F455173

General Info

Members Datasets Scaffolds Average Seq Length
498 317 996 249

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100084769|Ga0075431_1000847693
Length 276
Sequence MILPGVLNGLFRNAGAIIFHLWLSWVLMKALVAVKRVVDFNVKVRVKADGTGVETANVKMSMNPFDEIAVEEAVRLKEAGLVKEIVAVSCGLAACQETLRTALAIGADRAILVETDAELQPLAVAKLLKAVAQKESPDLVILGKQAIDDDSNQTGQMVAALLGWPQATFASKVKIADGRAEVTREVDGGLDTISIKLPAVITTDLRLNEPRYVTLPNIMKAKKKTLEILKPDALGVDVAPRLQTLKVVEPAKRKAGAKVPDAKALVDKLRNEAKVI

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300023553 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
114 3300023556 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
115 3300023562 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
116 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
178 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
181 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
182 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
183 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
213 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
292 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
313 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
314 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
315 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
316 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
317 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.78
Metatranscriptomes 4.02
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 3.21
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100084769 3300006847 Bacteria 3271
2 LJQas_1002647 3300000549 Bacteria 2466
3 JGI25151J46595_10005033 3300003187 Bacteria 6881
4 Ga0006557J51388_1005984 3300003556 Eukaryota 1109
5 Ga0006558J51389_1004057 3300003558 Eukaryota 1030
6 Ga0006559J51393_1004269 3300003560 Eukaryota 1061
7 Ga0006553J51392_1005814 3300003561 Eukaryota 998
8 Ga0006555J51386_1005679 3300003564 Eukaryota 1075
9 Ga0006560J51390_1007073 3300003565 Eukaryota 1079
10 Ga0006554J51385_1005085 3300003567 Eukaryota 1002
11 Ga0065704_10005227 3300005289 Bacteria 4343
12 Ga0070683_100049943 3300005329 Bacteria 3870
13 Ga0070690_100002222 3300005330 Bacteria 10394
14 Ga0068869_100002111 3300005334 Bacteria 11951
15 Ga0068869_100388203 3300005334 Bacteria 1146
16 Ga0070666_10004006 3300005335 Bacteria 8942
17 Ga0070680_100001466 3300005336 Bacteria 17116
18 Ga0070682_100011826 3300005337 Bacteria 4994
19 Ga0068868_100003608 3300005338 Bacteria 10786
20 Ga0068868_100003616 3300005338 Bacteria 10780
21 Ga0068868_100500267 3300005338 Bacteria 1064
22 Ga0070689_100007839 3300005340 Bacteria 7485
23 Ga0070689_100008083 3300005340 Bacteria 7391
24 Ga0070691_10007280 3300005341 Bacteria 5065
25 Ga0070687_100000392 3300005343 Bacteria 14882
26 Ga0070661_100405551 3300005344 Bacteria 1078
27 Ga0070692_10015336 3300005345 Bacteria 3624
28 Ga0070692_10030270 3300005345 Bacteria 2705
29 Ga0070669_100104619 3300005353 Bacteria 2140
30 Ga0070671_100101681 3300005355 Bacteria 2412
31 Ga0070673_100001292 3300005364 Bacteria 14589
32 Ga0070688_100032201 3300005365 Bacteria 3159
33 Ga0070659_100011661 3300005366 Bacteria 6504
34 Ga0070667_100420101 3300005367 Bacteria 1219
35 Ga0070703_10008377 3300005406 Bacteria 2906
36 Ga0070709_10035498 3300005434 Bacteria 3030
37 Ga0070709_10047459 3300005434 Bacteria 2676
38 Ga0070709_10550742 3300005434 Bacteria 882
39 Ga0070714_100045428 3300005435 Bacteria 3723
40 Ga0070713_100003742 3300005436 Bacteria 10069
41 Ga0070713_100004299 3300005436 Bacteria 9545
42 Ga0070710_10064259 3300005437 Bacteria 2099
43 Ga0070710_10150964 3300005437 Bacteria 1433
44 Ga0070711_100014399 3300005439 Bacteria 4984
45 Ga0070705_100000198 3300005440 Bacteria 35654
46 Ga0070705_100020071 3300005440 Bacteria 3529
47 Ga0070700_100000336 3300005441 Bacteria 24375
48 Ga0070694_100003027 3300005444 Bacteria 10010
49 Ga0070694_100014620 3300005444 Bacteria 4915
50 Ga0070694_100035967 3300005444 Bacteria 3278
51 Ga0070694_100168786 3300005444 Bacteria 1610
52 Ga0070694_100245581 3300005444 Bacteria 1352
53 Ga0070694_100262048 3300005444 Bacteria 1311
54 Ga0070708_100001935 3300005445 Bacteria 15973
55 Ga0070663_100035004 3300005455 Bacteria 3482
56 Ga0070678_100084892 3300005456 Bacteria 2411
57 Ga0070681_10205721 3300005458 Bacteria 1885
58 Ga0068867_100000780 3300005459 Bacteria 21510
59 Ga0070685_10009758 3300005466 Bacteria 4976
60 Ga0070706_100031956 3300005467 Bacteria 4854
61 Ga0070706_100096908 3300005467 Bacteria 2739
62 Ga0070706_100103333 3300005467 Bacteria 2649
63 Ga0070707_100180278 3300005468 Bacteria 2059
64 Ga0070707_100434691 3300005468 Bacteria 1273
65 Ga0070698_100012262 3300005471 Bacteria 9076
66 Ga0070698_100747893 3300005471 Bacteria 921
67 Ga0070699_100012359 3300005518 Bacteria 7365
