F455126

General Info

Members Datasets Scaffolds Average Seq Length
497 396 994 213

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2874123672|2874125756
Length 240
Sequence HDDEGLAQYSSPPCFMHELDPEFRVPLSDWSEVKRWRKAERERLIAARLAVAADARAAMSQRIAEGLDTLIGDIDGRMVSLYWPFRGEPDLRPWMASINARGGRTALPVVIDKGQPLVFRGYAQGDRLEKGVWNIPIPAEGDPVLPDIVISPIVGIDPQHYRLGYGGGFFDRTLAAMPFKPLVIGVGYELQRIATIYPQPHDIPMDRVVTELSNPSRVCLKTRSAEADGVVFENRSGADF

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
93 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
128 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
129 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
130 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
131 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
132 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
133 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
134 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
135 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
136 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
137 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
138 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
139 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
140 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
141 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
142 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
143 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
144 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
145 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
146 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
147 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
148 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
149 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
150 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
151 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
152 2738543024 Aminobacter sp. AP02 Isolate Unclassified
153 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
154 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
155 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
156 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
157 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
158 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
159 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
160 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
161 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
162 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
163 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
164 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
165 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
166 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
167 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
168 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
169 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
170 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
171 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
172 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
173 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
174 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
175 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
176 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
177 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
178 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
179 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
180 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
181 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
182 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
183 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
184 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
185 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
186 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
187 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
188 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
189 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
190 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
191 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
192 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
193 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
194 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
195 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
196 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
197 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
198 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
199 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
200 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
201 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
202 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
203 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
204 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
205 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
206 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
207 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
208 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
209 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
210 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
211 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
212 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
213 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
214 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
215 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
216 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
217 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
218 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
219 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
220 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
221 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
222 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
223 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
224 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
225 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
