F455203

General Info

Members Datasets Scaffolds Average Seq Length
498 236 996 267

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10310107|Ga0207646_103101072
Length 301
Sequence MNEGSSVAGLVGPSPAAPGGLDISGVTVRFGGLTALDDVSLSAAPRQVTGIIGPNGAGKTTLLNAACGFVRPQSGTITFNGHELTGIRPHRLASLGIARTLQGVGLFRGLSVVENVMIGATHSARAGFWSGFLGLPRSDRDERRLREEALRALSRVGVEDLADSMPETLAYGLRKRVALARALVGHPRLLLLDEPASGLSEKELPELGDLIKTLADEAGVVVIEHRMDLVMSVCDTIFVLDFGRLIATGTPEQVQADPAVTAAYLGSDVTAGAGELGASGPEQTAGQSVWSDDAGATGAHE

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
110 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
211 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
212 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
213 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
214 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
215 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
216 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
217 2858882152 Micromonospora noduli MED15 Isolate Nodule
218 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
219 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
220 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
221 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
222 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
223 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
224 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
225 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
226 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
227 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
228 2902582711 Micromonospora sp. AP08 Isolate Unclassified
229 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
230 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
231 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
232 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
233 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
234 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
235 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
236 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.98
Metatranscriptomes 0
Isolates 5.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 1
Rhizoplane 6.22
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10310107 3300025922 Bacteria 1426
2 Ga0070676_10013034 3300005328 Bacteria 4556
3 Ga0070683_100000877 3300005329 Bacteria 22269
4 Ga0070683_100022105 3300005329 Bacteria 5682
5 Ga0070683_100738623 3300005329 Bacteria 943
6 Ga0070670_100097136 3300005331 Bacteria 2534
7 Ga0068869_100030443 3300005334 Bacteria 3789
8 Ga0068869_100165360 3300005334 Bacteria 1725
9 Ga0070682_100413025 3300005337 Bacteria 1024
10 Ga0068868_100008816 3300005338 Bacteria 7227
11 Ga0068868_100363057 3300005338 Bacteria 1243
12 Ga0070660_100061457 3300005339 Bacteria 2917
13 Ga0070661_100375565 3300005344 Bacteria 1120
14 Ga0070668_100472087 3300005347 Bacteria 1082
15 Ga0070659_100012787 3300005366 Bacteria 6233
16 Ga0070709_10000482 3300005434 Bacteria 23485
17 Ga0070709_10012377 3300005434 Bacteria 4775
18 Ga0070709_10067201 3300005434 Bacteria 2301
19 Ga0070709_10180327 3300005434 Bacteria 1482
20 Ga0070714_100000563 3300005435 Bacteria 26691
21 Ga0070714_100001859 3300005435 Bacteria 15374
22 Ga0070714_100009272 3300005435 Bacteria 7734
23 Ga0070713_100001453 3300005436 Bacteria 15114
24 Ga0070713_100047595 3300005436 Bacteria 3526
25 Ga0070713_100202495 3300005436 Bacteria 1793
26 Ga0070710_10000452 3300005437 Bacteria 19246
27 Ga0070710_10086450 3300005437 Bacteria 1841
28 Ga0070711_100000259 3300005439 Bacteria 27048
29 Ga0070708_100001174 3300005445 Bacteria 20181
30 Ga0070708_100002228 3300005445 Bacteria 14985
31 Ga0070708_100080696 3300005445 Bacteria 2944
32 Ga0070708_100160671 3300005445 Bacteria 2094
33 Ga0070662_100145138 3300005457 Bacteria 1843
34 Ga0070681_10356885 3300005458 Bacteria 1372
35 Ga0070681_10412557 3300005458 Bacteria 1262
36 Ga0070706_100045367 3300005467 Bacteria 4060
37 Ga0070706_100059541 3300005467 Bacteria 3525
38 Ga0070706_100351528 3300005467 Bacteria 1374
39 Ga0070707_100004919 3300005468 Bacteria 12525
40 Ga0070707_100013846 3300005468 Bacteria 7552
41 Ga0070707_100248307 3300005468 Bacteria 1732
42 Ga0070698_100000596 3300005471 Bacteria 38871
43 Ga0070698_100020380 3300005471 Bacteria 6950
44 Ga0070699_100056427 3300005518 Bacteria 3401
45 Ga0070699_100136713 3300005518 Bacteria 2162
46 Ga0070684_100002264 3300005535 Bacteria 14167
47 Ga0070684_100046326 3300005535 Bacteria 3768
48 Ga0070697_100155308 3300005536 Bacteria 1931
49 Ga0070695_100292580 3300005545 Bacteria 1201
50 Ga0070693_100104076 3300005547 Bacteria 1734
51 Ga0068855_100180078 3300005563 Bacteria 2390
52 Ga0068855_100354462 3300005563 Bacteria 1616
53 Ga0070664_100000100 3300005564 Bacteria 55301