68 Ga0070679_100012766 3300005530 Bacteria 8037
69 Ga0070679_100328690 3300005530 Bacteria 1477
70 Ga0070684_100157003 3300005535 Bacteria 2063
71 Ga0070684_100392845 3300005535 Bacteria 1278
72 Ga0070697_100064507 3300005536 Bacteria 2991
73 Ga0068853_100040180 3300005539 Bacteria 3990
74 Ga0070672_100017642 3300005543 Bacteria 5142
75 Ga0070686_100000595 3300005544 Bacteria 21373
76 Ga0070686_100011826 3300005544 Bacteria 4959
77 Ga0070695_100000292 3300005545 Bacteria 25201
78 Ga0070695_100133087 3300005545 Bacteria 1716
79 Ga0070696_100000489 3300005546 Bacteria 24889
80 Ga0070696_100005949 3300005546 Bacteria 8146
81 Ga0070696_100126517 3300005546 Bacteria 1855
82 Ga0070693_100000126 3300005547 Bacteria 34382
83 Ga0070693_100001405 3300005547 Bacteria 10851
84 Ga0070665_100001673 3300005548 Bacteria 25556
85 Ga0070704_100011353 3300005549 Bacteria 5457
86 Ga0070704_100164093 3300005549 Bacteria 1760
87 Ga0070704_100425206 3300005549 Bacteria 1138
88 Ga0070704_100449149 3300005549 Bacteria 1110
89 Ga0068855_100031341 3300005563 Bacteria 6349
90 Ga0070664_100350508 3300005564 Bacteria 1343
91 Ga0068857_100101767 3300005577 Bacteria 2578
92 Ga0068857_100128797 3300005577 Bacteria 2282
93 Ga0068854_100009382 3300005578 Bacteria 6318
94 Ga0068854_100023752 3300005578 Bacteria 4191
95 Ga0068854_100040014 3300005578 Bacteria 3305
96 Ga0068856_100046851 3300005614 Bacteria 4258
97 Ga0070702_100001112 3300005615 Bacteria 10782
98 Ga0070702_100083120 3300005615 Bacteria 1923
99 Ga0068852_100021891 3300005616 Bacteria 5115
100 Ga0068852_100111305 3300005616 Bacteria 2490
101 Ga0068859_100011156 3300005617 Bacteria 9035
102 Ga0068859_100027966 3300005617 Bacteria 5654
103 Ga0068864_100001224 3300005618 Bacteria 21327
104 Ga0068866_10000451 3300005718 Bacteria 18891
105 Ga0068866_10040480 3300005718 Bacteria 2307
106 Ga0068861_100002990 3300005719 Bacteria 11157
107 Ga0068861_100323913 3300005719 Bacteria 1343
108 Ga0068870_10062323 3300005840 Bacteria 2008
109 Ga0068858_100004859 3300005842 Bacteria 13181
110 Ga0068858_100170612 3300005842 Bacteria 2051
111 Ga0068860_100011341 3300005843 Bacteria 8782
112 Ga0068860_100216627 3300005843 Bacteria 1858
113 Ga0068860_100260090 3300005843 Bacteria 1691
114 Ga0068860_100428592 3300005843 Bacteria 1312
115 Ga0068862_100009361 3300005844 Bacteria 8103
116 Ga0068862_100361590 3300005844 Bacteria 1349
117 Ga0070716_100051244 3300006173 Bacteria 2346
118 Ga0070716_100142537 3300006173 Bacteria 1530
119 Ga0070712_100014569 3300006175 Bacteria 5046
120 Ga0070712_100075734 3300006175 Bacteria 2421
121 Ga0097621_100000804 3300006237 Bacteria 22119
122 Ga0097621_100150112 3300006237 Bacteria 1998
123 Ga0068871_100004146 3300006358 Bacteria 10029
124 Ga0075428_100000657 3300006844 Bacteria 35530
125 Ga0075428_100001001 3300006844 Bacteria 29943
126 Ga0075428_100116163 3300006844 Bacteria 2915
127 Ga0075428_100721374 3300006844 Bacteria 1062
128 Ga0075430_100000318 3300006846 Bacteria 34303
129 Ga0075430_100552581 3300006846 Bacteria 950
130 Ga0075431_100015013 3300006847 Bacteria 7842
131 Ga0075431_100039376 3300006847 Bacteria 4869
132 Ga0075431_100043885 3300006847 Bacteria 4611
133 Ga0075431_100054765 3300006847 Bacteria 4113
134 Ga0075431_100203713 3300006847 Bacteria 2024
135 Ga0075433_10119457 3300006852 Bacteria 2340
136 Ga0075429_100000194 3300006880 Bacteria 40201
137 Ga0075429_100000363 3300006880 Bacteria 33387
138 Ga0075429_100002260 3300006880 Bacteria 16139
139 Ga0075429_100017886 3300006880 Bacteria 6128
140 Ga0068865_100001740 3300006881 Bacteria 12775
141 Ga0068865_100186728 3300006881 Bacteria 1600
142 Ga0097620_100011157 3300006931 Bacteria 9035
143 Ga0097620_100027966 3300006931 Bacteria 5654
144 Ga0099794_10008097 3300007265 Bacteria 4352
145 Ga0099794_10156183 3300007265 Bacteria 1159
146 Ga0105251_10060950 3300009011 Bacteria 1775
147 Ga0105240_10000867 3300009093 Bacteria 54480
148 Ga0105240_10070393 3300009093 Bacteria 4327
149 Ga0111539_10001999 3300009094 Bacteria 27198
150 Ga0105245_10003910 3300009098 Bacteria 13243
151 Ga0105245_10058232 3300009098 Bacteria 3477
152 Ga0105245_10063947 3300009098 Bacteria 3325
153 Ga0114129_10001363 3300009147 Bacteria 32838
154 Ga0114129_10033238 3300009147 Bacteria 7289
155 Ga0105243_10000576 3300009148 Bacteria 36922
156 Ga0105243_10210824 3300009148 Bacteria 1710
157 Ga0105241_10031493 3300009174 Bacteria 3972
158 Ga0105241_10176500 3300009174 Bacteria 1769
159 Ga0105242_10004469 3300009176 Bacteria 10872
160 Ga0105242_10009273 3300009176 Bacteria 7557
161 Ga0105242_10061360 3300009176 Bacteria 3092
162 Ga0105242_10327101 3300009176 Bacteria 1408
163 Ga0105248_10001399 3300009177 Bacteria 26936
164 Ga0105248_10057468 3300009177 Bacteria 4367
165 Ga0105237_10000303 3300009545 Bacteria 68288