226 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
227 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
228 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
229 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
230 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
231 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
232 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
233 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
234 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
235 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
236 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
237 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
238 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
239 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
240 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
241 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
242 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
243 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
244 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
245 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
246 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
247 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
248 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
249 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
250 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
251 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
252 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
253 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
254 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
255 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
256 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
257 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
258 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
259 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
260 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
261 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
262 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
263 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
264 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
265 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
266 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
267 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
268 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
269 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
270 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
271 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
272 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
273 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
274 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
275 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
276 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
277 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
278 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
279 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
280 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
281 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
282 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
283 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
284 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
285 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
286 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
287 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
288 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
289 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
290 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
291 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
292 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
293 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
294 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
295 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
296 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
297 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
298 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
299 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
300 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
301 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
302 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
303 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
304 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
305 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
306 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
307 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
308 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
309 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
310 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
311 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
312 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
313 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
314 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
315 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
316 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
317 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
318 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
319 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
320 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
321 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
322 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
323 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
324 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
325 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
326 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
327 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
328 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
329 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
330 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
331 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
332 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
333 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
334 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
335 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
336 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
337 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
338 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
339 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
340 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
341 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
342 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
343 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
344 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
345 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
346 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
347 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
348 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
349 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
350 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
351 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
352 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
353 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
354 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
355 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
356 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
357 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
358 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
359 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
360 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
361 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
362 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
363 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
364 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
365 3004167301 Mesorhizobium loti 582 Isolate Unclassified
366 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
367 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
368 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
369 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
370 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
371 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
372 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
373 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
374 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
375 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
376 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
377 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
378 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
379 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
380 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
381 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
382 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
383 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
384 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
385 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
386 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
387 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
388 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
389 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
390 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
391 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
392 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
393 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
394 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
395 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
396 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 46.48
Metatranscriptomes 0
Isolates 53.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.06
Nodule 46.08
Rhizoplane 1.01
Rhizosphere 34.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1004205 3300002705 Bacteria 4442
2 JGI25157J39369_1001164 3300002741 Bacteria 11280
3 rootH1_10088124 3300003323 Bacteria 1146
4 Ga0055529_1003056 3300003763 Bacteria 2925
5 Ga0070658_10315927 3300005327 Bacteria 1333
6 Ga0070683_100218698 3300005329 Bacteria 1810
7 Ga0070660_100107769 3300005339 Bacteria 2214
8 Ga0070661_100040925 3300005344 Bacteria 3381
9 Ga0070661_100731687 3300005344 Bacteria 808
10 Ga0070674_100303197 3300005356 Bacteria 1274
11 Ga0070659_100092779 3300005366 Bacteria 2422
12 Ga0070659_100656265 3300005366 Bacteria 905
13 Ga0070663_100411129 3300005455 Bacteria 1108
14 Ga0068867_100226494 3300005459 Bacteria 1509
15 Ga0070706_100447722 3300005467 Bacteria 1202
16 Ga0070679_100565944 3300005530 Bacteria 1080
17 Ga0070684_100084386 3300005535 Bacteria 2815
18 Ga0068853_100179647 3300005539 Bacteria 1919
19 Ga0068853_100575205 3300005539 Bacteria 1069
20 Ga0070665_100043221 3300005548 Bacteria 4529
21 Ga0070665_100054833 3300005548 Bacteria 3998
22 Ga0070665_100119898 3300005548 Bacteria 2633
23 Ga0070665_100142084 3300005548 Bacteria 2404
24 Ga0070665_100224660 3300005548 Bacteria 1878
25 Ga0068855_100062162 3300005563 Bacteria 4360
26 Ga0068855_100164315 3300005563 Bacteria 2517
27 Ga0068855_100476196 3300005563 Bacteria 1360
28 Ga0070664_100065795 3300005564 Bacteria 3094
29 Ga0068856_100142459 3300005614 Bacteria 2404
30 Ga0068852_100171812 3300005616 Bacteria 2032
31 Ga0068852_100457334 3300005616 Bacteria 1265
32 Ga0068859_100574706 3300005617 Bacteria 1221
33 Ga0068864_100208626 3300005618 Bacteria 1798
34 Ga0081455_10029008 3300005937 Bacteria 5049
35 Ga0075365_10012266 3300006038 Bacteria 5081
36 Ga0075365_10067047 3300006038 Bacteria 2409
37 Ga0075365_10255303 3300006038 Bacteria 1232
38 Ga0075368_10035433 3300006042 Bacteria 1947
39 Ga0075368_10079797 3300006042 Bacteria 1330
40 Ga0075363_100053161 3300006048 Bacteria 2164
41 Ga0075363_100138230 3300006048 Bacteria 1370
42 Ga0075363_100286842 3300006048 Bacteria 953
43 Ga0075364_10069370 3300006051 Bacteria 2319
44 Ga0075364_10091186 3300006051 Bacteria 2022
45 Ga0075362_10038312 3300006177 Bacteria 2106
46 Ga0075362_10205909 3300006177 Bacteria 959
47 Ga0075367_10099714 3300006178 Bacteria 1774
48 Ga0075367_10101562 3300006178 Bacteria 1759
49 Ga0075369_10007257 3300006186 Bacteria 4215
