495666_0087924 3300046526 Bacteria 1468
413 Ga0495652_0120075 3300046529 Archaea 2098
414 Ga0495640_0174145 3300046533 Bacteria 1374
415 Ga0495586_0015839 3300046535 Bacteria 4010
416 Ga0495586_0030927 3300046535 Bacteria 2866
417 Ga0495645_0030924 3300046543 Bacteria 3900
418 Ga0495645_0142811 3300046543 Bacteria 1669
419 Ga0495668_0015331 3300046616 Bacteria 4479
420 Ga0495634_0012196 3300046642 Bacteria 6231
421 Ga0495634_0095827 3300046642 Bacteria 1922
422 Ga0495634_0235910 3300046642 Bacteria 1124
423 Ga0495625_0001602 3300046660 Bacteria 26739
424 Ga0495625_0204698 3300046660 Bacteria 1300
425 Ga0495599_0017257 3300046678 Bacteria 4487
426 Ga0495658_0061501 3300046683 Bacteria 2156
427 Ga0495669_0017624 3300046684 Bacteria 3067
428 Ga0495671_0101781 3300046692 Bacteria 1404
429 Ga0495649_0001065 3300046694 Bacteria 21451
430 Ga0495649_0080478 3300046694 Bacteria 1742
431 Ga0495589_0002147 3300046794 Bacteria 11121
432 Ga0495674_0005648 3300047319 Bacteria 11980
433 Ga0495674_0226426 3300047319 Archaea 1544
434 Ga0495676_0203058 3300047321 Bacteria 1376
435 Ga0495684_0036795 3300047471 Bacteria 3753
436 Ga0495686_0096111 3300047472 Bacteria 1793
437 Ga0496100_0079536 3300048903 Bacteria 2209
438 Ga0496100_0207644 3300048903 Bacteria 1431
439 Ga0496104_0098848 3300048907 Bacteria 2794
440 Ga0496104_0451086 3300048907 Bacteria 1198
441 Ga0496106_0023313 3300048909 Bacteria 4598
442 Ga0496107_0126243 3300048910 Bacteria 1887
443 Ga0496108_0039847 3300048911 Bacteria 3916
444 Ga0496114_0000614 3300048917 Bacteria 26344
445 Ga0496114_0012675 3300048917 Bacteria 6752
446 Ga0496114_0026155 3300048917 Bacteria 4776
447 Ga0501041_0217168 3300049577 Bacteria 1200
448 Ga0501042_0016970 3300049578 Bacteria 5012
449 Ga0501042_0253902 3300049578 Bacteria 1269
450 Ga0501067_0012588 3300049583 Bacteria 4695
451 Ga0501071_0219362 3300049587 Bacteria 1431
452 Ga0501073_0014417 3300049589 Bacteria 5743
453 Ga0501073_0014656 3300049589 Bacteria 5695
454 Ga0501073_0044547 3300049589 Bacteria 3127
455 Ga0501074_0049080 3300049590 Bacteria 3048
456 Ga0501080_0089155 3300049742 Bacteria 2865
457 Ga0501080_0132659 3300049742 Bacteria 2306
458 Ga0501083_0009607 3300049744 Bacteria 6834
459 nmdc:mga0k408_125085_c1 3300050493 Bacteria 1525
460 nmdc:mga0k408_1382_c1 3300050493 Bacteria 5819
461 nmdc:mga0k408_63376_c1 3300050493 Bacteria 2150
462 nmdc:mga06z11_121974_c1 3300050494 Bacteria 1455
463 nmdc:mga05p37_461_c1 3300050507 Bacteria 44218
464 nmdc:mga09592_1973_c1 3300050508 Bacteria 16541
465 nmdc:mga09592_62469_c1 3300050508 Bacteria 3151
466 nmdc:mga08y16_10308_c1 3300050511 Bacteria 9809
467 nmdc:mga0a205_275967_c1 3300050515 Bacteria 1557
468 Ga0500578_0000666 3300053086 Bacteria 41075
469 Ga0500646_0055159 3300053090 Bacteria 1156
470 Ga0500651_0095731 3300053093 Bacteria 1825
471 Ga0500566_0018899 3300053094 Bacteria 4046
472 Ga0500654_103864 3300053099 Bacteria 1198
473 Ga0500555_000818 3300053103 Bacteria 11167
474 Ga0500597_000747 3300053120 Bacteria 7349
475 Ga0500642_0010924 3300053130 Bacteria 3225
476 Ga0500642_0062017 3300053130 Bacteria 1681
477 Ga0500652_001214 3300053131 Bacteria 8215
478 Ga0500568_0030906 3300053139 Bacteria 2214
479 Ga0500616_0000549 3300053153 Bacteria 46665
480 Ga0500622_0003395 3300053156 Bacteria 10710