166 Ga0105238_10088573 3300009551 Bacteria 3081
167 Ga0105249_10245774 3300009553 Bacteria 1771
168 Ga0105249_10509047 3300009553 Bacteria 1250
169 Ga0105249_10725841 3300009553 Bacteria 1055
170 Ga0099796_10020239 3300010159 Bacteria 2031
171 Ga0105239_10000151 3300010375 Bacteria 99979
172 Ga0105239_10665409 3300010375 Bacteria 1190
173 Ga0105246_10192584 3300011119 Bacteria 1579
174 Ga0157373_10282464 3300013100 Bacteria 1176
175 Ga0157374_10002626 3300013296 Bacteria 15152
176 Ga0157374_10914000 3300013296 Bacteria 895
177 Ga0157378_10001643 3300013297 Bacteria 20215
178 Ga0157378_10101007 3300013297 Bacteria 2634
179 Ga0157378_10107301 3300013297 Bacteria 2555
180 Ga0163162_10032020 3300013306 Bacteria 5219
181 Ga0163162_10045802 3300013306 Bacteria 4382
182 Ga0163162_10103284 3300013306 Bacteria 2944
183 Ga0157372_10137408 3300013307 Bacteria 2815
184 Ga0163163_10003775 3300014325 Bacteria 12906
185 Ga0157380_10011765 3300014326 Bacteria 6329
186 Ga0157379_10002694 3300014968 Bacteria 14977
187 Ga0157376_10055816 3300014969 Bacteria 3297
188 Ga0157376_10291941 3300014969 Bacteria 1540
189 Ga0157376_10539309 3300014969 Bacteria 1153
190 Ga0163161_10009377 3300017792 Bacteria 6776
191 Ga0163161_10029877 3300017792 Bacteria 3874
192 Ga0206353_10072236 3300020082 Eukaryota 909
193 Ga0213871_10081387 3300021441 Bacteria 928
194 Ga0247524_105614 3300023553 Eukaryota 1096
195 Ga0247519_105217 3300023556 Eukaryota 1290
196 Ga0247516_106361 3300023562 Eukaryota 1338
197 Ga0247515_105745 3300023564 Eukaryota 1414
198 Ga0209025_1000034 3300025294 Bacteria 413205
199 Ga0207426_1002320 3300025302 Bacteria 12450
200 Ga0207653_10007371 3300025885 Bacteria 3429
201 Ga0207653_10038391 3300025885 Bacteria 1565
202 Ga0207692_10004853 3300025898 Bacteria 5352
203 Ga0207692_10133570 3300025898 Bacteria 1404
204 Ga0207642_10000598 3300025899 Bacteria 11081
205 Ga0207680_10008068 3300025903 Bacteria 5158
206 Ga0207643_10047216 3300025908 Bacteria 2435
207 Ga0207684_10158987 3300025910 Bacteria 1945
208 Ga0207684_10197169 3300025910 Bacteria 1737
209 Ga0207654_10013379 3300025911 Bacteria 4222
210 Ga0207654_10196946 3300025911 Bacteria 1324
211 Ga0207654_10440978 3300025911 Bacteria 912
212 Ga0207707_10633643 3300025912 Bacteria 902
213 Ga0207695_10005103 3300025913 Bacteria 17590
214 Ga0207695_10755378 3300025913 Bacteria 853
215 Ga0207671_10000881 3300025914 Bacteria 37996
216 Ga0207693_10014341 3300025915 Bacteria 6375
217 Ga0207663_10041797 3300025916 Bacteria 2796
218 Ga0207660_10002378 3300025917 Bacteria 12379
219 Ga0207660_10138431 3300025917 Bacteria 1859
220 Ga0207662_10039719 3300025918 Bacteria 2762
221 Ga0207662_10053540 3300025918 Bacteria 2404
222 Ga0207657_10011112 3300025919 Bacteria 8950
223 Ga0207657_10071296 3300025919 Bacteria 2942
224 Ga0207649_10031970 3300025920 Bacteria 3132
225 Ga0207652_10006354 3300025921 Bacteria 9542
226 Ga0207646_10121885 3300025922 Bacteria 2343
227 Ga0207646_10133482 3300025922 Bacteria 2235
228 Ga0207681_10191500 3300025923 Bacteria 1565
229 Ga0207694_10112161 3300025924 Bacteria 2170
230 Ga0207694_10327936 3300025924 Bacteria 1264
231 Ga0207687_10002399 3300025927 Bacteria 12708
232 Ga0207687_10003319 3300025927 Bacteria 10874
233 Ga0207700_10009195 3300025928 Bacteria 6161
234 Ga0207700_10019559 3300025928 Bacteria 4575
235 Ga0207664_10001202 3300025929 Bacteria 17189
236 Ga0207644_10020526 3300025931 Bacteria 4492
237 Ga0207690_10062020 3300025932 Bacteria 2543
238 Ga0207706_10042287 3300025933 Bacteria 4039
239 Ga0207706_10089449 3300025933 Bacteria 2707
240 Ga0207706_10266338 3300025933 Bacteria 1496
241 Ga0207686_10001546 3300025934 Bacteria 12982
242 Ga0207686_10002725 3300025934 Bacteria 9580
243 Ga0207686_10032841 3300025934 Bacteria 3092
244 Ga0207709_10001943 3300025935 Bacteria 13531
245 Ga0207709_10200410 3300025935 Bacteria 1425
246 Ga0207670_10007607 3300025936 Bacteria 6060
247 Ga0207670_10155125 3300025936 Bacteria 1703
248 Ga0207669_10136280 3300025937 Bacteria 1696
249 Ga0207704_10008432 3300025938 Bacteria 4930
250 Ga0207665_10014976 3300025939 Bacteria 5094
251 Ga0207691_10053117 3300025940 Bacteria 3700
252 Ga0207691_10117180 3300025940 Bacteria 2363
253 Ga0207711_10001412 3300025941 Bacteria 22485
254 Ga0207711_10021773 3300025941 Bacteria 5354
255 Ga0207689_10081708 3300025942 Bacteria 2656
256 Ga0207679_10504319 3300025945 Bacteria 1080
257 Ga0207667_10014474 3300025949 Bacteria 8991
258 Ga0207667_10118041 3300025949 Bacteria 2734
259 Ga0207651_10004291 3300025960 Bacteria 7158
260 Ga0207651_10081783 3300025960 Bacteria 2329
261 Ga0207712_10285439 3300025961 Bacteria 1348
262 Ga0207640_10001543 3300025981 Bacteria 12411
263 Ga0207640_10100492 3300025981 Bacteria 2027
264 Ga0207640_10101178 3300025981 Bacteria 2021
265 Ga0207658_10025291 3300025986 Bacteria 4156