50 Ga0075369_10140712 3300006186 Bacteria 1100
51 Ga0075366_10123951 3300006195 Bacteria 1558
52 Ga0097621_100459363 3300006237 Bacteria 1148
53 Ga0075370_10108322 3300006353 Bacteria 1612
54 Ga0097620_100574625 3300006931 Bacteria 1221
55 Ga0105240_10177831 3300009093 Bacteria 2514
56 Ga0105240_10303524 3300009093 Bacteria 1826
57 Ga0105240_10665674 3300009093 Bacteria 1139
58 Ga0105243_10227724 3300009148 Bacteria 1652
59 Ga0105237_10028343 3300009545 Bacteria 5706
60 Ga0105237_10120114 3300009545 Bacteria 2622
61 Ga0105237_10257973 3300009545 Bacteria 1746
62 Ga0105238_10010408 3300009551 Bacteria 9336
63 Ga0105238_10123148 3300009551 Bacteria 2572
64 Ga0105238_10550480 3300009551 Bacteria 1158
65 Ga0105239_10122092 3300010375 Bacteria 2894
66 Ga0105239_10789596 3300010375 Bacteria 1088
67 Ga0157371_10523500 3300013102 Bacteria 877
68 Ga0157370_10101547 3300013104 Bacteria 2694
69 Ga0157370_10137997 3300013104 Bacteria 2272
70 Ga0157369_10109919 3300013105 Bacteria 2931
71 Ga0157378_10246898 3300013297 Bacteria 1707
72 Ga0163163_10231624 3300014325 Bacteria 1896
73 Ga0157379_10467818 3300014968 Bacteria 1166
74 Ga0157376_10229069 3300014969 Bacteria 1725
75 Ga0209026_1000002 3300025250 Bacteria 1136158
76 Ga0209148_1000038 3300025254 Bacteria 493744
77 Ga0209759_1000119 3300025256 Bacteria 141051
78 Ga0209233_1000625 3300025261 Bacteria 17770
79 Ga0209233_1004929 3300025261 Bacteria 4490
80 Ga0209455_1000204 3300025272 Bacteria 85420
81 Ga0209758_1004234 3300025297 Bacteria 12146
82 Ga0207426_1013264 3300025302 Bacteria 3060
83 Ga0207647_10036303 3300025904 Bacteria 3133
84 Ga0207654_10412887 3300025911 Bacteria 941
85 Ga0207695_10001421 3300025913 Bacteria 40289
86 Ga0207695_10382064 3300025913 Bacteria 1294
87 Ga0207671_10217701 3300025914 Bacteria 1495
88 Ga0207671_10291768 3300025914 Bacteria 1288
89 Ga0207657_10046718 3300025919 Bacteria 3791
90 Ga0207657_10804066 3300025919 Bacteria 727
91 Ga0207649_10242238 3300025920 Bacteria 1295
92 Ga0207694_10280247 3300025924 Bacteria 1369
93 Ga0207679_10078931 3300025945 Bacteria 2509
94 Ga0207678_10290841 3300026067 Bacteria 1403
95 Ga0207702_10735579 3300026078 Bacteria 973
96 Ga0207648_10415121 3300026089 Bacteria 1221
97 Ga0207674_10629602 3300026116 Bacteria 1036
98 Ga0207698_10218775 3300026142 Bacteria 1719
99 Ga0207698_10292678 3300026142 Bacteria 1512
100 Ga0268266_10079619 3300028379 Bacteria 2853
101 Ga0268266_10160055 3300028379 Bacteria 2036
102 Ga0395899_0063073 3300037312 Bacteria 2727
103 Ga0395899_0114055 3300037312 Bacteria 1941
104 Ga0395899_0341428 3300037312 Bacteria 1004
105 Ga0395899_0416446 3300037312 Bacteria 886
106 Ga0395900_0002013 3300037418 Bacteria 22906
107 Ga0395900_0044547 3300037418 Bacteria 4571
108 Ga0395900_0120865 3300037418 Bacteria 2687
109 Ga0395900_0565647 3300037418 Bacteria 1080
110 Ga0395900_0594753 3300037418 Bacteria 1047
111 Ga0395900_0656328 3300037418 Bacteria 985
112 Ga0395898_0124437 3300037466 Bacteria 2470
113 Ga0395898_0299292 3300037466 Bacteria 1535
114 Ga0395898_0909125 3300037466 Bacteria 818
115 Ga0395905_0130449 3300037471 Bacteria 2364
116 Ga0395905_0269327 3300037471 Bacteria 1589
117 Ga0395905_0562894 3300037471 Bacteria 1041
118 Ga0395901_0002160 3300038443 Bacteria 20081
119 Ga0395901_0009565 3300038443 Bacteria 9835
120 Ga0395901_0228294 3300038443 Bacteria 1944
121 Ga0395901_0802045 3300038443 Bacteria 930
122 Ga0439465_0150499 3300041413 Bacteria 831
123 Ga0439458_0047467 3300042157 Bacteria 1054
124 Ga0466963_0026066 3300044694 Bacteria 3737
125 Ga0466960_0242760 3300044901 Bacteria 998
126 Ga0495597_0095856 3300046542 Bacteria 1255
127 Ga0495668_0032117 3300046616 Bacteria 2956
128 Ga0495625_0021704 3300046660 Bacteria 4937
129 Ga0495635_0419507 3300046663 Bacteria 887
130 Ga0495674_0712308 3300047319 Bacteria 787
131 Ga0495687_082420 3300047443 Bacteria 1256
132 Ga0495602_0542490 3300048088 Bacteria 807
133 Ga0495626_0259997 3300048091 Bacteria 694
134 Ga0496102_0289478 3300048905 Bacteria 1544
135 Ga0496103_0593433 3300048906 Bacteria 706
136 Ga0496104_1012195 3300048907 Bacteria 735
137 Ga0496112_0042943 3300048915 Bacteria 4425
138 Ga0496119_0026156 3300048922 Bacteria 4054
139 Ga0496119_0256235 3300048922 Bacteria 880
140 Ga0496120_0003364 3300048923 Bacteria 14675
141 Ga0496125_0096406 3300048928 Bacteria 2196
142 Ga0496126_0049080 3300048929 Bacteria 3855
143 Ga0496126_0118888 3300048929 Bacteria 2294
144 Ga0501031_0000202 3300049568 Bacteria 33947
145 Ga0501031_0011232 3300049568 Bacteria 5835
146 Ga0501032_0000443 3300049569 Bacteria 33947
147 Ga0501032_0018481 3300049569 Bacteria 4882
148 Ga0501033_0000097 3300049570 Bacteria 83228
149 Ga0501033_0041854 3300049570 Bacteria 3416
150 Ga0501033_0164409 3300049570 Bacteria 1596
151 Ga0501033_0203098 3300049570 Bacteria 1415
152 Ga0501033_0224655 3300049570 Bacteria 1335
153 Ga0501033_0308950 3300049570 Bacteria 1112
154 Ga0501034_0000186 3300049571 Bacteria 116500
155 Ga0501034_0000883 3300049571 Bacteria 43964
156 Ga0501034_0002372 3300049571 Bacteria 22880
157 Ga0501034_0002798 3300049571 Bacteria 20405
158 Ga0501034_0024097 3300049571 Bacteria 6191
159 Ga0501034_0045710 3300049571 Bacteria 4423
160 Ga0501034_0048069 3300049571 Bacteria 4306
161 Ga0501034_0217254 3300049571 Bacteria 1865
162 Ga0501034_0482085 3300049571 Bacteria 1155
163 Ga0501036_0000002 3300049572 Bacteria 293106
164 Ga0501036_0015868 3300049572 Bacteria 6290
165 Ga0501037_0000443 3300049573 Bacteria 33927
166 Ga0501037_0102206 3300049573 Bacteria 2067
167 Ga0501038_0000002 3300049574 Bacteria 330446
168 Ga0501038_0024080 3300049574 Bacteria 5433
169 Ga0501038_0291895 3300049574 Bacteria 1281
170 Ga0501039_0000002 3300049575 Bacteria 375152
171 Ga0501039_0033679 3300049575 Bacteria 3951
172 Ga0501040_0002065 3300049576 Bacteria 12945
173 Ga0501040_0146910 3300049576 Bacteria 1662
174 Ga0501043_0000543 3300049579 Bacteria 33914
175 Ga0501043_0017000 3300049579 Bacteria 5702
176 Ga0501043_0295852 3300049579 Bacteria 1238
177 Ga0501046_0020274 3300049580 Bacteria 5501
178 Ga0501047_0002238 3300049581 Bacteria 18520
179 Ga0501047_0002948 3300049581 Bacteria 16125
180 Ga0501047_0115522 3300049581 Bacteria 2566
181 Ga0501047_0390409 3300049581 Bacteria 1225
182 Ga0501068_0122945 3300049584 Bacteria 1619