481 Ga0500638_147858 3300053162 Bacteria 1048
482 Ga0500639_096423 3300053163 Bacteria 1464
483 Ga0500636_0037643 3300053177 Bacteria 2862
484 Ga0500584_052247 3300053726 Bacteria 1845
485 Ga0500645_002994 3300053730 Bacteria 7153
486 Ga0500587_000264 3300053739 Bacteria 5738
487 Ga0501084_0081018 3300054114 Bacteria 2722
488 Ga0590075_048711 3300059424 Bacteria 1087
489 Ga0590077_018742 3300059426 Bacteria 1462
490 2599021412 2597490337 Archaea 2364912
491 2587727454 2585428057 Bacteria 6737412
492 2587735373 2585428058 Bacteria 6853932
493 2587758764 2585428062 Bacteria 6842168
494 2588295062 2588253510 Bacteria 6901809
495 2643971563 2643221592 Bacteria 6608788
496 2644141098 2643221625 Bacteria 6512927
497 2644247952 2643221644 Bacteria 6865017
498 2644276890 2643221648 Bacteria 6521465
499 Ga0590071_000748
500 JGI25156J39149_1000060
501 JGI25154J39366_1000540
502 JGI25157J39369_1000029
503 JGI25152J39213_1002286
504 JGI25153J46596_10000333
505 JGI25153J46596_10011832
506 rootH1_10010673
507 rootH1_10010674
508 rootL2_10278450
509 rootH1_10052226
510 rootH1_10089266
511 rootH1_10152242
512 rootH1_10190425
513 Ga0055526_1000608
514 Ga0055524_1000203
515 Ga0055530_10002233
516 Ga0055540_1000023
517 Ga0055540_1019694
518 Ga0055531_10008652
519 Ga0065165_1001800
520 Ga0070658_10109551
521 Ga0070683_100112673
522 Ga0070683_100274460
523 Ga0070683_100361632
524 Ga0070690_100006493
525 Ga0070690_100006677
526 Ga0070670_100008860
527 Ga0068869_100074385
528 Ga0068869_100116796
529 Ga0068869_100164980
530 Ga0070680_100000445
531 Ga0070682_100002871
532 Ga0070682_100073702
533 Ga0070682_100093388
534 Ga0068868_100217471
535 Ga0070660_100009700
536 Ga0070691_10115908
537 Ga0070687_100019252
538 Ga0070661_100197971
539 Ga0070669_100232456
540 Ga0070671_100024988
541 Ga0070674_100001783
542 Ga0070673_100293376
543 Ga0070659_100023026
544 Ga0070659_100117814
545 Ga0070667_100020995
546 Ga0070713_100058834
547 Ga0070701_10037389
548 Ga0070705_100255679
549 Ga0070694_100155852
550 Ga0070678_100027507
551 Ga0070681_10000067
552 Ga0070681_10035909
553 Ga0070681_10113296
554 Ga0070681_10247658
555 Ga0068867_100000058
556 Ga0070706_100017311
557 Ga0070707_100013117
558 Ga0070698_100004327
559 Ga0070698_100040830
560 Ga0070698_100089525
561 Ga0070699_100047030
562 Ga0070699_100496466
563 Ga0070679_100000055
564 Ga0070679_100013547
565 Ga0070684_100006742
566 Ga0070684_100054782
567 Ga0070684_100185308
568 Ga0070697_100043246
569 Ga0070672_100048593
570 Ga0070672_100212763
571 Ga0070686_100237650
572 Ga0070686_100247249
573 Ga0070695_100147934
574 Ga0070696_100291439
575 Ga0068855_100002106
576 Ga0068855_100003757
577 Ga0068855_100028849
578 Ga0068855_100043210
579 Ga0068855_100180363
580 Ga0068857_100000097
581 Ga0068857_100014171
582 Ga0068857_100403821
583 Ga0068854_100007883
584 Ga0068856_100103664
585 Ga0068856_100133870
586 Ga0070702_100003595
587 Ga0070702_100042598
588 Ga0068852_100048670
589 Ga0068859_100028125
590 Ga0068859_100109272
591 Ga0068859_100279136
592 Ga0068864_100013413
593 Ga0068861_100006534
594 Ga0068861_100011051
595 Ga0068861_100108968
596 Ga0068861_100115651
597 Ga0068863_100025889
598 Ga0068863_100038450
599 Ga0068863_100042658
600 Ga0068863_100316159
601 Ga0068858_100069858
602 Ga0068860_100075281
603 Ga0068860_100082750
604 Ga0070717_10120651
605 Ga0070716_100000007