266 Ga0207658_10334768 3300025986 Bacteria 1314
267 Ga0207677_10007549 3300026023 Bacteria 6030
268 Ga0207677_10018513 3300026023 Bacteria 4181
269 Ga0207677_10026015 3300026023 Bacteria 3662
270 Ga0207677_10272504 3300026023 Bacteria 1385
271 Ga0207703_10001566 3300026035 Bacteria 20744
272 Ga0207703_10011228 3300026035 Bacteria 6969
273 Ga0207678_10054514 3300026067 Bacteria 3444
274 Ga0207678_10068845 3300026067 Bacteria 3036
275 Ga0207708_10001410 3300026075 Bacteria 18034
276 Ga0207702_10352165 3300026078 Bacteria 1409
277 Ga0207648_10000359 3300026089 Bacteria 50214
278 Ga0207648_10073261 3300026089 Bacteria 2985
279 Ga0207676_10000429 3300026095 Bacteria 35426
280 Ga0207674_10028853 3300026116 Bacteria 5849
281 Ga0207674_10250965 3300026116 Bacteria 1716
282 Ga0207683_10001317 3300026121 Bacteria 22408
283 Ga0207698_10634015 3300026142 Bacteria 1057
284 Ga0209588_1116698 3300027671 Bacteria 856
285 Ga0207428_10001254 3300027907 Bacteria 27170
286 Ga0268266_10018442 3300028379 Bacteria 5946
287 Ga0268265_10010013 3300028380 Bacteria 6400
288 Ga0268265_10192903 3300028380 Bacteria 1761
289 Ga0268264_10009307 3300028381 Bacteria 8133
290 Ga0268264_10015263 3300028381 Bacteria 6300
291 Ga0268264_10021447 3300028381 Bacteria 5274
292 Ga0265336_10000062 3300028666 Bacteria 101023
293 Ga0265324_10000370 3300029957 Bacteria 32596
294 Ga0310101_109498 3300031690 Eukaryota 1116
295 Ga0316579_10000237 3300031691 Bacteria 16867
296 Ga0307405_10053673 3300031731 Bacteria 2512
297 Ga0316044_110253 3300031810 Eukaryota 1130
298 Ga0316045_107015 3300031815 Eukaryota 1399
299 Ga0316042_108822 3300031816 Eukaryota 1410
300 Ga0316043_108565 3300031828 Eukaryota 1433
301 Ga0307406_10165778 3300031901 Bacteria 1593
302 Ga0307409_100112869 3300031995 Bacteria 2283
303 Ga0307409_100589660 3300031995 Bacteria 1097
304 Ga0307416_100176968 3300032002 Bacteria 1994
305 Ga0307416_100444199 3300032002 Bacteria 1348
306 Ga0307416_101293519 3300032002 Bacteria 835
307 Ga0307411_10333532 3300032005 Bacteria 1230
308 Ga0307415_100059990 3300032126 Bacteria 2626
309 Ga0307415_100114432 3300032126 Bacteria 2008
310 Ga0373926_0004327 3300035083 Bacteria 4653
311 Ga0373934_0003780 3300035086 Bacteria 5573
312 Ga0373940_0023726 3300035088 Bacteria 1585
313 Ga0373944_0117591 3300035089 Bacteria 913
314 Ga0373923_0195479 3300035111 Bacteria 933
315 Ga0373953_0008287 3300035117 Bacteria 3523
316 Ga0373954_0001840 3300035118 Bacteria 8754
317 Ga0373954_0072905 3300035118 Bacteria 1633
318 Ga0373956_0011293 3300035119 Bacteria 3678
319 Ga0373957_0007917 3300035120 Bacteria 3420
320 Ga0373943_0023524 3300035170 Bacteria 2865
321 Ga0373955_0006536 3300035172 Bacteria 5316
322 Ga0373955_0160579 3300035172 Bacteria 1326
323 Ga0373955_0350738 3300035172 Bacteria 894
324 Ga0373942_0001086 3300035207 Bacteria 7288
325 Ga0373942_0123894 3300035207 Bacteria 810
326 Ga0373924_0021234 3300035410 Bacteria 2531
327 Ga0373935_0006822 3300035692 Bacteria 6819
328 Ga0373935_0025728 3300035692 Bacteria 3627
329 Ga0373927_0007150 3300035695 Bacteria 7573
330 Ga0373933_0027297 3300035724 Bacteria 3286
331 Ga0373933_0067201 3300035724 Bacteria 2174
332 Ga0373947_0037685 3300035725 Bacteria 2870
333 Ga0373947_0068582 3300035725 Bacteria 2169
334 Ga0373937_0040893 3300036401 Bacteria 4227
335 Ga0373937_0062678 3300036401 Bacteria 3418
336 Ga0373937_0156398 3300036401 Bacteria 2137
337 Ga0310110_014272 3300036535 Eukaryota 1144
338 Ga0316584_0498753 3300036712 Bacteria 856
339 Ga0373925_0034733 3300037068 Bacteria 3717
340 Ga0373925_0045338 3300037068 Bacteria 3266
341 Ga0373925_0065682 3300037068 Bacteria 2733
342 Ga0395898_0035350 3300037466 Bacteria 4969
343 Ga0395901_0618408 3300038443 Bacteria 1090
344 Ga0400484_38127 3300038725 Bacteria 2661
345 Ga0400483_286598 3300039062 Bacteria 2225
346 Ga0436360_0971829 3300039438 Bacteria 1179
347 Ga0451577_0314979 3300042876 Bacteria 1418
348 Ga0466966_0003050 3300044684 Bacteria 11050
349 Ga0466964_0175041 3300044706 Bacteria 1013
350 Ga0453684_0234625 3300044712 Bacteria 2115
351 Ga0451576_0002819 3300045051 Bacteria 25036
352 Ga0451576_0003913 3300045051 Bacteria 19889
353 Ga0451576_0005813 3300045051 Bacteria 15340
354 Ga0451576_0027918 3300045051 Bacteria 6054
355 Ga0451576_0156643 3300045051 Bacteria 2376
356 Ga0466967_0290901 3300045976 Bacteria 1569
357 Ga0495629_0009770 3300046459 Bacteria 7002
358 Ga0495651_0070974 3300046462 Bacteria 2649
359 Ga0495653_0388726 3300046463 Bacteria 889
360 Ga0495580_0139223 3300046472 Bacteria 1682
361 Ga0495662_0056731 3300046476 Bacteria 1891
362 Ga0495616_0000687 3300046513 Bacteria 25047
363 Ga0495630_0183016 3300046517 Bacteria 1598
364 Ga0495632_0050172 3300046519 Bacteria 2059
365 Ga0495642_0056534 3300046528 Bacteria 1621
366 Ga0495652_0031147 3300046529 Bacteria 4673