183 Ga0501070_0003059 3300049586 Bacteria 14564
184 Ga0501070_0008443 3300049586 Bacteria 8699
185 Ga0501070_0057177 3300049586 Bacteria 3233
186 Ga0501071_0285806 3300049587 Bacteria 1248
187 Ga0501072_0311738 3300049588 Bacteria 1251
188 Ga0501073_0033080 3300049589 Bacteria 3684
189 Ga0501074_0027600 3300049590 Bacteria 4116
190 Ga0501074_0056177 3300049590 Bacteria 2837
191 Ga0501079_0444188 3300049741 Bacteria 1018
192 Ga0501080_0086653 3300049742 Bacteria 2910
193 Ga0501080_0113647 3300049742 Bacteria 2510
194 Ga0501035_0000100 3300049822 Bacteria 107321
195 Ga0501035_0010431 3300049822 Bacteria 8612
196 Ga0501035_0044924 3300049822 Bacteria 3975
197 Ga0501035_0218185 3300049822 Bacteria 1629
198 Ga0501035_0339813 3300049822 Bacteria 1258
199 Ga0501035_0384296 3300049822 Bacteria 1170
200 Ga0501044_0000002 3300049823 Bacteria 375152
201 Ga0501044_0039724 3300049823 Bacteria 4906
202 Ga0501044_0213019 3300049823 Bacteria 1885
203 Ga0501044_0485235 3300049823 Bacteria 1138
204 Ga0501045_0034234 3300049824 Bacteria 3686
205 nmdc:mga03683_127883_c1 3300050489 Bacteria 1135
206 nmdc:mga03683_83481_c1 3300050489 Bacteria 1383
207 nmdc:mga03n38_106623_c1 3300050490 Bacteria 1359
208 nmdc:mga03n38_160457_c1 3300050490 Bacteria 1138
209 nmdc:mga03n38_92813_c1 3300050490 Bacteria 1441
210 nmdc:mga00v17_80255_c1 3300050491 Bacteria 2036
211 nmdc:mga00v17_84405_c1 3300050491 Bacteria 1988
212 nmdc:mga0yw44_187212_c1 3300050492 Bacteria 1364
213 nmdc:mga0yw44_42472_c1 3300050492 Bacteria 2711
214 nmdc:mga0yw44_43317_c1 3300050492 Bacteria 2687
215 nmdc:mga0yw44_49807_c1 3300050492 Bacteria 2530
216 nmdc:mga0yw44_54336_c1 3300050492 Bacteria 2434
217 nmdc:mga0yw44_73165_c1 3300050492 Bacteria 2132
218 nmdc:mga0k408_154330_c1 3300050493 Bacteria 1367
219 nmdc:mga06z11_158043_c1 3300050494 Bacteria 1294
220 nmdc:mga06z11_198927_c1 3300050494 Bacteria 1163
221 nmdc:mga07m45_99343_c1 3300050496 Bacteria 1671
222 Ga0495601_0462171 3300053077 Bacteria 820
223 Ga0495655_0119080 3300053083 Bacteria 802
224 Ga0500643_003905 3300053087 Bacteria 6925
225 Ga0500658_0152269 3300053134 Bacteria 1043
226 Ga0500658_0193284 3300053134 Bacteria 929
227 Ga0500604_0039434 3300053151 Bacteria 1420
228 Ga0500620_000126 3300053155 Bacteria 15428
229 Ga0500620_015788 3300053155 Bacteria 2143
230 Ga0500627_0064104 3300053158 Bacteria 1620
231 Ga0500611_011586 3300053727 Bacteria 1464
232 2874125756 2874123672 Bacteria 7238285
233 2503202610 2503198000 Bacteria 6884444
234 2509117770 2508501123 Bacteria 6283661
235 2509143540 2508501127 Bacteria 7037543
236 2509373042 2509276018 Bacteria 6910194
237 2509397119 2509276022 Bacteria 6200534
238 2510319865 2510065059 Bacteria 6847884
239 2512930615 2512875016 Bacteria 6529530
240 2513612080 2513237090 Bacteria 7096802
241 2588516264 2588253730 Bacteria 6881675
242 2599939588 2599185301 Bacteria 6161860
243 2643772809 2643221550 Bacteria 4619371
244 2643775524 2643221551 Bacteria 3750538
245 2643793970 2643221555 Bacteria 3749717
246 2643987353 2643221595 Bacteria 6565519
247 2644155677 2643221627 Bacteria 6761570
248 2688599113 2687453392 Bacteria 6880454
249 2694631964 2693429783 Bacteria 7019804
250 2694634615 2693429784 Bacteria 7241525
251 2723576117 2721755686 Bacteria 7343952
252 2739308973 2738543024 Bacteria 5603683
253 2756677812 2756170246 Bacteria 7451806
254 2792752951 2791355123 Bacteria 8049106
255 2841740403 2841734538 Bacteria 6784580
256 2844006741 2844002411 Bacteria 7168230
257 2844014511 2844009547 Bacteria 6728125
258 2847670840 2847670302 Bacteria 6165597
259 2847687020 2847686936 Bacteria 6278406
260 2856316297 2856314179 Bacteria 6477897
261 2856325128 2856320880 Bacteria 7263508
262 2856330517 2856328259 Bacteria 6528202
263 2856335320 2856334872 Bacteria 7037011
264 2856349975 2856349417 Bacteria 6230045
265 2856363909 2856356410 Bacteria 6297484
266 2856369096 2856364286 Bacteria 6939991
267 2857355637 2857349434 Bacteria 7926032
268 2857374515 2857367948 Bacteria 6965560
269 2869167364 2869162929 Bacteria 6399702
270 2869239227 2869234852 Bacteria 6654993
271 2869256607 2869249662 Bacteria 6868783
272 2869258302 2869256925 Bacteria 6981691
273 2869265555 2869264136 Bacteria 6880765
274 2869276639 2869271264 Bacteria 6908218
275 2869280850 2869278585 Bacteria 7077053
276 2869288464 2869285874 Bacteria 6901219
277 2871432155 2871429161 Bacteria 6547891
278 2871438149 2871435913 Bacteria 6880295
279 2871445614 2871444079 Bacteria 6423508
280 2871457685 2871451962 Bacteria 7336357
281 2871462985 2871459585 Bacteria 6866887
282 2871473656 2871466892 Bacteria 6923287
283 2871476467 2871474448 Bacteria 6806570
284 2871488067 2871481445 Bacteria 6700002
285 2871495673 2871488783 Bacteria 6929816
286 2871500506 2871495908 Bacteria 6935695
287 2874104795 2874102143 Bacteria 6342645
288 2874121788 2874116593 Bacteria 6674494
289 2874138713 2874131515 Bacteria 6820270
290 2874141482 2874139085 Bacteria 7021506
291 2874151035 2874146452 Bacteria 7533118
292 2874157373 2874155637 Bacteria 6724144
293 2874163815 2874162495 Bacteria 6174670
294 2874172620 2874168670 Bacteria 8062617
295 2876368038 2876363079 Bacteria 6544991
296 2876372883 2876369609 Bacteria 6807521
297 2876391462 2876386047 Bacteria 6698674
298 2876395212 2876392853 Bacteria 6660880
299 2876399977 2876399893 Bacteria 6927900
300 2876412666 2876406927 Bacteria 6191900
301 2876417063 2876413966 Bacteria 6831344
302 2876422679 2876420981 Bacteria 6687741
303 2878041620 2878035449 Bacteria 6555736
304 2878732990 2878730984 Bacteria 6380721
305 2878743211 2878738818 Bacteria 7136951
306 2878748874 2878745973 Bacteria 6867388
307 2878753528 2878753008 Bacteria 6922523
308 2878764595 2878760144 Bacteria 6823465
309 2878771696 2878767105 Bacteria 6898628
310 2878778416 2878774303 Bacteria 6108671
311 2878781238 2878781027 Bacteria 6834456
312 2881152604 2881147464 Bacteria 7779814
313 2881156223 2881155292 Bacteria 6461656
314 2881849958 2881845957 Bacteria 6611900
315 2881857785 2881853255 Bacteria 6698367
316 2882633113 2882632389 Bacteria 8154593
317 2882917231 2882912400 Bacteria 6801539
318 2885310627 2885305155 Bacteria 7348390
319 2885325188 2885318864 Bacteria 6729568
320 2885333781 2885326080 Bacteria 7134805