54 Ga0070664_100260334 3300005564 Bacteria 1561
55 Ga0068857_100027135 3300005577 Bacteria 5052
56 Ga0068857_100378505 3300005577 Bacteria 1314
57 Ga0068856_100013922 3300005614 Bacteria 7780
58 Ga0068856_100030846 3300005614 Bacteria 5242
59 Ga0068856_100037267 3300005614 Bacteria 4771
60 Ga0068856_100276922 3300005614 Bacteria 1694
61 Ga0070702_100082390 3300005615 Bacteria 1930
62 Ga0068863_100041426 3300005841 Bacteria 4379
63 Ga0068858_100025221 3300005842 Bacteria 5533
64 Ga0068858_100068522 3300005842 Bacteria 3288
65 Ga0081540_1000548 3300005983 Bacteria 36395
66 Ga0081539_10000430 3300005985 Bacteria 89313
67 Ga0081539_10001750 3300005985 Bacteria 34635
68 Ga0070717_10000562 3300006028 Bacteria 23638
69 Ga0070717_10009810 3300006028 Bacteria 7210
70 Ga0070717_10014005 3300006028 Bacteria 6161
71 Ga0070717_10116506 3300006028 Bacteria 2284
72 Ga0070717_10251468 3300006028 Bacteria 1562
73 Ga0070717_10315181 3300006028 Bacteria 1393
74 Ga0070717_10335845 3300006028 Bacteria 1348
75 Ga0075432_10044119 3300006058 Bacteria 1563
76 Ga0070715_10000262 3300006163 Bacteria 12711
77 Ga0070715_10009871 3300006163 Bacteria 3381
78 Ga0070716_100000717 3300006173 Bacteria 14159
79 Ga0070716_100114368 3300006173 Bacteria 1678
80 Ga0070712_100001363 3300006175 Bacteria 14811
81 Ga0070712_100018958 3300006175 Bacteria 4478
82 Ga0070712_100040682 3300006175 Bacteria 3188
83 Ga0097621_100171261 3300006237 Bacteria 1871
84 Ga0068871_100040624 3300006358 Bacteria 3727
85 Ga0068871_100056380 3300006358 Bacteria 3194
86 Ga0075428_100418350 3300006844 Bacteria 1436
87 Ga0075431_100527152 3300006847 Bacteria 1170
88 Ga0075433_10031196 3300006852 Bacteria 4554
89 Ga0075433_10251708 3300006852 Bacteria 1567
90 Ga0075434_100465572 3300006871 Bacteria 1285
91 Ga0075436_100013457 3300006914 Bacteria 5601
92 Ga0075436_100017417 3300006914 Bacteria 4918
93 Ga0075435_100089623 3300007076 Bacteria 2536
94 Ga0099794_10035512 3300007265 Bacteria 2353
95 Ga0111539_10003076 3300009094 Bacteria 22107
96 Ga0111539_10021896 3300009094 Bacteria 7858
97 Ga0111539_10047517 3300009094 Bacteria 5128
98 Ga0105245_10040615 3300009098 Bacteria 4145
99 Ga0105245_10105704 3300009098 Bacteria 2611
100 Ga0114129_10000004 3300009147 Bacteria 160944
101 Ga0114129_10001880 3300009147 Bacteria 28626
102 Ga0114129_10501929 3300009147 Bacteria 1584
103 Ga0105237_10180042 3300009545 Bacteria 2114
104 Ga0105237_10291658 3300009545 Bacteria 1634
105 Ga0105239_10204317 3300010375 Bacteria 2214
106 Ga0157370_10082423 3300013104 Bacteria 3025
107 Ga0157369_10704082 3300013105 Bacteria 1040
108 Ga0157374_10050883 3300013296 Bacteria 3853
109 Ga0157374_10194427 3300013296 Bacteria 1985
110 Ga0163162_10253925 3300013306 Bacteria 1890
111 Ga0163162_10587523 3300013306 Bacteria 1240
112 Ga0157377_10052873 3300014745 Bacteria 2295
113 Ga0157379_10097286 3300014968 Bacteria 2642
114 Ga0157379_10111998 3300014968 Bacteria 2452
115 Ga0157376_10157500 3300014969 Bacteria 2055
116 Ga0213875_10000501 3300021388 Bacteria 32825
117 Ga0224572_1011731 3300024225 Bacteria 1658
118 Ga0207692_10000260 3300025898 Bacteria 18211
119 Ga0207692_10023166 3300025898 Bacteria 2868
120 Ga0207692_10207721 3300025898 Bacteria 1155
121 Ga0207642_10064294 3300025899 Bacteria 1719
122 Ga0207685_10003945 3300025905 Bacteria 3689
123 Ga0207685_10005311 3300025905 Bacteria 3387
124 Ga0207685_10020188 3300025905 Bacteria 2210
125 Ga0207685_10103121 3300025905 Bacteria 1223
126 Ga0207699_10000522 3300025906 Bacteria 19005
127 Ga0207699_10000987 3300025906 Bacteria 13528
128 Ga0207699_10001808 3300025906 Bacteria 10056
129 Ga0207699_10013008 3300025906 Bacteria 4245
130 Ga0207699_10250043 3300025906 Bacteria 1221
131 Ga0207645_10014650 3300025907 Bacteria 5237
132 Ga0207684_10000954 3300025910 Bacteria 32598
133 Ga0207684_10006176 3300025910 Bacteria 10954
134 Ga0207684_10229257 3300025910 Bacteria 1603
135 Ga0207693_10003821 3300025915 Bacteria 12828
136 Ga0207693_10039301 3300025915 Bacteria 3726
137 Ga0207693_10057568 3300025915 Bacteria 3046
138 Ga0207693_10186757 3300025915 Bacteria 1631
139 Ga0207693_10262816 3300025915 Bacteria 1353
140 Ga0207663_10001104 3300025916 Bacteria 12404
141 Ga0207663_10038326 3300025916 Bacteria 2896
142 Ga0207663_10070294 3300025916 Bacteria 2255
143 Ga0207660_10215267 3300025917 Bacteria 1506
144 Ga0207649_10322556 3300025920 Bacteria 1135
145 Ga0207646_10001035 3300025922 Bacteria 35522
146 Ga0207646_10020246 3300025922 Bacteria 6167
147 Ga0207646_10074921 3300025922 Bacteria 3023
148 Ga0207646_10197250 3300025922 Bacteria 1818
149 Ga0207646_10237340 3300025922 Bacteria 1647
150 Ga0207687_10091096 3300025927 Bacteria 2223
151 Ga0207700_10000211 3300025928 Bacteria 34862
152 Ga0207700_10017675 3300025928 Bacteria 4769
153 Ga0207700_10048739 3300025928 Bacteria 3147