367 Ga0495665_0061462 3300046531 Bacteria 1983
368 Ga0495586_0128755 3300046535 Bacteria 1417
369 Ga0495587_0259455 3300046536 Bacteria 976
370 Ga0495621_0015073 3300046539 Bacteria 2459
371 Ga0495645_0000805 3300046543 Bacteria 21490
372 Ga0495667_0034445 3300046559 Bacteria 3387
373 Ga0495634_0125426 3300046642 Bacteria 1641
374 Ga0495635_0029084 3300046663 Bacteria 3841
375 Ga0495635_0211800 3300046663 Bacteria 1312
376 Ga0495599_0000941 3300046678 Bacteria 16273
377 Ga0495623_0060153 3300046679 Bacteria 2384
378 Ga0495658_0045119 3300046683 Bacteria 2472
379 Ga0495581_0002351 3300047315 Bacteria 10667
380 Ga0495604_0079008 3300047317 Bacteria 2468
381 Ga0495674_0165630 3300047319 Bacteria 1847
382 Ga0495673_0040173 3300047469 Bacteria 2116
383 Ga0495686_0000100 3300047472 Bacteria 180492
384 Ga0495602_0261360 3300048088 Bacteria 1284
385 Ga0495614_0088469 3300048089 Bacteria 1346
386 Ga0496101_0169068 3300048904 Bacteria 1679
387 Ga0496104_0052089 3300048907 Bacteria 3865
388 Ga0496105_0027664 3300048908 Bacteria 4635
389 Ga0496106_0136362 3300048909 Bacteria 1928
390 Ga0496106_0251779 3300048909 Bacteria 1412
391 Ga0496106_0289084 3300048909 Bacteria 1314
392 Ga0496107_0231386 3300048910 Bacteria 1375
393 Ga0496108_0001356 3300048911 Bacteria 19238
394 Ga0496108_0020388 3300048911 Bacteria 5450
395 Ga0496109_0017738 3300048912 Bacteria 6244
396 Ga0496109_0151105 3300048912 Bacteria 2174
397 Ga0496110_0256489 3300048913 Bacteria 1592
398 Ga0496110_0294525 3300048913 Bacteria 1478
399 Ga0496110_0413767 3300048913 Bacteria 1229
400 Ga0496112_0008342 3300048915 Bacteria 9275
401 Ga0496114_0024491 3300048917 Bacteria 4928
402 Ga0496116_0038050 3300048919 Bacteria 3346
403 Ga0496121_0000065 3300048924 Bacteria 269310
404 Ga0496121_0082990 3300048924 Bacteria 2531
405 Ga0496122_0083618 3300048925 Bacteria 2212
406 Ga0496123_0054565 3300048926 Bacteria 2630
407 Ga0496124_0015098 3300048927 Bacteria 7426
408 Ga0496124_0316112 3300048927 Bacteria 1120
409 Ga0496125_0014828 3300048928 Bacteria 7568
410 Ga0496125_0019559 3300048928 Bacteria 6381
411 Ga0496125_0349858 3300048928 Bacteria 883
412 Ga0496126_0023509 3300048929 Bacteria 5972
413 Ga0501308_003499 3300049128 Bacteria 1457
414 Ga0501312_012076 3300049528 Bacteria 1183
415 Ga0501032_0103324 3300049569 Bacteria 1888
416 Ga0501033_0002540 3300049570 Bacteria 15451
417 Ga0501033_0108678 3300049570 Bacteria 2020
418 Ga0501034_0137439 3300049571 Bacteria 2424
419 Ga0501034_0422386 3300049571 Bacteria 1254
420 Ga0501036_0003547 3300049572 Bacteria 12480
421 Ga0501037_0010375 3300049573 Bacteria 6834
422 Ga0501038_0013556 3300049574 Bacteria 7429
423 Ga0501038_0071637 3300049574 Bacteria 2939
424 Ga0501039_0000199 3300049575 Bacteria 43314
425 Ga0501039_0093367 3300049575 Bacteria 2345
426 Ga0501040_0000082 3300049576 Bacteria 46447
427 Ga0501040_0075032 3300049576 Bacteria 2337
428 Ga0501041_0000410 3300049577 Bacteria 21637
429 Ga0501042_0003570 3300049578 Bacteria 9797
430 Ga0501043_0100698 3300049579 Bacteria 2271
431 Ga0501046_0006832 3300049580 Bacteria 10066
432 Ga0501046_0057771 3300049580 Bacteria 3043
433 Ga0501046_0106590 3300049580 Bacteria 2145
434 Ga0501047_0107094 3300049581 Bacteria 2677
435 Ga0501047_0200513 3300049581 Bacteria 1856
436 Ga0501048_0001243 3300049582 Bacteria 19319
437 Ga0501048_0508967 3300049582 Bacteria 863
438 Ga0501068_0022856 3300049584 Bacteria 3661
439 Ga0501069_0085048 3300049585 Bacteria 1785
440 Ga0501070_0112295 3300049586 Bacteria 2252
441 Ga0501071_0000316 3300049587 Bacteria 23302
442 Ga0501071_0008661 3300049587 Bacteria 6729
443 Ga0501072_0007920 3300049588 Bacteria 8067
444 Ga0501072_0065782 3300049588 Bacteria 2859
445 Ga0501072_0074585 3300049588 Bacteria 2683
446 Ga0501074_0001772 3300049590 Bacteria 14753
447 Ga0501074_0110642 3300049590 Bacteria 1965
448 Ga0501075_0000696 3300049591 Bacteria 20851
449 Ga0501075_0121379 3300049591 Bacteria 1989
450 Ga0501076_0000856 3300049592 Bacteria 19728
451 Ga0501077_0022401 3300049593 Bacteria 4001
452 Ga0501223_000050 3300049663 Bacteria 40578
453 Ga0501246_008835 3300049676 Bacteria 898
454 Ga0501079_0000165 3300049741 Bacteria 36937
455 Ga0501079_0117905 3300049741 Bacteria 2063
456 Ga0501079_0676453 3300049741 Bacteria 812
457 Ga0501080_0005242 3300049742 Bacteria 11550
458 Ga0501080_0036464 3300049742 Bacteria 4590
459 Ga0501080_0604230 3300049742 Bacteria 973
460 Ga0501081_0001217 3300049743 Bacteria 15671
461 Ga0501083_0302029 3300049744 Bacteria 1041
462 Ga0501044_0042860 3300049823 Bacteria 4705
463 Ga0501044_0229018 3300049823 Bacteria 1807
464 Ga0501044_0360263 3300049823 Bacteria 1372
465 Ga0501045_0000012 3300049824 Bacteria 74001
466 nmdc:mga05p37_196117_c1 3300050507 Bacteria 2448
467 nmdc:mga05p37_325782_c1 3300050507 Bacteria 1817