606 Ga0075366_10008135
607 Ga0075366_10038791
608 Ga0097621_100011109
609 Ga0097621_100265955
610 Ga0068871_100002231
611 Ga0068871_100300884
612 Ga0075428_100030342
613 Ga0075429_100062518
614 Ga0097620_100028125
615 Ga0097620_100109274
616 Ga0097620_100279133
617 Ga0079104_1000273
618 Ga0105240_10003216
619 Ga0105240_10029073
620 Ga0111539_10248705
621 Ga0105245_10002289
622 Ga0105245_10158127
623 Ga0105245_10332068
624 Ga0114129_10072978
625 Ga0114129_10360209
626 Ga0114129_10808424
627 Ga0105243_10006273
628 Ga0105243_10006803
629 Ga0105243_10429539
630 Ga0105241_10012649
631 Ga0105241_10127645
632 Ga0105241_10396415
633 Ga0105248_10047890
634 Ga0105237_10067073
635 Ga0105238_10003035
636 Ga0105239_10106603
637 Ga0105239_10344514
638 Ga0105246_10033030
639 Ga0105246_10189449
640 Ga0157369_10330933
641 Ga0157374_10153038
642 Ga0157378_10023275
643 Ga0157378_10227765
644 Ga0157375_10152790
645 Ga0157380_10215689
646 Ga0157377_10000092
647 Ga0157377_10018526
648 Ga0157376_10011888
649 Ga0157376_10059378
650 Ga0157376_10092308
651 Ga0163161_10041810
652 Ga0207427_100324
653 Ga0209258_100660
654 Ga0207425_1000167
655 Ga0209646_1000111
656 Ga0209026_1000054
657 Ga0209677_100105
658 Ga0209677_102438
659 Ga0209759_1000043
660 Ga0209759_1001974
661 Ga0209759_1011374
662 Ga0209129_1000154
663 Ga0209673_1010409
664 Ga0209673_1015388
665 Ga0209675_1011902
666 Ga0209564_1000445
667 Ga0209758_1000226
668 Ga0209758_1000338
669 Ga0209050_1000748
670 Ga0209050_1000783
671 Ga0209050_1024178
672 Ga0209256_1000024
673 Ga0209256_1013398
674 Ga0209051_1000079
675 Ga0209051_1000808
676 Ga0209051_1011807
677 Ga0209257_1000183
678 Ga0207680_10102909
679 Ga0207684_10006757
680 Ga0207684_10035566
681 Ga0207654_10010606
682 Ga0207654_10110458
683 Ga0207707_10000003
684 Ga0207707_10047634
685 Ga0207695_10009981
686 Ga0207695_10057045
687 Ga0207695_10208303
688 Ga0207695_10292425
689 Ga0207695_10390670
690 Ga0207671_10027728
691 Ga0207671_10063286
692 Ga0207693_10297010
693 Ga0207660_10000449
694 Ga0207662_10008532
695 Ga0207662_10016463
696 Ga0207657_10025444
697 Ga0207652_10000111
698 Ga0207652_10040495
699 Ga0207646_10016303
700 Ga0207694_10001305
701 Ga0207694_10004991
702 Ga0207687_10002013
703 Ga0207687_10024900
704 Ga0207644_10466240
705 Ga0207686_10052127
706 Ga0207709_10046681
707 Ga0207670_10000013
708 Ga0207670_10002264
709 Ga0207670_10086829
710 Ga0207669_10012477
711 Ga0207669_10306226
712 Ga0207665_10000018
713 Ga0207691_10004845
714 Ga0207691_10032424
715 Ga0207711_10528210
716 Ga0207689_10003548
717 Ga0207689_10020376
718 Ga0207689_10140445
719 Ga0207661_10000570
720 Ga0207661_10095911
721 Ga0207661_10167383
722 Ga0207661_10264234
723 Ga0207661_10329378
724 Ga0207679_10353867
725 Ga0207667_10000835
726 Ga0207667_10007769
727 Ga0207667_10521130
728 Ga0207651_10054343
729 Ga0207640_10045251
730 Ga0207678_10092705
731 Ga0207708_10062866
732 Ga0207702_10000946
733 Ga0207702_10205545
734 Ga0207641_10013701
735 Ga0207641_10053900
736 Ga0207648_10000164
737 Ga0207648_10057614
738 Ga0207648_10105606
739 Ga0207676_10009777
740 Ga0207676_10075709
741 Ga0207674_10004499
742 Ga0207674_10004696
743 Ga0207675_100000765
744 Ga0207675_100002481
745 Ga0207675_100003378
746 Ga0207675_100244170
747 Ga0209281_1000135
748 Ga0209974_10011028
749 Ga0268266_10293140