154 Ga0207700_10051694 3300025928 Bacteria 3068
155 Ga0207700_10091389 3300025928 Bacteria 2404
156 Ga0207700_10171673 3300025928 Bacteria 1809
157 Ga0207664_10000122 3300025929 Bacteria 68140
158 Ga0207664_10000453 3300025929 Bacteria 29102
159 Ga0207664_10007028 3300025929 Bacteria 7795
160 Ga0207664_10494926 3300025929 Bacteria 1094
161 Ga0207690_10053235 3300025932 Bacteria 2715
162 Ga0207706_10174820 3300025933 Bacteria 1886
163 Ga0207665_10000052 3300025939 Bacteria 74914
164 Ga0207689_10014688 3300025942 Bacteria 6650
165 Ga0207661_10004656 3300025944 Bacteria 9608
166 Ga0207661_10088375 3300025944 Bacteria 2576
167 Ga0207661_10100698 3300025944 Bacteria 2426
168 Ga0207661_10144162 3300025944 Bacteria 2053
169 Ga0207679_10024470 3300025945 Bacteria 4140
170 Ga0207679_10039590 3300025945 Bacteria 3367
171 Ga0207667_10461167 3300025949 Bacteria 1291
172 Ga0207640_10537694 3300025981 Bacteria 980
173 Ga0207677_10021498 3300026023 Bacteria 3944
174 Ga0207677_10057420 3300026023 Bacteria 2673
175 Ga0207677_10087973 3300026023 Bacteria 2251
176 Ga0207703_10045447 3300026035 Bacteria 3533
177 Ga0207703_10135694 3300026035 Bacteria 2130
178 Ga0207678_10012932 3300026067 Bacteria 7325
179 Ga0207708_10071754 3300026075 Bacteria 2653
180 Ga0207702_10032135 3300026078 Bacteria 4379
181 Ga0207702_10053531 3300026078 Bacteria 3417
182 Ga0207702_10095772 3300026078 Bacteria 2609
183 Ga0207641_10116752 3300026088 Bacteria 2375
184 Ga0207676_10095394 3300026095 Bacteria 2453
185 Ga0207676_10157468 3300026095 Bacteria 1964
186 Ga0207674_10007436 3300026116 Bacteria 12767
187 Ga0207683_10034320 3300026121 Bacteria 4408
188 Ga0268264_10160770 3300028381 Bacteria 2023
189 Ga0265336_10005282 3300028666 Bacteria 4784
190 Ga0307515_10002732 3300028794 Bacteria 37745
191 Ga0265338_10003675 3300028800 Bacteria 21377
192 Ga0307512_10019452 3300030522 Bacteria 6178
193 Ga0307513_10003860 3300031456 Bacteria 20162
194 Ga0307508_10002502 3300031616 Bacteria 19362
195 Ga0307406_10228866 3300031901 Bacteria 1387
196 Ga0307407_10250983 3300031903 Bacteria 1212
197 Ga0307409_100288696 3300031995 Bacteria 1520
198 Ga0307409_100324495 3300031995 Bacteria 1442
199 Ga0307411_10353961 3300032005 Bacteria 1198
200 Ga0307415_100032221 3300032126 Bacteria 3387
201 Ga0307415_100318334 3300032126 Bacteria 1296
202 Ga0307415_100321134 3300032126 Bacteria 1291
203 Ga0373934_0000415 3300035086 Bacteria 14940
204 Ga0373934_0024790 3300035086 Bacteria 2320
205 Ga0373934_0077926 3300035086 Bacteria 1329
206 Ga0373934_0137333 3300035086 Bacteria 999
207 Ga0373940_0063646 3300035088 Bacteria 1060
208 Ga0373951_0000305 3300035091 Bacteria 15567
209 Ga0373952_0007022 3300035092 Bacteria 2099
210 Ga0373923_0021934 3300035111 Bacteria 2498
211 Ga0373932_0003422 3300035112 Bacteria 3817
212 Ga0373936_0008776 3300035113 Bacteria 3808
213 Ga0373939_0032438 3300035114 Bacteria 1518
214 Ga0373941_0152326 3300035115 Bacteria 849
215 Ga0373945_0097309 3300035116 Bacteria 1147
216 Ga0373953_0001889 3300035117 Bacteria 6207
217 Ga0373953_0015112 3300035117 Bacteria 2790
218 Ga0373954_0001466 3300035118 Bacteria 9593
219 Ga0373954_0004284 3300035118 Bacteria 6132
220 Ga0373954_0089906 3300035118 Bacteria 1474
221 Ga0373956_0000476 3300035119 Bacteria 16441
222 Ga0373956_0022095 3300035119 Bacteria 2719
223 Ga0373956_0130907 3300035119 Bacteria 1174
224 Ga0373957_0000665 3300035120 Bacteria 8844
225 Ga0373957_0003976 3300035120 Bacteria 4444
226 Ga0373960_0004736 3300035121 Bacteria 3130
227 Ga0373943_0063261 3300035170 Bacteria 1854
228 Ga0373946_0116243 3300035171 Bacteria 1216
229 Ga0373955_0000004 3300035172 Bacteria 108650
230 Ga0373955_0005415 3300035172 Bacteria 5736
231 Ga0373955_0028065 3300035172 Bacteria 2915
232 Ga0373955_0128939 3300035172 Bacteria 1475
233 Ga0373924_0000888 3300035410 Bacteria 9434
234 Ga0373924_0019179 3300035410 Bacteria 2647
235 Ga0373924_0055673 3300035410 Bacteria 1646
236 Ga0373924_0087999 3300035410 Bacteria 1326
237 Ga0373924_0104128 3300035410 Bacteria 1222
238 Ga0373935_0060849 3300035692 Bacteria 2416
239 Ga0373935_0267657 3300035692 Bacteria 1200
240 Ga0373927_0039079 3300035695 Bacteria 3079
241 Ga0373927_0043615 3300035695 Bacteria 2903
242 Ga0373927_0154099 3300035695 Bacteria 1505
243 Ga0373933_0000005 3300035724 Bacteria 128820
244 Ga0373933_0007949 3300035724 Bacteria 5788
245 Ga0373933_0018237 3300035724 Bacteria 3945
246 Ga0373933_0056248 3300035724 Bacteria 2361
247 Ga0373933_0132461 3300035724 Bacteria 1568
248 Ga0373937_0000077 3300036401 Bacteria 89075
249 Ga0373937_0038582 3300036401 Bacteria 4352
250 Ga0373937_0050244 3300036401 Bacteria 3819
251 Ga0373937_0190131 3300036401 Bacteria 1929
252 Ga0373937_0326338 3300036401 Bacteria 1452
253 Ga0373925_0002811 3300037068 Bacteria 13741
254 Ga0373925_0029788 3300037068 Bacteria 4004