321 2885349251 2885342637 Bacteria 7011821
322 2885355569 2885350715 Bacteria 6787678
323 2888340634 2888337043 Bacteria 6629336
324 2888347822 2888343758 Bacteria 6611049
325 2888356834 2888350351 Bacteria 7372807
326 2889011886 2889010040 Bacteria 6749192
327 2889023185 2889016732 Bacteria 6700763
328 2894776908 2894772417 Bacteria 5305674
329 2903452059 2903448605 Bacteria 7357801
330 2903495383 2903492973 Bacteria 13473544
331 2903504116 2903492973 Bacteria 13473544
332 2903515689 2903513507 Bacteria 6344008
333 2903527034 2903521522 Bacteria 6525694
334 2903533261 2903528002 Bacteria 6586099
335 2903545319 2903540706 Bacteria 7062119
336 2904661843 2904659560 Bacteria 6685615
337 2906311226 2906308376 Bacteria 6841989
338 2906323993 2906321335 Bacteria 6579571
339 2906328406 2906328253 Bacteria 6585166
340 2906360611 2906354277 Bacteria 6991324
341 2906366970 2906363423 Bacteria 6856682
342 2906375771 2906370794 Bacteria 6881062
343 2906388571 2906386501 Bacteria 5977019
344 2906403006 2906401398 Bacteria 6693206
345 2906410524 2906408224 Bacteria 6162342
346 2906416434 2906414383 Bacteria 6580790
347 2906433579 2906427513 Bacteria 6375796
348 2922135597 2922130491 Bacteria 7173936
349 2922153989 2922151315 Bacteria 6902399
350 2922163232 2922158528 Bacteria 6573167
351 2922177558 2922172374 Bacteria 6167644
352 2922183025 2922178524 Bacteria 6025201
353 2922189591 2922185730 Bacteria 7113964
354 2924710213 2924710171 Bacteria 6752351
355 2924725664 2924718760 Bacteria 6331356
356 2924730160 2924726620 Bacteria 6271473
357 2924734619 2924733363 Bacteria 7574837
358 2924742014 2924741084 Bacteria 6661321
359 2924753905 2924748358 Bacteria 6154725
360 2924760269 2924754689 Bacteria 6774424
361 2924763878 2924762789 Bacteria 6561353
362 2924777325 2924776078 Bacteria 7492003
363 2924789557 2924784321 Bacteria 7416538
364 2929200676 2929199973 Bacteria 7260745
365 2937813448 2937813078 Bacteria 7783518
366 2937826622 2937822353 Bacteria 7290551
367 2937840043 2937836603 Bacteria 6811263
368 2937853680 2937848649 Bacteria 6983481
369 2937865288 2937861824 Bacteria 6660327
370 2937873659 2937868953 Bacteria 6639878
371 2937879270 2937877337 Bacteria 7246526
372 2937896604 2937891427 Bacteria 6357007
373 2937974997 2937972304 Bacteria 7532020
374 2937985924 2937980651 Bacteria 6517427
375 2937999169 2937994558 Bacteria 7036190
376 2938019290 2938014810 Bacteria 6700592
377 2958036813 2958034702 Bacteria 6989922
378 2958050435 2958041894 Bacteria 13082850
379 2958065819 2958064165 Bacteria 7158582
380 2958072518 2958071322 Bacteria 6815895
381 2958086445 2958084443 Bacteria 7312792
382 2958098585 2958092219 Bacteria 6861151
383 2958102646 2958100919 Bacteria 6800575
384 2958110798 2958108152 Bacteria 6681128
385 2958122542 2958115193 Bacteria 6923548
386 2958123165 2958122699 Bacteria 7280457
387 2958132865 2958130278 Bacteria 6897202
388 2958142328 2958137437 Bacteria 6050276
389 2958150696 2958144490 Bacteria 6677056
390 2958159685 2958158011 Bacteria 6058449
391 2958169643 2958165035 Bacteria 6906348
392 2958182979 2958179912 Bacteria 6874908
393 2961080859 2961077736 Bacteria 7079850
394 2961116996 2961114664 Bacteria 6680456
395 2961143369 2961136820 Bacteria 6775228
396 2961168103 2961163497 Bacteria 6901077
397 2961177987 2961170736 Bacteria 7072258
398 2961185174 2961183825 Bacteria 6688536
399 2963648611 2963644680 Bacteria 6530403
400 2965022922 2965018300 Bacteria 6883036
401 2965027292 2965025482 Bacteria 6532201
402 2965032925 2965032056 Bacteria 6887443
403 2965040756 2965040258 Bacteria 6855979
404 2965050173 2965047637 Bacteria 6623551
405 2965064101 2965062239 Bacteria 7412989
406 2965095464 2965089291 Bacteria 6866420
407 2965108024 2965102966 Bacteria 6800987
408 2965112437 2965110997 Bacteria 6693150
409 2965126184 2965119406 Bacteria 6956431
410 2968003239 2967996073 Bacteria 6787468
411 2968004065 2968003550 Bacteria 6929263
412 2968017512 2968016561 Bacteria 7022047
413 2968083839 2968083720 Bacteria 7351627
414 2968092458 2968091066 Bacteria 6052692
415 2968102114 2968097103 Bacteria 6107094
416 2968112904 2968110612 Bacteria 6814636
417 2968122865 2968117919 Bacteria 6536078
418 2968128812 2968128360 Bacteria 6270294
419 2968141591 2968138860 Bacteria 6605449
420 2968176503 2968171901 Bacteria 6894245
421 2970472312 2970469710 Bacteria 6969209
422 2970490861 2970489779 Bacteria 6517260
423 2970510663 2970503327 Bacteria 7099517
424 2970513797 2970510686 Bacteria 7006402
425 2970530061 2970524798 Bacteria 6840927
426 2970536052 2970532167 Bacteria 6553173
427 2970547738 2970540015 Bacteria 6977556
428 2970554331 2970547951 Bacteria 6931819
429 2970559442 2970554993 Bacteria 6814252
430 2970595454 2970593180 Bacteria 7073582
431 2970622943 2970619444 Bacteria 6986144
432 2970628550 2970627176 Bacteria 6680862
433 2977822532 2977821940 Bacteria 6906439
434 2977833525 2977828996 Bacteria 7007971
435 2977845447 2977843712 Bacteria 6753583
436 2977853083 2977851361 Bacteria 6694324
437 2977858588 2977858184 Bacteria 6215359
438 2977872010 2977864932 Bacteria 7534097
439 2977875286 2977872689 Bacteria 7270173
440 2977899224 2977898635 Bacteria 6675551
441 2977914707 2977907340 Bacteria 6577984
442 2977915932 2977915119 Bacteria 6829656
443 2977929164 2977922695 Bacteria 6956781
444 2977939488 2977935797 Bacteria 6252826
445 2977946103 2977942078 Bacteria 7570577
446 2977957241 2977950692 Bacteria 6893264
447 2977964258 2977957713 Bacteria 6877875
448 2977976472 2977971508 Bacteria 7472917
449 2977988792 2977986579 Bacteria 6581278
450 2979710518 2979710463 Bacteria 6785254
451 2979745271 2979742915 Bacteria 7301278
452 2979771546 2979764755 Bacteria 6610066
453 2979775297 2979772303 Bacteria 6618277
454 2979784828 2979779861 Bacteria 6219781
455 2979797927 2979793036 Bacteria 6808957
456 2979815537 2979808191 Bacteria 7179355
457 2987640771 2987636660 Bacteria 8088555
458 2987645599 2987645492 Bacteria 6117018
459 2987664117 2987659509 Bacteria 6966464
460 2987670346 2987666974 Bacteria 6509233
461 2987673512 2987673487 Bacteria 6884027
462 2996348326 2996341866 Bacteria 6643098
463 2996351183 2996348954 Bacteria 7239054
464 2996390960 2996386984 Bacteria 6978667