750 Ga0268266_10306052
751 Ga0268264_10143187
752 Ga0268264_10168259
753 Ga0265337_1032477
754 Ga0265326_10004446
755 Ga0265326_10012600
756 Ga0265319_1000351
757 Ga0265319_1004043
758 Ga0265319_1009789
759 Ga0265334_10034404
760 Ga0265334_10049754
761 Ga0265318_10005409
762 Ga0265323_10029122
763 Ga0265322_10015060
764 Ga0265336_10000008
765 Ga0265336_10000300
766 Ga0307517_10064160
767 Ga0307517_10094049
768 Ga0307515_10000139
769 Ga0307515_10019192
770 Ga0307515_10025988
771 Ga0265338_10000388
772 Ga0265338_10004894
773 Ga0265338_10039130
774 Ga0265338_10064725
775 Ga0265338_10114717
776 Ga0265324_10005636
777 Ga0307512_10015107
778 Ga0265330_10002208
779 Ga0265330_10022755
780 Ga0265332_10016968
781 Ga0265328_10003648
782 Ga0265320_10000650
783 Ga0265320_10003526
784 Ga0265320_10003547
785 Ga0265320_10003894
786 Ga0265320_10004074
787 Ga0265320_10052201
788 Ga0265320_10061694
789 Ga0265325_10001828
790 Ga0265325_10067545
791 Ga0265325_10120951
792 Ga0265329_10000039
793 Ga0265340_10000150
794 Ga0265340_10005432
795 Ga0265340_10007489
796 Ga0265340_10010199
797 Ga0265340_10011247
798 Ga0265340_10031711
799 Ga0265339_10000042
800 Ga0265339_10007059
801 Ga0265339_10010722
802 Ga0265339_10016920
803 Ga0265339_10020708
804 Ga0265331_10000784
805 Ga0265316_10000383
806 Ga0265316_10015041
807 Ga0265316_10026776
808 Ga0265316_10030370
809 Ga0265316_10044962
810 Ga0265316_10054682
811 Ga0265316_10070050
812 Ga0307513_10039393
813 Ga0307513_10126045
814 Ga0307509_10038283
815 Ga0307509_10093130
816 Ga0307509_10114998
817 Ga0307408_100000114
818 Ga0265313_10030606
819 Ga0307508_10036786
820 Ga0307514_10000762
821 Ga0265314_10000002
822 Ga0265314_10000106
823 Ga0265314_10001335
824 Ga0265314_10020682
825 Ga0265314_10047400
826 Ga0265314_10063449
827 Ga0265314_10108286
828 Ga0265342_10000315
829 Ga0265342_10000374
830 Ga0265342_10001318
831 Ga0265342_10001897
832 Ga0265342_10002528
833 Ga0265342_10014944
834 Ga0265342_10062507
835 Ga0316576_10205232
836 Ga0307516_10000269
837 Ga0307516_10001810
838 Ga0307409_100016416
839 Ga0307507_10110318
840 Ga0373949_0000081
841 Ga0373953_0104884
842 Ga0373956_0007560
843 Ga0373957_0120290
844 Ga0373955_0050514
845 Ga0373955_0134325
846 Ga0316574_0064594
847 Ga0373931_0006145
848 Ga0373935_0054993
849 Ga0373927_0102919
850 Ga0373927_0231165
851 Ga0373933_0021691
852 Ga0373937_0002556
853 Ga0373937_0033720
854 Ga0373937_0083197
855 Ga0373937_0145251
856 Ga0373937_0190842
857 Ga0373925_0115553
858 Ga0395900_0021112
859 Ga0395905_0008117
860 Ga0395905_0013641
861 Ga0395905_0236189
862 Ga0436364_1139589
863 Ga0395901_0009810
864 Ga0436365_0731303
865 Ga0436361_0812699
866 Ga0436361_1079266
867 Ga0451789_1108154
868 Ga0451789_1137927
869 Ga0451793_0833192
870 Ga0451793_1284212
871 Ga0451797_0973833
872 Ga0451798_0866974
873 Ga0451800_0771921
874 Ga0451802_0912654
875 Ga0451807_0107758
876 Ga0451807_0272962
877 Ga0451807_1332070
878 Ga0451837_0373664
879 Ga0450919_000973
880 Ga0450918_000697
881 Ga0451577_0016728
882 Ga0451577_0020310
883 Ga0453683_0024830
884 Ga0453684_0000012
885 Ga0453684_0002989
886 Ga0453684_0019192
887 Ga0453684_0056768
888 Ga0453684_0062134
889 Ga0453684_0177840
890 Ga0453684_0209775
891 Ga0453684_0249667
892 Ga0453684_0257052
893 Ga0453684_0267369
894 Ga0453684_0340026
895 Ga0451576_0020674
896 Ga0451576_0030927