255 Ga0373925_0119766 3300037068 Bacteria 2042
256 Ga0373925_0246020 3300037068 Bacteria 1433
257 Ga0373925_0256966 3300037068 Bacteria 1402
258 Ga0373925_0260281 3300037068 Bacteria 1393
259 Ga0373925_0289282 3300037068 Bacteria 1321
260 Ga0395899_0002150 3300037312 Bacteria 16185
261 Ga0395899_0074816 3300037312 Bacteria 2474
262 Ga0395900_0021468 3300037418 Bacteria 6601
263 Ga0395900_0034723 3300037418 Bacteria 5194
264 Ga0395898_0007753 3300037466 Bacteria 11400
265 Ga0395898_0008812 3300037466 Bacteria 10631
266 Ga0395898_0011706 3300037466 Bacteria 9096
267 Ga0395898_0053624 3300037466 Bacteria 3938
268 Ga0395905_0004685 3300037471 Bacteria 14141
269 Ga0395905_0042181 3300037471 Bacteria 4281
270 Ga0436364_0614465 3300037853 Bacteria 45940
271 Ga0436364_1316847 3300037853 Bacteria 1815
272 Ga0395901_0002585 3300038443 Bacteria 18350
273 Ga0395901_0002983 3300038443 Bacteria 17070
274 Ga0395901_0035892 3300038443 Bacteria 5123
275 Ga0395901_0087409 3300038443 Bacteria 3259
276 Ga0395901_0186267 3300038443 Bacteria 2177
277 Ga0466963_0077640 3300044694 Bacteria 2244
278 Ga0466967_0079355 3300045976 Bacteria 2959
279 Ga0466967_0228146 3300045976 Bacteria 1772
280 Ga0495592_0000010 3300046454 Bacteria 157001
281 Ga0495592_0015533 3300046454 Bacteria 5776
282 Ga0495592_0034847 3300046454 Bacteria 3793
283 Ga0495592_0121350 3300046454 Bacteria 1838
284 Ga0495592_0420158 3300046454 Bacteria 843
285 Ga0495603_0023190 3300046455 Bacteria 3757
286 Ga0495629_0080589 3300046459 Bacteria 2272
287 Ga0495629_0179186 3300046459 Bacteria 1469
288 Ga0495629_0188841 3300046459 Bacteria 1426
289 Ga0495641_0104543 3300046461 Bacteria 1263
290 Ga0495651_0000006 3300046462 Bacteria 171575
291 Ga0495651_0003311 3300046462 Bacteria 12370
292 Ga0495651_0005914 3300046462 Bacteria 9333
293 Ga0495651_0087643 3300046462 Bacteria 2340
294 Ga0495651_0145319 3300046462 Bacteria 1715
295 Ga0495653_0009030 3300046463 Bacteria 8152
296 Ga0495653_0017860 3300046463 Bacteria 5767
297 Ga0495653_0054553 3300046463 Bacteria 3053
298 Ga0495653_0066037 3300046463 Bacteria 2721
299 Ga0495653_0071809 3300046463 Bacteria 2586
300 Ga0495580_0105334 3300046472 Bacteria 1960
301 Ga0495582_0098057 3300046473 Bacteria 1639
302 Ga0495639_0147519 3300046475 Bacteria 1133
303 Ga0495662_0013631 3300046476 Bacteria 3957
304 Ga0495664_0109529 3300046477 Bacteria 1666
305 Ga0495664_0140289 3300046477 Bacteria 1465
306 Ga0495664_0392585 3300046477 Bacteria 833
307 Ga0495606_0006349 3300046507 Bacteria 10938
308 Ga0495608_0000161 3300046511 Bacteria 47857
309 Ga0495608_0006242 3300046511 Bacteria 8460
310 Ga0495608_0006507 3300046511 Bacteria 8283
311 Ga0495608_0038660 3300046511 Bacteria 3203
312 Ga0495608_0083803 3300046511 Bacteria 2069
313 Ga0495618_0015242 3300046514 Bacteria 4690
314 Ga0495618_0062477 3300046514 Bacteria 2363
315 Ga0495618_0230348 3300046514 Bacteria 1166
316 Ga0495618_0279953 3300046514 Bacteria 1040
317 Ga0495628_0005475 3300046516 Bacteria 11117
318 Ga0495628_0009917 3300046516 Bacteria 8108
319 Ga0495628_0088290 3300046516 Bacteria 2403
320 Ga0495628_0136118 3300046516 Bacteria 1877
321 Ga0495630_0005638 3300046517 Bacteria 8844
322 Ga0495630_0050901 3300046517 Bacteria 3099
323 Ga0495630_0141359 3300046517 Bacteria 1830
324 Ga0495630_0233752 3300046517 Bacteria 1405
325 Ga0495652_0004827 3300046529 Bacteria 12820
326 Ga0495652_0033383 3300046529 Bacteria 4492
327 Ga0495652_0048388 3300046529 Bacteria 3644
328 Ga0495652_0094967 3300046529 Bacteria 2431
329 Ga0495652_0153329 3300046529 Bacteria 1797
330 Ga0495652_0272085 3300046529 Bacteria 1244
331 Ga0495665_0063197 3300046531 Bacteria 1954
332 Ga0495665_0170101 3300046531 Bacteria 1134
333 Ga0495640_0003463 3300046533 Bacteria 12702
334 Ga0495640_0061175 3300046533 Bacteria 2559
335 Ga0495640_0116447 3300046533 Bacteria 1740
336 Ga0495586_0120202 3300046535 Bacteria 1467
337 Ga0495587_0000152 3300046536 Bacteria 51432
338 Ga0495587_0002340 3300046536 Bacteria 12668
339 Ga0495587_0021908 3300046536 Bacteria 3940
340 Ga0495587_0026762 3300046536 Bacteria 3513
341 Ga0495587_0031811 3300046536 Bacteria 3192
342 Ga0495645_0010651 3300046543 Bacteria 6455
343 Ga0495645_0036678 3300046543 Bacteria 3573
344 Ga0495645_0060036 3300046543 Bacteria 2756
345 Ga0495645_0075773 3300046543 Bacteria 2421
346 Ga0495667_0000153 3300046559 Bacteria 46974
347 Ga0495668_0000173 3300046616 Bacteria 95830
348 Ga0495634_0009096 3300046642 Bacteria 7341
349 Ga0495634_0047988 3300046642 Bacteria 2876
350 Ga0495634_0069047 3300046642 Bacteria 2332
351 Ga0495634_0139008 3300046642 Bacteria 1543
352 Ga0495625_0001016 3300046660 Bacteria 37004
353 Ga0495635_0002118 3300046663 Bacteria 13471
354 Ga0495635_0021545 3300046663 Bacteria 4494
355 Ga0495635_0058714 3300046663 Bacteria 2646
356 Ga0495635_0085321 3300046663 Bacteria 2160