468 nmdc:mga05p37_623_c1 3300050507 Bacteria 39191
469 nmdc:mga09592_1081_c1 3300050508 Bacteria 21649
470 nmdc:mga09592_22108_c1 3300050508 Bacteria 5247
471 nmdc:mga09592_2644_c1 3300050508 Bacteria 14481
472 nmdc:mga09592_2947_c1 3300050508 Bacteria 13794
473 nmdc:mga0qj67_42027_c1 3300050509 Bacteria 3598
474 nmdc:mga0qj67_851_c1 3300050509 Bacteria 20946
475 nmdc:mga06r32_69308_c1 3300050510 Bacteria 3408
476 nmdc:mga06r32_7280_c1 3300050510 Bacteria 9966
477 nmdc:mga06r32_8383_c1 3300050510 Bacteria 9308
478 nmdc:mga06r32_9532_c1 3300050510 Bacteria 8767
479 nmdc:mga08y16_3447_c1 3300050511 Bacteria 16415
480 nmdc:mga08y16_644414_c1 3300050511 Bacteria 1064
481 nmdc:mga08y16_9734_c1 3300050511 Bacteria 10093
482 nmdc:mga0rr50_311694_c1 3300050513 Bacteria 1318
483 nmdc:mga0rr50_488159_c1 3300050513 Bacteria 1046
484 nmdc:mga08x19_13096_c1 3300050514 Bacteria 5009
485 nmdc:mga08x19_326146_c1 3300050514 Bacteria 1069
486 nmdc:mga0a205_185371_c1 3300050515 Bacteria 1974
487 nmdc:mga0a205_272462_c1 3300050515 Bacteria 1569
488 Ga0495619_0046440 3300053085 Bacteria 2855
489 Ga0500643_000110 3300053087 Bacteria 85114
490 Ga0501084_0000200 3300054114 Bacteria 46374
491 Ga0500661_000247 3300055283 Bacteria 9695
492 Ga0501082_0022004 3300060353 Bacteria 5497
493 2547374307 2547132103 Bacteria 5115736
494 2809063999 2808606401 Bacteria 4586670
495 2809079967 2808606404 Bacteria 4652788
496 2809084332 2808606405 Bacteria 4586632
497 2843694829 2843690924 Bacteria 5169057
498 2880522860 2880518877 Bacteria 5012590
499 Ga0075431_100084769
500 LJQas_1002647
501 JGI25151J46595_10005033
502 Ga0006557J51388_1005984
503 Ga0006558J51389_1004057
504 Ga0006559J51393_1004269
505 Ga0006553J51392_1005814
506 Ga0006555J51386_1005679
507 Ga0006560J51390_1007073
508 Ga0006554J51385_1005085
509 Ga0065704_10005227
510 Ga0070683_100049943
511 Ga0070690_100002222
512 Ga0068869_100002111
513 Ga0068869_100388203
514 Ga0070666_10004006
515 Ga0070680_100001466
516 Ga0070682_100011826
517 Ga0068868_100003608
518 Ga0068868_100003616
519 Ga0068868_100500267
520 Ga0070689_100007839
521 Ga0070689_100008083
522 Ga0070691_10007280
523 Ga0070687_100000392
524 Ga0070661_100405551
525 Ga0070692_10015336
526 Ga0070692_10030270
527 Ga0070669_100104619
528 Ga0070671_100101681
529 Ga0070673_100001292
530 Ga0070688_100032201
531 Ga0070659_100011661
532 Ga0070667_100420101
533 Ga0070703_10008377
534 Ga0070709_10035498
535 Ga0070709_10047459
536 Ga0070709_10550742
537 Ga0070714_100045428
538 Ga0070713_100003742
539 Ga0070713_100004299
540 Ga0070710_10064259
541 Ga0070710_10150964
542 Ga0070711_100014399
543 Ga0070705_100000198
544 Ga0070705_100020071
545 Ga0070700_100000336
546 Ga0070694_100003027
547 Ga0070694_100014620
548 Ga0070694_100035967
549 Ga0070694_100168786
550 Ga0070694_100245581
551 Ga0070694_100262048
552 Ga0070708_100001935
553 Ga0070663_100035004
554 Ga0070678_100084892
555 Ga0070681_10205721
556 Ga0068867_100000780
557 Ga0070685_10009758
558 Ga0070706_100031956
559 Ga0070706_100096908
560 Ga0070706_100103333
561 Ga0070707_100180278
562 Ga0070707_100434691
563 Ga0070698_100012262
564 Ga0070698_100747893
565 Ga0070699_100012359
566 Ga0070679_100012766
567 Ga0070679_100328690
568 Ga0070684_100157003
569 Ga0070684_100392845
570 Ga0070697_100064507
571 Ga0068853_100040180
572 Ga0070672_100017642
573 Ga0070686_100000595
574 Ga0070686_100011826
575 Ga0070695_100000292
576 Ga0070695_100133087
577 Ga0070696_100000489
578 Ga0070696_100005949
579 Ga0070696_100126517
580 Ga0070693_100000126
581 Ga0070693_100001405
582 Ga0070665_100001673
583 Ga0070704_100011353
584 Ga0070704_100164093
585 Ga0070704_100425206
586 Ga0070704_100449149
587 Ga0068855_100031341
588 Ga0070664_100350508
589 Ga0068857_100101767
590 Ga0068857_100128797
591 Ga0068854_100009382
592 Ga0068854_100023752
593 Ga0068854_100040014
594 Ga0068856_100046851
595 Ga0070702_100001112
596 Ga0070702_100083120
597 Ga0068852_100021891
598 Ga0068852_100111305
599 Ga0068859_100011156
600 Ga0068859_100027966
601 Ga0068864_100001224
602 Ga0068866_10000451
603 Ga0068866_10040480
604 Ga0068861_100002990
605 Ga0068861_100323913
606 Ga0068870_10062323
607 Ga0068858_100004859
608 Ga0068858_100170612
609 Ga0068860_100011341
610 Ga0068860_100216627
611 Ga0068860_100260090
612 Ga0068860_100428592
613 Ga0068862_100009361
614 Ga0068862_100361590
615 Ga0070716_100051244
616 Ga0070716_100142537
617 Ga0070712_100014569
618 Ga0070712_100075734
619 Ga0097621_100000804
620 Ga0097621_100150112
621 Ga0068871_100004146
622 Ga0075428_100000657
623 Ga0075428_100001001
624 Ga0075428_100116163
625 Ga0075428_100721374
626 Ga0075430_100000318
627 Ga0075430_100552581
628 Ga0075431_100015013
629 Ga0075431_100039376
630 Ga0075431_100043885
631 Ga0075431_100054765
632 Ga0075431_100203713
633 Ga0075433_10119457