897 Ga0451576_0044549
898 Ga0451576_0068352
899 Ga0451576_0452044
900 Ga0495641_0030225
901 Ga0495664_0100129
902 Ga0495583_0000017
903 Ga0495606_0002111
904 Ga0495606_0116152
905 Ga0495616_0022670
906 Ga0495628_0129281
907 Ga0495630_0068959
908 Ga0495632_0001312
909 Ga0495666_0087924
910 Ga0495652_0120075
911 Ga0495640_0174145
912 Ga0495586_0015839
913 Ga0495586_0030927
914 Ga0495645_0030924
915 Ga0495645_0142811
916 Ga0495668_0015331
917 Ga0495634_0012196
918 Ga0495634_0095827
919 Ga0495634_0235910
920 Ga0495625_0001602
921 Ga0495625_0204698
922 Ga0495599_0017257
923 Ga0495658_0061501
924 Ga0495669_0017624
925 Ga0495671_0101781
926 Ga0495649_0001065
927 Ga0495649_0080478
928 Ga0495589_0002147
929 Ga0495674_0005648
930 Ga0495674_0226426
931 Ga0495676_0203058
932 Ga0495684_0036795
933 Ga0495686_0096111
934 Ga0496100_0079536
935 Ga0496100_0207644
936 Ga0496104_0098848
937 Ga0496104_0451086
938 Ga0496106_0023313
939 Ga0496107_0126243
940 Ga0496108_0039847
941 Ga0496114_0000614
942 Ga0496114_0012675
943 Ga0496114_0026155
944 Ga0501041_0217168
945 Ga0501042_0016970
946 Ga0501042_0253902
947 Ga0501067_0012588
948 Ga0501071_0219362
949 Ga0501073_0014417
950 Ga0501073_0014656
951 Ga0501073_0044547
952 Ga0501074_0049080
953 Ga0501080_0089155
954 Ga0501080_0132659
955 Ga0501083_0009607
956 nmdc:mga0k408_125085_c1
957 nmdc:mga0k408_1382_c1
958 nmdc:mga0k408_63376_c1
959 nmdc:mga06z11_121974_c1
960 nmdc:mga05p37_461_c1
961 nmdc:mga09592_1973_c1
962 nmdc:mga09592_62469_c1
963 nmdc:mga08y16_10308_c1
964 nmdc:mga0a205_275967_c1
965 Ga0500578_0000666
966 Ga0500646_0055159
967 Ga0500651_0095731
968 Ga0500566_0018899
969 Ga0500654_103864
970 Ga0500555_000818
971 Ga0500597_000747
972 Ga0500642_0010924
973 Ga0500642_0062017
974 Ga0500652_001214
975 Ga0500568_0030906
976 Ga0500616_0000549
977 Ga0500622_0003395
978 Ga0500638_147858
979 Ga0500639_096423
980 Ga0500636_0037643
981 Ga0500584_052247
982 Ga0500645_002994
983 Ga0500587_000264
984 Ga0501084_0081018
985 Ga0590075_048711
986 Ga0590077_018742
987 2599021412
988 2587727454
989 2587735373
990 2587758764
991 2588295062
992 2643971563
993 2644141098
994 2644247952
995 2644276890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

15

314

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.8793 1 314
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8629 3 298
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8608 3 298
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.8591 1 319
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8582 1 315
ID Description Score Start End Superfamily
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8603 1 314 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8582 1 315 3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8556 1 118 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8533 1 222 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8511 1 319 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A535T9U4-F1-model_v4 Aldo/keto reductase 0.9955 56 327 GO:0005829
AF-A0A3N5G015-F1-model_v4 Aldo/keto reductase 0.9945 72 327 GO:0005829
AF-A0A1Q6YBF3-F1-model_v4 Aldo/keto reductase 0.9926 1 272 GO:0016491
AF-X1PRV2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9926 153 327
AF-A0A7C7K133-F1-model_v4 Aldo/keto reductase 0.9916 113 327

Map