357 Ga0495635_0152731 3300046663 Bacteria 1572
358 Ga0495588_0067679 3300046674 Bacteria 1854
359 Ga0495657_0000082 3300046675 Bacteria 85101
360 Ga0495657_0002073 3300046675 Bacteria 17020
361 Ga0495657_0014404 3300046675 Bacteria 5805
362 Ga0495657_0041629 3300046675 Bacteria 3142
363 Ga0495657_0078916 3300046675 Bacteria 2132
364 Ga0495599_0000028 3300046678 Bacteria 113952
365 Ga0495599_0002654 3300046678 Bacteria 10429
366 Ga0495599_0019354 3300046678 Bacteria 4243
367 Ga0495599_0091254 3300046678 Bacteria 1900
368 Ga0495599_0225590 3300046678 Bacteria 1145
369 Ga0495623_0000746 3300046679 Bacteria 21773
370 Ga0495623_0041065 3300046679 Bacteria 2952
371 Ga0495623_0063944 3300046679 Bacteria 2303
372 Ga0495623_0074202 3300046679 Bacteria 2114
373 Ga0495623_0159384 3300046679 Bacteria 1327
374 Ga0495623_0293339 3300046679 Bacteria 901
375 Ga0495646_0004936 3300046680 Bacteria 8424
376 Ga0495646_0008393 3300046680 Bacteria 6565
377 Ga0495646_0026547 3300046680 Bacteria 3636
378 Ga0495646_0192239 3300046680 Bacteria 1115
379 Ga0495613_0081762 3300046689 Bacteria 2346
380 Ga0495613_0101666 3300046689 Bacteria 2076
381 Ga0495624_0087365 3300046690 Bacteria 1925
382 Ga0495600_0002631 3300046809 Bacteria 10358
383 Ga0495600_0005250 3300046809 Bacteria 7793
384 Ga0495600_0012188 3300046809 Bacteria 5369
385 Ga0495581_0041988 3300047315 Bacteria 2647
386 Ga0495581_0077962 3300047315 Bacteria 1917
387 Ga0495581_0164962 3300047315 Bacteria 1295
388 Ga0495604_0000086 3300047317 Bacteria 79200
389 Ga0495604_0039405 3300047317 Bacteria 3713
390 Ga0495604_0044149 3300047317 Bacteria 3485
391 Ga0495674_0003593 3300047319 Bacteria 15080
392 Ga0495674_0012892 3300047319 Bacteria 7872
393 Ga0495674_0070285 3300047319 Bacteria 3025
394 Ga0495674_0079372 3300047319 Bacteria 2818
395 Ga0495676_0117328 3300047321 Bacteria 1942
396 Ga0495676_0322147 3300047321 Bacteria 1038
397 Ga0495680_0000326 3300047322 Bacteria 53618
398 Ga0495680_0005787 3300047322 Bacteria 11569
399 Ga0495680_0014272 3300047322 Bacteria 6886
400 Ga0495680_0076955 3300047322 Bacteria 2528
401 Ga0495680_0160572 3300047322 Bacteria 1632
402 Ga0495675_0000729 3300047444 Bacteria 20553
403 Ga0495675_0037252 3300047444 Bacteria 3097
404 Ga0495675_0086044 3300047444 Bacteria 1976
405 Ga0495675_0118027 3300047444 Bacteria 1653
406 Ga0495684_0006702 3300047471 Bacteria 8938
407 Ga0495684_0015180 3300047471 Bacteria 5931
408 Ga0495684_0168625 3300047471 Bacteria 1629
409 Ga0495593_0037245 3300047673 Bacteria 2632
410 Ga0495602_0000049 3300048088 Bacteria 114354
411 Ga0495602_0075960 3300048088 Bacteria 2849
412 Ga0495602_0162164 3300048088 Bacteria 1744
413 Ga0495602_0174667 3300048088 Bacteria 1663
414 Ga0495602_0190240 3300048088 Bacteria 1574
415 Ga0495602_0191180 3300048088 Bacteria 1569
416 Ga0495602_0260894 3300048088 Bacteria 1285
417 Ga0495626_0000642 3300048091 Bacteria 33724
418 Ga0496100_0096401 3300048903 Bacteria 2029
419 Ga0496101_0029281 3300048904 Bacteria 3851
420 Ga0496102_0129918 3300048905 Bacteria 2357
421 Ga0496102_0308408 3300048905 Bacteria 1491
422 Ga0496104_0013203 3300048907 Bacteria 7445
423 Ga0496104_0055060 3300048907 Bacteria 3760
424 Ga0496105_0003458 3300048908 Bacteria 11685
425 Ga0496105_0011053 3300048908 Bacteria 7116
426 Ga0496105_0128038 3300048908 Bacteria 2093
427 Ga0496106_0052333 3300048909 Bacteria 3080
428 Ga0496107_0005093 3300048910 Bacteria 8959
429 Ga0496108_0016801 3300048911 Bacteria 5979
430 Ga0496108_0036769 3300048911 Bacteria 4075
431 Ga0496108_0047818 3300048911 Bacteria 3576
432 Ga0496109_0181055 3300048912 Bacteria 1979
433 Ga0496109_0286547 3300048912 Bacteria 1552
434 Ga0496110_0027302 3300048913 Bacteria 4893
435 Ga0496110_0172790 3300048913 Bacteria 1961
436 Ga0496110_0423114 3300048913 Bacteria 1214
437 Ga0496110_0484324 3300048913 Bacteria 1127
438 Ga0496111_0043384 3300048914 Bacteria 3232
439 Ga0496111_0090249 3300048914 Bacteria 2245
440 Ga0496112_0000759 3300048915 Bacteria 22635
441 Ga0496112_0034984 3300048915 Bacteria 4889
442 Ga0496113_0015521 3300048916 Bacteria 5239
443 Ga0496113_0021274 3300048916 Bacteria 4573
444 Ga0496113_0190416 3300048916 Bacteria 1628
445 Ga0496114_0039089 3300048917 Bacteria 3926
446 Ga0496115_0011374 3300048918 Bacteria 6669
447 Ga0496115_0017006 3300048918 Bacteria 5547
448 Ga0496115_0154957 3300048918 Bacteria 1893
449 nmdc:mga05p37_23596_c1 3300050507 Bacteria 7466
450 nmdc:mga05p37_4281_c1 3300050507 Bacteria 16670
451 nmdc:mga06r32_493778_c1 3300050510 Bacteria 1201
452 nmdc:mga08y16_31340_c1 3300050511 Bacteria 5592
453 nmdc:mga08y16_356991_c1 3300050511 Bacteria 1501
454 nmdc:mga0n895_134804_c1 3300050512 Bacteria 2496
455 nmdc:mga0n895_206694_c1 3300050512 Bacteria 1994
456 nmdc:mga0n895_313429_c1 3300050512 Bacteria 1590