634 Ga0075429_100000194
635 Ga0075429_100000363
636 Ga0075429_100002260
637 Ga0075429_100017886
638 Ga0068865_100001740
639 Ga0068865_100186728
640 Ga0097620_100011157
641 Ga0097620_100027966
642 Ga0099794_10008097
643 Ga0099794_10156183
644 Ga0105251_10060950
645 Ga0105240_10000867
646 Ga0105240_10070393
647 Ga0111539_10001999
648 Ga0105245_10003910
649 Ga0105245_10058232
650 Ga0105245_10063947
651 Ga0114129_10001363
652 Ga0114129_10033238
653 Ga0105243_10000576
654 Ga0105243_10210824
655 Ga0105241_10031493
656 Ga0105241_10176500
657 Ga0105242_10004469
658 Ga0105242_10009273
659 Ga0105242_10061360
660 Ga0105242_10327101
661 Ga0105248_10001399
662 Ga0105248_10057468
663 Ga0105237_10000303
664 Ga0105238_10088573
665 Ga0105249_10245774
666 Ga0105249_10509047
667 Ga0105249_10725841
668 Ga0099796_10020239
669 Ga0105239_10000151
670 Ga0105239_10665409
671 Ga0105246_10192584
672 Ga0157373_10282464
673 Ga0157374_10002626
674 Ga0157374_10914000
675 Ga0157378_10001643
676 Ga0157378_10101007
677 Ga0157378_10107301
678 Ga0163162_10032020
679 Ga0163162_10045802
680 Ga0163162_10103284
681 Ga0157372_10137408
682 Ga0163163_10003775
683 Ga0157380_10011765
684 Ga0157379_10002694
685 Ga0157376_10055816
686 Ga0157376_10291941
687 Ga0157376_10539309
688 Ga0163161_10009377
689 Ga0163161_10029877
690 Ga0206353_10072236
691 Ga0213871_10081387
692 Ga0247524_105614
693 Ga0247519_105217
694 Ga0247516_106361
695 Ga0247515_105745
696 Ga0209025_1000034
697 Ga0207426_1002320
698 Ga0207653_10007371
699 Ga0207653_10038391
700 Ga0207692_10004853
701 Ga0207692_10133570
702 Ga0207642_10000598
703 Ga0207680_10008068
704 Ga0207643_10047216
705 Ga0207684_10158987
706 Ga0207684_10197169
707 Ga0207654_10013379
708 Ga0207654_10196946
709 Ga0207654_10440978
710 Ga0207707_10633643
711 Ga0207695_10005103
712 Ga0207695_10755378
713 Ga0207671_10000881
714 Ga0207693_10014341
715 Ga0207663_10041797
716 Ga0207660_10002378
717 Ga0207660_10138431
718 Ga0207662_10039719
719 Ga0207662_10053540
720 Ga0207657_10011112
721 Ga0207657_10071296
722 Ga0207649_10031970
723 Ga0207652_10006354
724 Ga0207646_10121885
725 Ga0207646_10133482
726 Ga0207681_10191500
727 Ga0207694_10112161
728 Ga0207694_10327936
729 Ga0207687_10002399
730 Ga0207687_10003319
731 Ga0207700_10009195
732 Ga0207700_10019559
733 Ga0207664_10001202
734 Ga0207644_10020526
735 Ga0207690_10062020
736 Ga0207706_10042287
737 Ga0207706_10089449
738 Ga0207706_10266338
739 Ga0207686_10001546
740 Ga0207686_10002725
741 Ga0207686_10032841
742 Ga0207709_10001943
743 Ga0207709_10200410
744 Ga0207670_10007607
745 Ga0207670_10155125
746 Ga0207669_10136280
747 Ga0207704_10008432
748 Ga0207665_10014976
749 Ga0207691_10053117
750 Ga0207691_10117180
751 Ga0207711_10001412
752 Ga0207711_10021773
753 Ga0207689_10081708
754 Ga0207679_10504319
755 Ga0207667_10014474
756 Ga0207667_10118041
757 Ga0207651_10004291
758 Ga0207651_10081783
759 Ga0207712_10285439
760 Ga0207640_10001543
761 Ga0207640_10100492
762 Ga0207640_10101178
763 Ga0207658_10025291
764 Ga0207658_10334768
765 Ga0207677_10007549
766 Ga0207677_10018513
767 Ga0207677_10026015
768 Ga0207677_10272504
769 Ga0207703_10001566
770 Ga0207703_10011228
771 Ga0207678_10054514
772 Ga0207678_10068845
773 Ga0207708_10001410
774 Ga0207702_10352165
775 Ga0207648_10000359
776 Ga0207648_10073261
777 Ga0207676_10000429
778 Ga0207674_10028853
779 Ga0207674_10250965
780 Ga0207683_10001317
781 Ga0207698_10634015
782 Ga0209588_1116698
783 Ga0207428_10001254
784 Ga0268266_10018442
785 Ga0268265_10010013
786 Ga0268265_10192903
787 Ga0268264_10009307
788 Ga0268264_10015263
789 Ga0268264_10021447
790 Ga0265336_10000062
791 Ga0265324_10000370
792 Ga0310101_109498
793 Ga0316579_10000237
794 Ga0307405_10053673
795 Ga0316044_110253
796 Ga0316045_107015
797 Ga0316042_108822
798 Ga0316043_108565
799 Ga0307406_10165778
800 Ga0307409_100112869
801 Ga0307409_100589660
802 Ga0307416_100176968
803 Ga0307416_100444199
804 Ga0307416_101293519
805 Ga0307411_10333532
806 Ga0307415_100059990
807 Ga0307415_100114432
808 Ga0373926_0004327
809 Ga0373934_0003780
810 Ga0373940_0023726
811 Ga0373944_0117591
812 Ga0373923_0195479
813 Ga0373953_0008287
814 Ga0373954_0001840
815 Ga0373954_0072905
816 Ga0373956_0011293
817 Ga0373957_0007917
818 Ga0373943_0023524
819 Ga0373955_0006536
820 Ga0373955_0160579
821 Ga0373955_0350738
822 Ga0373942_0001086
823 Ga0373942_0123894
824 Ga0373924_0021234
825 Ga0373935_0006822
826 Ga0373935_0025728
827 Ga0373927_0007150
828 Ga0373933_0027297
829 Ga0373933_0067201
830 Ga0373947_0037685
831 Ga0373947_0068582
832 Ga0373937_0040893
833 Ga0373937_0062678
834 Ga0373937_0156398
835 Ga0310110_014272
836 Ga0316584_0498753
837 Ga0373925_0034733
838 Ga0373925_0045338
839 Ga0373925_0065682
840 Ga0395898_0035350
841 Ga0395901_0618408
842 Ga0400484_38127
843 Ga0400483_286598