465 3000136222 3000135777 Bacteria 6891109
466 3004170136 3004167301 Bacteria 8330599
467 3004193172 3004188549 Bacteria 6952365
468 3004197883 3004195979 Bacteria 6776956
469 3004208968 3004203850 Bacteria 7307914
470 3004212700 3004211236 Bacteria 7417683
471 3004222723 3004218560 Bacteria 7421728
472 3004234864 3004232784 Bacteria 6662140
473 3004245151 3004239961 Bacteria 6892290
474 3004255164 3004248173 Bacteria 6563236
475 3004269770 3004268573 Bacteria 7043476
476 3004277881 3004275668 Bacteria 7114440
477 3004296299 3004289098 Bacteria 6135450
478 3004340305 3004334049 Bacteria 8449246
479 3005420804 3005416602 Bacteria 7064308
480 637073609 637000159 Bacteria 7596297
481 649873545 649633066 Bacteria 6690028
482 8004305577 8004300914 Bacteria 6132239
483 8004318178 8004312739 Bacteria 7444653
484 8004365413 8004361976 Bacteria 6858373
485 8004375100 8004374579 Bacteria 6898112
486 8004390977 8004387939 Bacteria 7049250
487 8004395624 8004395343 Bacteria 6620908
488 8004448284 8004445564 Bacteria 6322258
489 8004633924 8004633249 Bacteria 6723080
490 8004643162 8004640170 Bacteria 6723001
491 8004695752 8004695233 Bacteria 6731676
492 8004714502 8004703790 Bacteria 8006957
493 8004717529 8004714634 Bacteria 6776161
494 8004730121 8004727605 Bacteria 6643904
495 8005316656 8005314921 Bacteria 7072929
496 8055621956 8055617313 Bacteria 7548464
497 8055915338 8055909800 Bacteria 7278581
498 JGI25156J39149_1004205
499 JGI25157J39369_1001164
500 rootH1_10088124
501 Ga0055529_1003056
502 Ga0070658_10315927
503 Ga0070683_100218698
504 Ga0070660_100107769
505 Ga0070661_100040925
506 Ga0070661_100731687
507 Ga0070674_100303197
508 Ga0070659_100092779
509 Ga0070659_100656265
510 Ga0070663_100411129
511 Ga0068867_100226494
512 Ga0070706_100447722
513 Ga0070679_100565944
514 Ga0070684_100084386
515 Ga0068853_100179647
516 Ga0068853_100575205
517 Ga0070665_100043221
518 Ga0070665_100054833
519 Ga0070665_100119898
520 Ga0070665_100142084
521 Ga0070665_100224660
522 Ga0068855_100062162
523 Ga0068855_100164315
524 Ga0068855_100476196
525 Ga0070664_100065795
526 Ga0068856_100142459
527 Ga0068852_100171812
528 Ga0068852_100457334
529 Ga0068859_100574706
530 Ga0068864_100208626
531 Ga0081455_10029008
532 Ga0075365_10012266
533 Ga0075365_10067047
534 Ga0075365_10255303
535 Ga0075368_10035433
536 Ga0075368_10079797
537 Ga0075363_100053161
538 Ga0075363_100138230
539 Ga0075363_100286842
540 Ga0075364_10069370
541 Ga0075364_10091186
542 Ga0075362_10038312
543 Ga0075362_10205909
544 Ga0075367_10099714
545 Ga0075367_10101562
546 Ga0075369_10007257
547 Ga0075369_10140712
548 Ga0075366_10123951
549 Ga0097621_100459363
550 Ga0075370_10108322
551 Ga0097620_100574625
552 Ga0105240_10177831
553 Ga0105240_10303524
554 Ga0105240_10665674
555 Ga0105243_10227724
556 Ga0105237_10028343
557 Ga0105237_10120114
558 Ga0105237_10257973
559 Ga0105238_10010408
560 Ga0105238_10123148
561 Ga0105238_10550480
562 Ga0105239_10122092
563 Ga0105239_10789596
564 Ga0157371_10523500
565 Ga0157370_10101547
566 Ga0157370_10137997
567 Ga0157369_10109919
568 Ga0157378_10246898
569 Ga0163163_10231624
570 Ga0157379_10467818
571 Ga0157376_10229069
572 Ga0209026_1000002
573 Ga0209148_1000038
574 Ga0209759_1000119
575 Ga0209233_1000625
576 Ga0209233_1004929
577 Ga0209455_1000204
578 Ga0209758_1004234
579 Ga0207426_1013264
580 Ga0207647_10036303
581 Ga0207654_10412887
582 Ga0207695_10001421
583 Ga0207695_10382064
584 Ga0207671_10217701
585 Ga0207671_10291768
586 Ga0207657_10046718
587 Ga0207657_10804066
588 Ga0207649_10242238
589 Ga0207694_10280247
590 Ga0207679_10078931
591 Ga0207678_10290841
592 Ga0207702_10735579
593 Ga0207648_10415121
594 Ga0207674_10629602
595 Ga0207698_10218775
596 Ga0207698_10292678
597 Ga0268266_10079619
598 Ga0268266_10160055
599 Ga0395899_0063073
600 Ga0395899_0114055
601 Ga0395899_0341428
602 Ga0395899_0416446
603 Ga0395900_0002013
604 Ga0395900_0044547
605 Ga0395900_0120865
606 Ga0395900_0565647
607 Ga0395900_0594753
608 Ga0395900_0656328
609 Ga0395898_0124437
610 Ga0395898_0299292
611 Ga0395898_0909125
612 Ga0395905_0130449
613 Ga0395905_0269327
614 Ga0395905_0562894
615 Ga0395901_0002160
616 Ga0395901_0009565
617 Ga0395901_0228294
618 Ga0395901_0802045
619 Ga0439465_0150499
620 Ga0439458_0047467
621 Ga0466963_0026066
622 Ga0466960_0242760
623 Ga0495597_0095856
624 Ga0495668_0032117
625 Ga0495625_0021704
626 Ga0495635_0419507
627 Ga0495674_0712308
628 Ga0495687_082420
629 Ga0495602_0542490
630 Ga0495626_0259997
631 Ga0496102_0289478
632 Ga0496103_0593433
633 Ga0496104_1012195
634 Ga0496112_0042943
635 Ga0496119_0026156
636 Ga0496119_0256235
637 Ga0496120_0003364
638 Ga0496125_0096406
639 Ga0496126_0049080
640 Ga0496126_0118888
641 Ga0501031_0000202
642 Ga0501031_0011232
643 Ga0501032_0000443
644 Ga0501032_0018481
645 Ga0501033_0000097
646 Ga0501033_0041854
647 Ga0501033_0164409
648 Ga0501033_0203098
649 Ga0501033_0224655
650 Ga0501033_0308950
651 Ga0501034_0000186
652 Ga0501034_0000883
653 Ga0501034_0002372
654 Ga0501034_0002798
655 Ga0501034_0024097
656 Ga0501034_0045710
657 Ga0501034_0048069
658 Ga0501034_0217254
659 Ga0501034_0482085
660 Ga0501036_0000002
661 Ga0501036_0015868
662 Ga0501037_0000443
663 Ga0501037_0102206
664 Ga0501038_0000002
665 Ga0501038_0024080
666 Ga0501038_0291895
667 Ga0501039_0000002
668 Ga0501039_0033679
669 Ga0501040_0002065
670 Ga0501040_0146910
671 Ga0501043_0000543
672 Ga0501043_0017000
673 Ga0501043_0295852
674 Ga0501046_0020274
675 Ga0501047_0002238
676 Ga0501047_0002948
677 Ga0501047_0115522
678 Ga0501047_0390409
679 Ga0501068_0122945
680 Ga0501070_0003059
681 Ga0501070_0008443
682 Ga0501070_0057177
683 Ga0501071_0285806
684 Ga0501072_0311738
685 Ga0501073_0033080
686 Ga0501074_0027600
687 Ga0501074_0056177
688 Ga0501079_0444188
689 Ga0501080_0086653
690 Ga0501080_0113647
691 Ga0501035_0000100
692 Ga0501035_0010431
693 Ga0501035_0044924
694 Ga0501035_0218185
695 Ga0501035_0339813
696 Ga0501035_0384296
697 Ga0501044_0000002
698 Ga0501044_0039724
699 Ga0501044_0213019
700 Ga0501044_0485235
701 Ga0501045_0034234
702 nmdc:mga03683_127883_c1
703 nmdc:mga03683_83481_c1
704 nmdc:mga03n38_106623_c1
705 nmdc:mga03n38_160457_c1
706 nmdc:mga03n38_92813_c1
707 nmdc:mga00v17_80255_c1
708 nmdc:mga00v17_84405_c1