457 nmdc:mga0rr50_204226_c1 3300050513 Bacteria 1625
458 nmdc:mga0rr50_377105_c1 3300050513 Bacteria 1196
459 nmdc:mga08x19_21383_c1 3300050514 Bacteria 3993
460 Ga0495601_0092462 3300053077 Bacteria 1948
461 Ga0495601_0108625 3300053077 Bacteria 1795
462 Ga0495601_0200415 3300053077 Bacteria 1304
463 Ga0495612_0012449 3300053078 Bacteria 3430
464 Ga0495612_0081495 3300053078 Bacteria 1360
465 Ga0495595_0001782 3300053084 Bacteria 8401
466 Ga0495595_0009049 3300053084 Bacteria 4112
467 Ga0495619_0065411 3300053085 Bacteria 2426
468 Ga0495619_0132568 3300053085 Bacteria 1713
469 Ga0495619_0206362 3300053085 Bacteria 1360
470 Ga0495619_0266297 3300053085 Bacteria 1187
471 Ga0500644_0093844 3300053088 Bacteria 1128
472 Ga0500650_0074438 3300053098 Bacteria 1588
473 Ga0500594_0006537 3300053118 Bacteria 2623
474 2676486989 2675903059 Bacteria 8644972
475 2855670756 2855670206 Bacteria 7120389
476 2855677815 2855676851 Bacteria 7063653
477 2857289686 2857288857 Bacteria 7189066
478 2858849347 2858848962 Bacteria 6963058
479 2858882496 2858882152 Bacteria 7230291
480 2858894671 2858888857 Bacteria 7060307
481 2858895565 2858895516 Bacteria 7378898
482 2867314494 2867312974 Bacteria 7058875
483 2867323320 2867319477 Bacteria 7069771
484 2869049623 2869048445 Bacteria 6875584
485 2869063247 2869061728 Bacteria 7112407
486 2869069655 2869068681 Bacteria 7205615
487 2880490855 2880489317 Bacteria 7096270
488 2880501660 2880495981 Bacteria 7340502
489 2887480891 2887478801 Bacteria 8972725
490 2902582996 2902582711 Bacteria 6187705
491 2929223771 2929219909 Bacteria 6984360
492 2929230163 2929226422 Bacteria 7248583
493 2996225190 2996221748 Bacteria 6799777
494 8001785445 8001781756 Bacteria 9586736
495 8003833920 8003830390 Bacteria 6541657
496 8054705876 8054704163 Bacteria 7247792
497 8054728895 8054727385 Bacteria 7558670
498 8054734760 8054734606 Bacteria 6947278
499 Ga0207646_10310107
500 Ga0070676_10013034
501 Ga0070683_100000877
502 Ga0070683_100022105
503 Ga0070683_100738623
504 Ga0070670_100097136
505 Ga0068869_100030443
506 Ga0068869_100165360
507 Ga0070682_100413025
508 Ga0068868_100008816
509 Ga0068868_100363057
510 Ga0070660_100061457
511 Ga0070661_100375565
512 Ga0070668_100472087
513 Ga0070659_100012787
514 Ga0070709_10000482
515 Ga0070709_10012377
516 Ga0070709_10067201
517 Ga0070709_10180327
518 Ga0070714_100000563
519 Ga0070714_100001859
520 Ga0070714_100009272
521 Ga0070713_100001453
522 Ga0070713_100047595
523 Ga0070713_100202495
524 Ga0070710_10000452
525 Ga0070710_10086450
526 Ga0070711_100000259
527 Ga0070708_100001174
528 Ga0070708_100002228
529 Ga0070708_100080696
530 Ga0070708_100160671
531 Ga0070662_100145138
532 Ga0070681_10356885
533 Ga0070681_10412557
534 Ga0070706_100045367
535 Ga0070706_100059541
536 Ga0070706_100351528
537 Ga0070707_100004919
538 Ga0070707_100013846
539 Ga0070707_100248307
540 Ga0070698_100000596
541 Ga0070698_100020380
542 Ga0070699_100056427
543 Ga0070699_100136713
544 Ga0070684_100002264
545 Ga0070684_100046326
546 Ga0070697_100155308
547 Ga0070695_100292580
548 Ga0070693_100104076
549 Ga0068855_100180078
550 Ga0068855_100354462
551 Ga0070664_100000100
552 Ga0070664_100260334
553 Ga0068857_100027135
554 Ga0068857_100378505
555 Ga0068856_100013922
556 Ga0068856_100030846
557 Ga0068856_100037267
558 Ga0068856_100276922
559 Ga0070702_100082390
560 Ga0068863_100041426
561 Ga0068858_100025221
562 Ga0068858_100068522
563 Ga0081540_1000548
564 Ga0081539_10000430
565 Ga0081539_10001750
566 Ga0070717_10000562
567 Ga0070717_10009810
568 Ga0070717_10014005
569 Ga0070717_10116506
570 Ga0070717_10251468
571 Ga0070717_10315181
572 Ga0070717_10335845
573 Ga0075432_10044119
574 Ga0070715_10000262
575 Ga0070715_10009871
576 Ga0070716_100000717
577 Ga0070716_100114368
578 Ga0070712_100001363
579 Ga0070712_100018958
580 Ga0070712_100040682
581 Ga0097621_100171261
582 Ga0068871_100040624
583 Ga0068871_100056380
584 Ga0075428_100418350
585 Ga0075431_100527152
586 Ga0075433_10031196
587 Ga0075433_10251708
588 Ga0075434_100465572
589 Ga0075436_100013457
590 Ga0075436_100017417
591 Ga0075435_100089623
592 Ga0099794_10035512
593 Ga0111539_10003076
594 Ga0111539_10021896
595 Ga0111539_10047517
596 Ga0105245_10040615
597 Ga0105245_10105704
598 Ga0114129_10000004
599 Ga0114129_10001880
600 Ga0114129_10501929
601 Ga0105237_10180042
602 Ga0105237_10291658
603 Ga0105239_10204317
604 Ga0157370_10082423
605 Ga0157369_10704082
606 Ga0157374_10050883
607 Ga0157374_10194427
608 Ga0163162_10253925
609 Ga0163162_10587523
610 Ga0157377_10052873
611 Ga0157379_10097286
612 Ga0157379_10111998
613 Ga0157376_10157500
614 Ga0213875_10000501
615 Ga0224572_1011731
616 Ga0207692_10000260
617 Ga0207692_10023166
618 Ga0207692_10207721
619 Ga0207642_10064294
620 Ga0207685_10003945
621 Ga0207685_10005311
622 Ga0207685_10020188
623 Ga0207685_10103121