844 Ga0436360_0971829
845 Ga0451577_0314979
846 Ga0466966_0003050
847 Ga0466964_0175041
848 Ga0453684_0234625
849 Ga0451576_0002819
850 Ga0451576_0003913
851 Ga0451576_0005813
852 Ga0451576_0027918
853 Ga0451576_0156643
854 Ga0466967_0290901
855 Ga0495629_0009770
856 Ga0495651_0070974
857 Ga0495653_0388726
858 Ga0495580_0139223
859 Ga0495662_0056731
860 Ga0495616_0000687
861 Ga0495630_0183016
862 Ga0495632_0050172
863 Ga0495642_0056534
864 Ga0495652_0031147
865 Ga0495665_0061462
866 Ga0495586_0128755
867 Ga0495587_0259455
868 Ga0495621_0015073
869 Ga0495645_0000805
870 Ga0495667_0034445
871 Ga0495634_0125426
872 Ga0495635_0029084
873 Ga0495635_0211800
874 Ga0495599_0000941
875 Ga0495623_0060153
876 Ga0495658_0045119
877 Ga0495581_0002351
878 Ga0495604_0079008
879 Ga0495674_0165630
880 Ga0495673_0040173
881 Ga0495686_0000100
882 Ga0495602_0261360
883 Ga0495614_0088469
884 Ga0496101_0169068
885 Ga0496104_0052089
886 Ga0496105_0027664
887 Ga0496106_0136362
888 Ga0496106_0251779
889 Ga0496106_0289084
890 Ga0496107_0231386
891 Ga0496108_0001356
892 Ga0496108_0020388
893 Ga0496109_0017738
894 Ga0496109_0151105
895 Ga0496110_0256489
896 Ga0496110_0294525
897 Ga0496110_0413767
898 Ga0496112_0008342
899 Ga0496114_0024491
900 Ga0496116_0038050
901 Ga0496121_0000065
902 Ga0496121_0082990
903 Ga0496122_0083618
904 Ga0496123_0054565
905 Ga0496124_0015098
906 Ga0496124_0316112
907 Ga0496125_0014828
908 Ga0496125_0019559
909 Ga0496125_0349858
910 Ga0496126_0023509
911 Ga0501308_003499
912 Ga0501312_012076
913 Ga0501032_0103324
914 Ga0501033_0002540
915 Ga0501033_0108678
916 Ga0501034_0137439
917 Ga0501034_0422386
918 Ga0501036_0003547
919 Ga0501037_0010375
920 Ga0501038_0013556
921 Ga0501038_0071637
922 Ga0501039_0000199
923 Ga0501039_0093367
924 Ga0501040_0000082
925 Ga0501040_0075032
926 Ga0501041_0000410
927 Ga0501042_0003570
928 Ga0501043_0100698
929 Ga0501046_0006832
930 Ga0501046_0057771
931 Ga0501046_0106590
932 Ga0501047_0107094
933 Ga0501047_0200513
934 Ga0501048_0001243
935 Ga0501048_0508967
936 Ga0501068_0022856
937 Ga0501069_0085048
938 Ga0501070_0112295
939 Ga0501071_0000316
940 Ga0501071_0008661
941 Ga0501072_0007920
942 Ga0501072_0065782
943 Ga0501072_0074585
944 Ga0501074_0001772
945 Ga0501074_0110642
946 Ga0501075_0000696
947 Ga0501075_0121379
948 Ga0501076_0000856
949 Ga0501077_0022401
950 Ga0501223_000050
951 Ga0501246_008835
952 Ga0501079_0000165
953 Ga0501079_0117905
954 Ga0501079_0676453
955 Ga0501080_0005242
956 Ga0501080_0036464
957 Ga0501080_0604230
958 Ga0501081_0001217
959 Ga0501083_0302029
960 Ga0501044_0042860
961 Ga0501044_0229018
962 Ga0501044_0360263
963 Ga0501045_0000012
964 nmdc:mga05p37_196117_c1
965 nmdc:mga05p37_325782_c1
966 nmdc:mga05p37_623_c1
967 nmdc:mga09592_1081_c1
968 nmdc:mga09592_22108_c1
969 nmdc:mga09592_2644_c1
970 nmdc:mga09592_2947_c1
971 nmdc:mga0qj67_42027_c1
972 nmdc:mga0qj67_851_c1
973 nmdc:mga06r32_69308_c1
974 nmdc:mga06r32_7280_c1
975 nmdc:mga06r32_8383_c1
976 nmdc:mga06r32_9532_c1
977 nmdc:mga08y16_3447_c1
978 nmdc:mga08y16_644414_c1
979 nmdc:mga08y16_9734_c1
980 nmdc:mga0rr50_311694_c1
981 nmdc:mga0rr50_488159_c1
982 nmdc:mga08x19_13096_c1
983 nmdc:mga08x19_326146_c1
984 nmdc:mga0a205_185371_c1
985 nmdc:mga0a205_272462_c1
986 Ga0495619_0046440
987 Ga0500643_000110
988 Ga0501084_0000200
989 Ga0500661_000247
990 Ga0501082_0022004
991 2547374307
992 2809063999
993 2809079967
994 2809084332
995 2843694829
996 2880522860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

51

234

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xiw-assembly1.cif.gz_B-2 crystal structure of the sac7d-derived igg1-binder c3-c24s 0.9386 146 173
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9381 1 227
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9302 1 227
2a1t-assembly1.cif.gz_S structure of the human mcad:etf e165betaa complex 0.8984 2 246
8qpc-assembly1.cif.gz_AA 18mer dna mimic foldamer with an aromatic linker in complex with sac7d v26a/m29a protein 0.8973 147 173
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9381 1 227 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9302 1 227 3.40.50.620
af_Q504N7_328_393_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8788 146 173 2.40.50.140
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8783 1 215 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8648 2 252 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4V2DP92-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9878 1 85 GO:0009055
AF-A0A3D2M539-F1-model_v4 Electron transporter RnfB 0.9845 1 87 GO:0009055
AF-A0A0D7V1E6-F1-model_v4 deleted 0.9844 1 82
AF-A0A6L7G6G7-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9839 1 82 GO:0009055
AF-A0A368TRL3-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9832 1 114 GO:0009055

Map