709 nmdc:mga0yw44_187212_c1
710 nmdc:mga0yw44_42472_c1
711 nmdc:mga0yw44_43317_c1
712 nmdc:mga0yw44_49807_c1
713 nmdc:mga0yw44_54336_c1
714 nmdc:mga0yw44_73165_c1
715 nmdc:mga0k408_154330_c1
716 nmdc:mga06z11_158043_c1
717 nmdc:mga06z11_198927_c1
718 nmdc:mga07m45_99343_c1
719 Ga0495601_0462171
720 Ga0495655_0119080
721 Ga0500643_003905
722 Ga0500658_0152269
723 Ga0500658_0193284
724 Ga0500604_0039434
725 Ga0500620_000126
726 Ga0500620_015788
727 Ga0500627_0064104
728 Ga0500611_011586
729 2874125756
730 2503202610
731 2509117770
732 2509143540
733 2509373042
734 2509397119
735 2510319865
736 2512930615
737 2513612080
738 2588516264
739 2599939588
740 2643772809
741 2643775524
742 2643793970
743 2643987353
744 2644155677
745 2688599113
746 2694631964
747 2694634615
748 2723576117
749 2739308973
750 2756677812
751 2792752951
752 2841740403
753 2844006741
754 2844014511
755 2847670840
756 2847687020
757 2856316297
758 2856325128
759 2856330517
760 2856335320
761 2856349975
762 2856363909
763 2856369096
764 2857355637
765 2857374515
766 2869167364
767 2869239227
768 2869256607
769 2869258302
770 2869265555
771 2869276639
772 2869280850
773 2869288464
774 2871432155
775 2871438149
776 2871445614
777 2871457685
778 2871462985
779 2871473656
780 2871476467
781 2871488067
782 2871495673
783 2871500506
784 2874104795
785 2874121788
786 2874138713
787 2874141482
788 2874151035
789 2874157373
790 2874163815
791 2874172620
792 2876368038
793 2876372883
794 2876391462
795 2876395212
796 2876399977
797 2876412666
798 2876417063
799 2876422679
800 2878041620
801 2878732990
802 2878743211
803 2878748874
804 2878753528
805 2878764595
806 2878771696
807 2878778416
808 2878781238
809 2881152604
810 2881156223
811 2881849958
812 2881857785
813 2882633113
814 2882917231
815 2885310627
816 2885325188
817 2885333781
818 2885349251
819 2885355569
820 2888340634
821 2888347822
822 2888356834
823 2889011886
824 2889023185
825 2894776908
826 2903452059
827 2903495383
828 2903504116
829 2903515689
830 2903527034
831 2903533261
832 2903545319
833 2904661843
834 2906311226
835 2906323993
836 2906328406
837 2906360611
838 2906366970
839 2906375771
840 2906388571
841 2906403006
842 2906410524
843 2906416434
844 2906433579
845 2922135597
846 2922153989
847 2922163232
848 2922177558
849 2922183025
850 2922189591
851 2924710213
852 2924725664
853 2924730160
854 2924734619
855 2924742014
856 2924753905
857 2924760269
858 2924763878
859 2924777325
860 2924789557
861 2929200676
862 2937813448
863 2937826622
864 2937840043
865 2937853680
866 2937865288
867 2937873659
868 2937879270
869 2937896604
870 2937974997
871 2937985924
872 2937999169
873 2938019290
874 2958036813
875 2958050435
876 2958065819
877 2958072518
878 2958086445
879 2958098585
880 2958102646
881 2958110798
882 2958122542
883 2958123165
884 2958132865
885 2958142328
886 2958150696
887 2958159685
888 2958169643
889 2958182979
890 2961080859
891 2961116996
892 2961143369
893 2961168103
894 2961177987
895 2961185174
896 2963648611
897 2965022922
898 2965027292
899 2965032925
900 2965040756
901 2965050173
902 2965064101
903 2965095464
904 2965108024
905 2965112437
906 2965126184
907 2968003239
908 2968004065
909 2968017512
910 2968083839
911 2968092458
912 2968102114
913 2968112904
914 2968122865
915 2968128812
916 2968141591
917 2968176503
918 2970472312
919 2970490861
920 2970510663
921 2970513797
922 2970530061
923 2970536052
924 2970547738
925 2970554331
926 2970559442
927 2970595454
928 2970622943
929 2970628550
930 2977822532
931 2977833525
932 2977845447
933 2977853083
934 2977858588
935 2977872010
936 2977875286
937 2977899224
938 2977914707
939 2977915932
940 2977929164
941 2977939488
942 2977946103
943 2977957241
944 2977964258
945 2977976472
946 2977988792
947 2979710518
948 2979745271
949 2979771546
950 2979775297
951 2979784828
952 2979797927
953 2979815537
954 2987640771
955 2987645599
956 2987664117
957 2987670346
958 2987673512
959 2996348326
960 2996351183
961 2996390960
962 3000136222
963 3004170136
964 3004193172
965 3004197883
966 3004208968
967 3004212700
968 3004222723
969 3004234864
970 3004245151
971 3004255164
972 3004269770
973 3004277881
974 3004296299
975 3004340305
976 3005420804
977 637073609
978 649873545
979 8004305577
980 8004318178
981 8004365413
982 8004375100
983 8004390977
984 8004395624
985 8004448284
986 8004633924
987 8004643162
988 8004695752
989 8004714502
990 8004717529
991 8004730121
992 8005316656
993 8055621956
994 8055915338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01812

5-FTHF_cyc-lig

5-formyltetrahydrofolate cyclo-ligase family

37

211

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jcb-assembly2.cif.gz_B the crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489) 0.9145 36 214
1u3g-assembly1.cif.gz_A structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) 0.9 40 214
1u3g-assembly1.cif.gz_A structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) 0.8792 40 214
3hy6-assembly1.cif.gz_A structure of human mthfs with adp 0.8712 33 213
1sou-assembly1.cif.gz_A nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46 0.8662 40 215
ID Description Score Start End Superfamily
2jcbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9145 36 214 3.40.50.10420
1u3gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9 40 214 3.40.50.10420
af_A0A0G2L0J2_1_199_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8964 34 214 3.40.50.10420
af_O05575_1_191_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8924 40 215 3.40.50.10420
af_Q2FY23_1_179_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8907 40 211 3.40.50.10420
ID Description Score Start End GO Terms
AF-W7VZ60-F1-model_v4 Putative 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9928 133 211 GO:0005524
GO:0009396
GO:0030272
GO:0035999
AF-W7WM26-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9921 33 214 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A531ACD2-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase 0.9908 146 218 GO:0009396
GO:0030272
GO:0035999
AF-A0A848U6R5-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9895 104 214 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A5E8XDN3-F1-model_v4 deleted 0.9894 85 212

Map