624 Ga0207699_10000522
625 Ga0207699_10000987
626 Ga0207699_10001808
627 Ga0207699_10013008
628 Ga0207699_10250043
629 Ga0207645_10014650
630 Ga0207684_10000954
631 Ga0207684_10006176
632 Ga0207684_10229257
633 Ga0207693_10003821
634 Ga0207693_10039301
635 Ga0207693_10057568
636 Ga0207693_10186757
637 Ga0207693_10262816
638 Ga0207663_10001104
639 Ga0207663_10038326
640 Ga0207663_10070294
641 Ga0207660_10215267
642 Ga0207649_10322556
643 Ga0207646_10001035
644 Ga0207646_10020246
645 Ga0207646_10074921
646 Ga0207646_10197250
647 Ga0207646_10237340
648 Ga0207687_10091096
649 Ga0207700_10000211
650 Ga0207700_10017675
651 Ga0207700_10048739
652 Ga0207700_10051694
653 Ga0207700_10091389
654 Ga0207700_10171673
655 Ga0207664_10000122
656 Ga0207664_10000453
657 Ga0207664_10007028
658 Ga0207664_10494926
659 Ga0207690_10053235
660 Ga0207706_10174820
661 Ga0207665_10000052
662 Ga0207689_10014688
663 Ga0207661_10004656
664 Ga0207661_10088375
665 Ga0207661_10100698
666 Ga0207661_10144162
667 Ga0207679_10024470
668 Ga0207679_10039590
669 Ga0207667_10461167
670 Ga0207640_10537694
671 Ga0207677_10021498
672 Ga0207677_10057420
673 Ga0207677_10087973
674 Ga0207703_10045447
675 Ga0207703_10135694
676 Ga0207678_10012932
677 Ga0207708_10071754
678 Ga0207702_10032135
679 Ga0207702_10053531
680 Ga0207702_10095772
681 Ga0207641_10116752
682 Ga0207676_10095394
683 Ga0207676_10157468
684 Ga0207674_10007436
685 Ga0207683_10034320
686 Ga0268264_10160770
687 Ga0265336_10005282
688 Ga0307515_10002732
689 Ga0265338_10003675
690 Ga0307512_10019452
691 Ga0307513_10003860
692 Ga0307508_10002502
693 Ga0307406_10228866
694 Ga0307407_10250983
695 Ga0307409_100288696
696 Ga0307409_100324495
697 Ga0307411_10353961
698 Ga0307415_100032221
699 Ga0307415_100318334
700 Ga0307415_100321134
701 Ga0373934_0000415
702 Ga0373934_0024790
703 Ga0373934_0077926
704 Ga0373934_0137333
705 Ga0373940_0063646
706 Ga0373951_0000305
707 Ga0373952_0007022
708 Ga0373923_0021934
709 Ga0373932_0003422
710 Ga0373936_0008776
711 Ga0373939_0032438
712 Ga0373941_0152326
713 Ga0373945_0097309
714 Ga0373953_0001889
715 Ga0373953_0015112
716 Ga0373954_0001466
717 Ga0373954_0004284
718 Ga0373954_0089906
719 Ga0373956_0000476
720 Ga0373956_0022095
721 Ga0373956_0130907
722 Ga0373957_0000665
723 Ga0373957_0003976
724 Ga0373960_0004736
725 Ga0373943_0063261
726 Ga0373946_0116243
727 Ga0373955_0000004
728 Ga0373955_0005415
729 Ga0373955_0028065
730 Ga0373955_0128939
731 Ga0373924_0000888
732 Ga0373924_0019179
733 Ga0373924_0055673
734 Ga0373924_0087999
735 Ga0373924_0104128
736 Ga0373935_0060849
737 Ga0373935_0267657
738 Ga0373927_0039079
739 Ga0373927_0043615
740 Ga0373927_0154099
741 Ga0373933_0000005
742 Ga0373933_0007949
743 Ga0373933_0018237
744 Ga0373933_0056248
745 Ga0373933_0132461
746 Ga0373937_0000077
747 Ga0373937_0038582
748 Ga0373937_0050244
749 Ga0373937_0190131
750 Ga0373937_0326338
751 Ga0373925_0002811
752 Ga0373925_0029788
753 Ga0373925_0119766
754 Ga0373925_0246020
755 Ga0373925_0256966
756 Ga0373925_0260281
757 Ga0373925_0289282
758 Ga0395899_0002150
759 Ga0395899_0074816
760 Ga0395900_0021468
761 Ga0395900_0034723
762 Ga0395898_0007753
763 Ga0395898_0008812
764 Ga0395898_0011706
765 Ga0395898_0053624
766 Ga0395905_0004685
767 Ga0395905_0042181
768 Ga0436364_0614465
769 Ga0436364_1316847
770 Ga0395901_0002585
771 Ga0395901_0002983
772 Ga0395901_0035892
773 Ga0395901_0087409
774 Ga0395901_0186267
775 Ga0466963_0077640
776 Ga0466967_0079355
777 Ga0466967_0228146
778 Ga0495592_0000010
779 Ga0495592_0015533
780 Ga0495592_0034847
781 Ga0495592_0121350
782 Ga0495592_0420158
783 Ga0495603_0023190
784 Ga0495629_0080589
785 Ga0495629_0179186
786 Ga0495629_0188841
787 Ga0495641_0104543
788 Ga0495651_0000006
789 Ga0495651_0003311
790 Ga0495651_0005914
791 Ga0495651_0087643
792 Ga0495651_0145319
793 Ga0495653_0009030
794 Ga0495653_0017860
795 Ga0495653_0054553
796 Ga0495653_0066037
797 Ga0495653_0071809
798 Ga0495580_0105334
799 Ga0495582_0098057
800 Ga0495639_0147519
801 Ga0495662_0013631
802 Ga0495664_0109529
803 Ga0495664_0140289
804 Ga0495664_0392585
805 Ga0495606_0006349
806 Ga0495608_0000161
807 Ga0495608_0006242
808 Ga0495608_0006507
809 Ga0495608_0038660
810 Ga0495608_0083803
811 Ga0495618_0015242
812 Ga0495618_0062477
813 Ga0495618_0230348
814 Ga0495618_0279953
815 Ga0495628_0005475
816 Ga0495628_0009917
817 Ga0495628_0088290
818 Ga0495628_0136118
819 Ga0495630_0005638
820 Ga0495630_0050901
821 Ga0495630_0141359
822 Ga0495630_0233752
823 Ga0495652_0004827
824 Ga0495652_0033383
825 Ga0495652_0048388
826 Ga0495652_0094967
827 Ga0495652_0153329
828 Ga0495652_0272085
829 Ga0495665_0063197
830 Ga0495665_0170101
831 Ga0495640_0003463
832 Ga0495640_0061175
833 Ga0495640_0116447
834 Ga0495586_0120202
835 Ga0495587_0000152
836 Ga0495587_0002340
837 Ga0495587_0021908
838 Ga0495587_0026762
839 Ga0495587_0031811
840 Ga0495645_0010651
841 Ga0495645_0036678
842 Ga0495645_0060036
843 Ga0495645_0075773
844 Ga0495667_0000153
845 Ga0495668_0000173
846 Ga0495634_0009096
847 Ga0495634_0047988
848 Ga0495634_0069047
849 Ga0495634_0139008
850 Ga0495625_0001016
851 Ga0495635_0002118
852 Ga0495635_0021545
853 Ga0495635_0058714
854 Ga0495635_0085321
855 Ga0495635_0152731
856 Ga0495588_0067679
857 Ga0495657_0000082
858 Ga0495657_0002073
859 Ga0495657_0014404
860 Ga0495657_0041629
861 Ga0495657_0078916
862 Ga0495599_0000028
863 Ga0495599_0002654
864 Ga0495599_0019354
865 Ga0495599_0091254
866 Ga0495599_0225590
867 Ga0495623_0000746
868 Ga0495623_0041065
869 Ga0495623_0063944
870 Ga0495623_0074202
871 Ga0495623_0159384
872 Ga0495623_0293339
873 Ga0495646_0004936
874 Ga0495646_0008393
875 Ga0495646_0026547
876 Ga0495646_0192239
877 Ga0495613_0081762
878 Ga0495613_0101666
879 Ga0495624_0087365
880 Ga0495600_0002631
881 Ga0495600_0005250
882 Ga0495600_0012188
883 Ga0495581_0041988
884 Ga0495581_0077962
885 Ga0495581_0164962
886 Ga0495604_0000086
887 Ga0495604_0039405
888 Ga0495604_0044149
889 Ga0495674_0003593
890 Ga0495674_0012892
891 Ga0495674_0070285
892 Ga0495674_0079372
893 Ga0495676_0117328
894 Ga0495676_0322147
895 Ga0495680_0000326
896 Ga0495680_0005787
897 Ga0495680_0014272
898 Ga0495680_0076955
899 Ga0495680_0160572
900 Ga0495675_0000729
901 Ga0495675_0037252
902 Ga0495675_0086044
903 Ga0495675_0118027
904 Ga0495684_0006702
905 Ga0495684_0015180
906 Ga0495684_0168625
907 Ga0495593_0037245
908 Ga0495602_0000049
909 Ga0495602_0075960
910 Ga0495602_0162164
911 Ga0495602_0174667
912 Ga0495602_0190240
913 Ga0495602_0191180
914 Ga0495602_0260894
915 Ga0495626_0000642
916 Ga0496100_0096401
917 Ga0496101_0029281
918 Ga0496102_0129918
919 Ga0496102_0308408
920 Ga0496104_0013203
921 Ga0496104_0055060
922 Ga0496105_0003458
923 Ga0496105_0011053
924 Ga0496105_0128038
925 Ga0496106_0052333
926 Ga0496107_0005093
927 Ga0496108_0016801
928 Ga0496108_0036769
929 Ga0496108_0047818
930 Ga0496109_0181055
931 Ga0496109_0286547
932 Ga0496110_0027302
933 Ga0496110_0172790
934 Ga0496110_0423114
935 Ga0496110_0484324
936 Ga0496111_0043384
937 Ga0496111_0090249
938 Ga0496112_0000759
939 Ga0496112_0034984
940 Ga0496113_0015521
941 Ga0496113_0021274
942 Ga0496113_0190416
943 Ga0496114_0039089
944 Ga0496115_0011374
945 Ga0496115_0017006
946 Ga0496115_0154957
947 nmdc:mga05p37_23596_c1
948 nmdc:mga05p37_4281_c1
949 nmdc:mga06r32_493778_c1
950 nmdc:mga08y16_31340_c1
951 nmdc:mga08y16_356991_c1
952 nmdc:mga0n895_134804_c1
953 nmdc:mga0n895_206694_c1
954 nmdc:mga0n895_313429_c1
955 nmdc:mga0rr50_204226_c1
956 nmdc:mga0rr50_377105_c1
957 nmdc:mga08x19_21383_c1
958 Ga0495601_0092462
959 Ga0495601_0108625
960 Ga0495601_0200415
961 Ga0495612_0012449
962 Ga0495612_0081495
963 Ga0495595_0001782
964 Ga0495595_0009049
965 Ga0495619_0065411
966 Ga0495619_0132568
967 Ga0495619_0206362
968 Ga0495619_0266297
969 Ga0500644_0093844
970 Ga0500650_0074438
971 Ga0500594_0006537
972 2676486989
973 2855670756
974 2855677815
975 2857289686
976 2858849347
977 2858882496
978 2858894671
979 2858895565
980 2867314494
981 2867323320
982 2869049623
983 2869063247
984 2869069655
985 2880490855
986 2880501660
987 2887480891
988 2902582996
989 2929223771
990 2929230163
991 2996225190
992 8001785445
993 8003833920
994 8054705876
995 8054728895
996 8054734760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

36

197

0.95

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

244

270

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.912 9 247
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.9109 8 258
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9106 8 247
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9081 11 247
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9075 11 247
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9569 10 259 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9458 10 259 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9221 7 244 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9159 10 259 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.914 7 259 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I6ERF8-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 1, HAAT family 0.9728 8 263 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A6L5DA32-F1-model_v4 deleted 0.9679 16 254
AF-F3NR75-F1-model_v4 Putative branched-chain amino acid ABC transporter ATP-binding protein 0.967 1 260 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A538AXM2-F1-model_v4 ABC transporter ATP-binding protein 0.9646 9 259 GO:0005524
GO:0005886
GO:0016887
AF-A0A3M1ZE58-F1-model_v4 ATP-binding cassette domain-containing protein 0.9632 9 172 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map